Citrus Sinensis ID: 003035

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-----
MRGLKFIEKFKSTQVHALNQQDASSGGCNGCANGSKLSNHKRTKFTGSKSNKTKSGSVAQALLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRAAERS
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcHHHHccccccccccccEEEccccccccccccccccccccccccccccccHHHHHHHHHccccccccEEEEEccEEEEcHHHHHHcccHHHHHHHccccccccccEEEEEcccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHcccHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHcHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccHHcccc
ccccEEEccccccEEEEEcccccccccccccccccccccccccccccccccccccccccHHcccccccHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHcccccccccccccccccHHHEccccccccccccccccccccccccEEEEcccccccccccccEEEEEcccEEEEEHHHHHHccHHHHHHHccccHHHHHHHEccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHccccccccccHEEEHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccccEEcccccHHHHHHHHHHHHHHccHcHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHccHEEEEcEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccHHHcccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccHHHHHHHHHHHHcccccccccccEHHcccc
MRGLKFIEKFKSTQVHAlnqqdassggcngcangsklsnhkrtkftgsksnktksgsvaqallpyglpstdllepsidphlkpihCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERredellgsssmdccgfilecpkaalisgcdpnstydhckcfeenaksnlgpiVEKFVCLsleeddsvtfcvrdkEISFVRNKiaslsspfkamlyggfveskrktidfshdgvsveGLRAVEVYTrtsrvdlfcPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRelpsslynpkvMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIIsehkptgwmyqerslynlgrekivdlnyaseldptlsfpyKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHvrswspadcwiklydrwssvddigSLAVINQMlindpgksFLRFRQSLLLLRLNCQKAAMRCLRLArnhssseherlVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILadtnldpesSTYVIQLLEEALrcpsdglrkgqaLNNLGSIYVEcgkldqaencyinaldikhtrAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDlnmatqldplrtypyryraaers
MRGLKFIEKFKSTQVHAlnqqdassggcNGCANgsklsnhkrtkftgsksnktksgsvAQALLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEenaksnlgpIVEKFVCLSLEEDDSVTFCvrdkeisfvrnkiaslsspfkAMLYGGFVESKRKTidfshdgvsvegLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRelpsslynpKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNyaseldptlsFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLarnhssseherlVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKndlnmatqldplrtypyryraaers
MRGLKFIEKFKSTQVHALNQQDassggcngcangsKLSNHKRtkftgsksnktksgsVAQALLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKsflrfrqsllllrlNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRAAERS
*************************************************************LLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLE***********************************************
**GLK**EKFKSTQVHA**********************************************PYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRF*******KSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERRED*****SSMDCCGFILECPKAALISG***************************FVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAME***VSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRAA***
MRGLKFIEKFKSTQVHALNQQDASSGGCNGCANGSKLSNHKRTK***********GSVAQALLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQY*************REMAKNDLNMATQLDPLRTYPYRYRAAERS
**GLKFIEKFKSTQVHALNQ************************************SVAQALLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRA****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRGLKFIEKFKSTQVHALNQQDASSGGCNGCANGSKLSNHKRTKFTGSKSNKTKSGSVAQALLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLxxxxxxxxxxxxxxxxxxxxxASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRAAERS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query855 2.2.26 [Sep-21-2011]
O65020951 Ethylene-overproduction p yes no 0.992 0.892 0.629 0.0
Q9LV01925 ETO1-like protein 2 OS=Ar no no 0.980 0.905 0.582 0.0
Q9ZQX6888 ETO1-like protein 1 OS=Ar no no 0.893 0.860 0.502 0.0
>sp|O65020|ETO1_ARATH Ethylene-overproduction protein 1 OS=Arabidopsis thaliana GN=ETO1 PE=1 SV=2 Back     alignment and function desciption
 Score = 1120 bits (2896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/879 (62%), Positives = 679/879 (77%), Gaps = 30/879 (3%)

Query: 1   MRGLKFIEKFKSTQVHALNQQDASSGGCNGCANG--------------------SKLSNH 40
           MR LK  E  K TQV+ALN    +     G ++                       LS+H
Sbjct: 1   MRSLKLAEGCKGTQVYALNPSAPTPPPPPGNSSTGGGGGGGSGGGTGGVGDKLLQHLSDH 60

Query: 41  KRTKFTGSKSNKTKSGSV-------AQALLPYGLPSTDLLEPSIDPHLKPIHCVKSLADL 93
            R     SKS++T             + LLP GLP TDLLEP IDP LK +  V+ +A +
Sbjct: 61  LRVNSVRSKSSRTYPPPTQPNAVVSPEFLLPCGLPVTDLLEPQIDPCLKFVDLVEKMAQV 120

Query: 94  YRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFER 153
           YRR E C + +KS  ++EQ A   G+ D KL RR LRS+RQ+A D+H KVVL++WL+FER
Sbjct: 121 YRRIENCSQFEKSGAYLEQCAIFRGISDPKLFRRSLRSSRQHAVDVHAKVVLASWLRFER 180

Query: 154 REDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLS 213
           REDEL+G++SMDCCG  LECPKA L+SG DP S YD C C   +  S    + E     S
Sbjct: 181 REDELIGTTSMDCCGRNLECPKATLVSGYDPESVYDPCVC---SGASRSEMMNEDECSTS 237

Query: 214 LEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRA 273
            E D  ++FC+ D+E+  VR KIASLS PFKAMLYGGF E KR TI+F+ +G+SVEG+RA
Sbjct: 238 QEVDYDMSFCIGDEEVRCVRYKIASLSRPFKAMLYGGFREMKRATINFTQNGISVEGMRA 297

Query: 274 VEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLE 333
            E+++RT+R+D F P +VLELL  ANRFCC+E+KSACD+HLA LV  +++A++LI+YGLE
Sbjct: 298 AEIFSRTNRLDNFPPNVVLELLKLANRFCCDELKSACDSHLAHLVNSLDEAMLLIEYGLE 357

Query: 334 ERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAME 393
           E A LLVA+CLQV LRELPSS++NP V+KIFCS+E  ERLA++GHASF LY+FLSQ+AME
Sbjct: 358 EAAYLLVAACLQVFLRELPSSMHNPNVIKIFCSAEGRERLASLGHASFTLYFFLSQIAME 417

Query: 394 KDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYS 453
            D  SNTTVMLLERL EC+ + W++ LA HQLG VM ER+EYKDA  +F AA +AGH+YS
Sbjct: 418 DDMKSNTTVMLLERLVECAVDSWEKQLAYHQLGVVMLERKEYKDAQRWFNAAVEAGHLYS 477

Query: 454 LAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPT 513
           L G+AR K+K   +YSAYK+INS+IS+HK TGWM+QERSLY  G+EK++DL+ A+E DPT
Sbjct: 478 LVGVARTKFKRDHRYSAYKIINSLISDHKATGWMHQERSLYCSGKEKLLDLDTATEFDPT 537

Query: 514 LSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLA 573
           L+FPYK+RAVA +EE Q  AAI+E+++I+ FK S DCLE+RAW+ I  +DYE AL+D  A
Sbjct: 538 LTFPYKFRAVALVEENQFGAAIAELNKILGFKASPDCLEMRAWISIGMEDYEGALKDIRA 597

Query: 574 LLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQML 633
           LL LE N+MMF+ ++ GDH+V+LL    + WS ADCW++LYDRWSSVDDIGSLAV++ ML
Sbjct: 598 LLTLEPNFMMFNWKIHGDHMVELLRPLAQQWSQADCWMQLYDRWSSVDDIGSLAVVHHML 657

Query: 634 INDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEA 693
            NDPGKS LRFRQSLLLLRLNCQKAAMR LRLARNHS SEHERLVYEGWILYDTGHREEA
Sbjct: 658 ANDPGKSLLRFRQSLLLLRLNCQKAAMRSLRLARNHSKSEHERLVYEGWILYDTGHREEA 717

Query: 694 LSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNN 753
           L++AE+SISI+R+FEAFFLKAY LAD+ LDP+SS YVIQLL+EAL+CPSDGLRKGQALNN
Sbjct: 718 LAKAEESISIQRSFEAFFLKAYALADSTLDPDSSNYVIQLLQEALKCPSDGLRKGQALNN 777

Query: 754 LGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYS 813
           LGS+YV+C KLD A +CY NAL IKHTRAHQGLARVY+LKN+ KAAYDEMTKL+EKAQ +
Sbjct: 778 LGSVYVDCEKLDLAADCYTNALTIKHTRAHQGLARVYHLKNQRKAAYDEMTKLIEKAQNN 837

Query: 814 ASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRAA 852
           ASA+EKRSEY DREMA++DL +ATQLDPLRTYPYRYRAA
Sbjct: 838 ASAYEKRSEYCDREMAQSDLCLATQLDPLRTYPYRYRAA 876
Essential regulator of the ethylene pathway, which acts by regulating the stability of 1-aminocyclopropane-1-carboxylate synthase (ACS) enzymes. May act as a substrate-specific adapter that connects ACS enzymes, such as ACS5, to ubiquitin ligase complexes, leading to proteasomal degradation of ACS enzymes.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LV01|ETOL2_ARATH ETO1-like protein 2 OS=Arabidopsis thaliana GN=EOL2 PE=1 SV=2 Back     alignment and function description
>sp|Q9ZQX6|ETOL1_ARATH ETO1-like protein 1 OS=Arabidopsis thaliana GN=EOL1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query855
224105907896 predicted protein [Populus trichocarpa] 0.959 0.915 0.731 0.0
225434510927 PREDICTED: ethylene-overproduction prote 0.991 0.914 0.705 0.0
255560353911 Ethylene-overproduction protein, putativ 0.971 0.912 0.700 0.0
356566016902 PREDICTED: ethylene-overproduction prote 0.969 0.919 0.663 0.0
356553104955 PREDICTED: ethylene-overproduction prote 0.991 0.887 0.653 0.0
356541801895 PREDICTED: ethylene-overproduction prote 0.961 0.918 0.657 0.0
356500888937 PREDICTED: ethylene-overproduction prote 0.992 0.906 0.659 0.0
297819878947 ethylene-overproduction protein 1 [Arabi 0.991 0.895 0.632 0.0
225439486951 PREDICTED: ethylene-overproduction prote 0.996 0.895 0.650 0.0
50400253951 RecName: Full=Ethylene-overproduction pr 0.992 0.892 0.629 0.0
>gi|224105907|ref|XP_002313975.1| predicted protein [Populus trichocarpa] gi|222850383|gb|EEE87930.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1270 bits (3287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/852 (73%), Positives = 720/852 (84%), Gaps = 32/852 (3%)

Query: 1   MRGLKFIEKFKSTQVHALNQQDASSGGCNGCANGSKLSNHKRTKFTGSKSNKTKSGSVAQ 60
           M G K +++FKSTQVHAL+ QD+     N C+ G KLS   + KFT +       GSVAQ
Sbjct: 1   MHGFKLLDRFKSTQVHALSPQDS-----NPCSRG-KLS---KCKFTNT-------GSVAQ 44

Query: 61  ALLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLG 120
           ALLP GLP+T+LLEPSID +LKPI  V+SLA++YRR  TC ++DKS+L IEQ++ L GLG
Sbjct: 45  ALLPCGLPTTELLEPSIDSYLKPIDYVESLAEIYRRLNTCSQTDKSLLCIEQFSILRGLG 104

Query: 121 DAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALIS 180
           D KLLRRCL +ARQYA D+H KVVLSAWL+FERREDE +G SS DC G+ILECP AAL+S
Sbjct: 105 DPKLLRRCLCAARQYAIDVHSKVVLSAWLRFERREDEFIGVSSKDCSGYILECPMAALVS 164

Query: 181 GCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLS 240
           GCDPNS YDHC+C ++N                LE D  V+FC+ D+ +  VR KIASLS
Sbjct: 165 GCDPNSIYDHCQCGQDN----------------LEADSDVSFCIGDELVHCVRFKIASLS 208

Query: 241 SPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANR 300
           SPFKAMLYG FVES+R  IDFS  G+SV+G+RAV+VY+RT RVDLFCP IVLELLSFANR
Sbjct: 209 SPFKAMLYGSFVESRRDKIDFSKIGISVKGMRAVQVYSRTGRVDLFCPEIVLELLSFANR 268

Query: 301 FCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKV 360
           FCCEE+K ACDAHLASLV   EDALILID+GLEERA LLVASCLQV LRELP+SLYN KV
Sbjct: 269 FCCEELKCACDAHLASLVCGTEDALILIDHGLEERANLLVASCLQVFLRELPNSLYNHKV 328

Query: 361 MKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRML 420
           M +FC+SEA ERLA +GHASFLLYYFLSQVAME++  SN  VMLLE L E +TE+WQ+ L
Sbjct: 329 MSVFCNSEARERLAMLGHASFLLYYFLSQVAMEENVASNAAVMLLEGLEEFATEKWQKAL 388

Query: 421 ALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISE 480
           ALHQLGCVM ER+EYK A +YFEAA +AGH+YSLAG+AR KYK GQQYSA++L+NS+I +
Sbjct: 389 ALHQLGCVMLERKEYKGAQFYFEAAVEAGHVYSLAGVARTKYKQGQQYSAFRLMNSLIFK 448

Query: 481 HKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDR 540
           HKP GWMYQERSLY +G+EKI+D+N A+ELDPTLSFPYK+RAV K+EE QIRAAI+EID+
Sbjct: 449 HKPVGWMYQERSLYGVGQEKIMDMNTATELDPTLSFPYKFRAVMKVEEKQIRAAITEIDK 508

Query: 541 IIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHH 600
           II FKLS DCLELRAW FIA +D+ESALRD  ALL LE  YMMFHGRVSGDHLV+LL+H 
Sbjct: 509 IIGFKLSPDCLELRAWFFIALEDFESALRDIRALLTLEPKYMMFHGRVSGDHLVELLSHR 568

Query: 601 VRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAM 660
           +R W+ ADCW++LY+RWSSVDDIGSLAV++QML NDP KS L FRQSLLLLRLNCQKAAM
Sbjct: 569 IRLWNLADCWMQLYERWSSVDDIGSLAVLHQMLSNDPAKSLLWFRQSLLLLRLNCQKAAM 628

Query: 661 RCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADT 720
           RCLRLARNH+SS HERL+YEGW+L+D+GHREEALSRAEKSISI+R+FEAFFL AY LADT
Sbjct: 629 RCLRLARNHTSSVHERLIYEGWLLFDSGHREEALSRAEKSISIQRSFEAFFLMAYTLADT 688

Query: 721 NLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHT 780
           NLDPESS+ VIQLLEEALRCPSDGLRKGQALNNLGSIYV+CGKLDQA +CY+NAL+IKHT
Sbjct: 689 NLDPESSSTVIQLLEEALRCPSDGLRKGQALNNLGSIYVDCGKLDQAADCYMNALNIKHT 748

Query: 781 RAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDLNMATQLD 840
           RAHQGLARVY+LKN+ KAA+DEMTKL+EKA  SASA+EKRSEY DRE AK+DLNMATQLD
Sbjct: 749 RAHQGLARVYHLKNQRKAAFDEMTKLIEKAHSSASAYEKRSEYCDREKAKDDLNMATQLD 808

Query: 841 PLRTYPYRYRAA 852
           PLRTYPYRYRAA
Sbjct: 809 PLRTYPYRYRAA 820

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225434510|ref|XP_002278414.1| PREDICTED: ethylene-overproduction protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255560353|ref|XP_002521192.1| Ethylene-overproduction protein, putative [Ricinus communis] gi|223539606|gb|EEF41192.1| Ethylene-overproduction protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356566016|ref|XP_003551231.1| PREDICTED: ethylene-overproduction protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356553104|ref|XP_003544898.1| PREDICTED: ethylene-overproduction protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356541801|ref|XP_003539361.1| PREDICTED: ethylene-overproduction protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356500888|ref|XP_003519262.1| PREDICTED: ethylene-overproduction protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|297819878|ref|XP_002877822.1| ethylene-overproduction protein 1 [Arabidopsis lyrata subsp. lyrata] gi|297323660|gb|EFH54081.1| ethylene-overproduction protein 1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225439486|ref|XP_002269998.1| PREDICTED: ethylene-overproduction protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|50400253|sp|O65020.2|ETO1_ARATH RecName: Full=Ethylene-overproduction protein 1; AltName: Full=Protein ETHYLENE OVERPRODUCER 1; Short=Protein ETO1 gi|46810683|gb|AAT01656.1| ethylene overproducer 1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query855
TAIR|locus:2074343959 ETO1 "ETHYLENE OVERPRODUCER 1" 0.921 0.821 0.656 1.7e-288
TAIR|locus:2132402888 EOL1 "ETO1-like 1" [Arabidopsi 0.893 0.860 0.487 3.2e-191
TAIR|locus:2074343 ETO1 "ETHYLENE OVERPRODUCER 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2741 (969.9 bits), Expect = 1.7e-288, Sum P(2) = 1.7e-288
 Identities = 519/791 (65%), Positives = 637/791 (80%)

Query:    62 LLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGD 121
             LLP GLP TDLLEP IDP LK +  V+ +A +YRR E C + +KS  ++EQ A   G+ D
Sbjct:    97 LLPCGLPVTDLLEPQIDPCLKFVDLVEKMAQVYRRIENCSQFEKSGAYLEQCAIFRGISD 156

Query:   122 AKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISG 181
              KL RR LRS+RQ+A D+H KVVL++WL+FERREDEL+G++SMDCCG  LECPKA L+SG
Sbjct:   157 PKLFRRSLRSSRQHAVDVHAKVVLASWLRFERREDELIGTTSMDCCGRNLECPKATLVSG 216

Query:   182 CDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSS 241
              DP S YD C C   +  S    + E     S E D  ++FC+ D+E+  VR KIASLS 
Sbjct:   217 YDPESVYDPCVC---SGASRSEMMNEDECSTSQEVDYDMSFCIGDEEVRCVRYKIASLSR 273

Query:   242 PFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRF 301
             PFKAMLYGGF E KR TI+F+ +G+SVEG+RA E+++RT+R+D F P +VLELL  ANRF
Sbjct:   274 PFKAMLYGGFREMKRATINFTQNGISVEGMRAAEIFSRTNRLDNFPPNVVLELLKLANRF 333

Query:   302 CCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVM 361
             CC+E+KSACD+HLA LV  +++A++LI+YGLEE A LLVA+CLQV LRELPSS++NP V+
Sbjct:   334 CCDELKSACDSHLAHLVNSLDEAMLLIEYGLEEAAYLLVAACLQVFLRELPSSMHNPNVI 393

Query:   362 KIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLA 421
             KIFCS+E  ERLA++GHASF LY+FLSQ+AME D  SNTTVMLLERL EC+ + W++ LA
Sbjct:   394 KIFCSAEGRERLASLGHASFTLYFFLSQIAMEDDMKSNTTVMLLERLVECAVDSWEKQLA 453

Query:   422 LHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEH 481
              HQLG VM ER+EYKDA  +F AA +AGH+YSL G+AR K+K   +YSAYK+INS+IS+H
Sbjct:   454 YHQLGVVMLERKEYKDAQRWFNAAVEAGHLYSLVGVARTKFKRDHRYSAYKIINSLISDH 513

Query:   482 KPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRI 541
             K TGWM+QERSLY  G+EK++DL+ A+E DPTL+FPYK+RAVA +EE Q  AAI+E+++I
Sbjct:   514 KATGWMHQERSLYCSGKEKLLDLDTATEFDPTLTFPYKFRAVALVEENQFGAAIAELNKI 573

Query:   542 IVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHV 601
             + FK S DCLE+RAW+ I  +DYE AL+D  ALL LE N+MMF+ ++ GDH+V+LL    
Sbjct:   574 LGFKASPDCLEMRAWISIGMEDYEGALKDIRALLTLEPNFMMFNWKIHGDHMVELLRPLA 633

Query:   602 RSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKXXXXXXXXXXXXXXNCQKAAMR 661
             + WS ADCW++LYDRWSSVDDIGSLAV++ ML NDPGK              NCQKAAMR
Sbjct:   634 QQWSQADCWMQLYDRWSSVDDIGSLAVVHHMLANDPGKSLLRFRQSLLLLRLNCQKAAMR 693

Query:   662 CLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTN 721
              LRLARNHS SEHERLVYEGWILYDTGHREEAL++AE+SISI+R+FEAFFLKAY LAD+ 
Sbjct:   694 SLRLARNHSKSEHERLVYEGWILYDTGHREEALAKAEESISIQRSFEAFFLKAYALADST 753

Query:   722 LDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTR 781
             LDP+SS YVIQLL+EAL+CPSDGLRKGQALNNLGS+YV+C KLD A +CY NAL IKHTR
Sbjct:   754 LDPDSSNYVIQLLQEALKCPSDGLRKGQALNNLGSVYVDCEKLDLAADCYTNALTIKHTR 813

Query:   782 AHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDLNMATQLDP 841
             AHQGLARVY+LKN+ KAAYDEMTKL+EKAQ +ASA+EKRSEY DREMA++DL +ATQLDP
Sbjct:   814 AHQGLARVYHLKNQRKAAYDEMTKLIEKAQNNASAYEKRSEYCDREMAQSDLCLATQLDP 873

Query:   842 LRTYPYRYRAA 852
             LRTYPYRYRAA
Sbjct:   874 LRTYPYRYRAA 884
GO:0005634 "nucleus" evidence=ISM
GO:0009693 "ethylene biosynthetic process" evidence=IMP
GO:0010182 "sugar mediated signaling pathway" evidence=RCA;TAS
GO:0005515 "protein binding" evidence=IPI
GO:0010364 "regulation of ethylene biosynthetic process" evidence=IDA
GO:0030674 "protein binding, bridging" evidence=IPI
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=IPI
GO:0017145 "stem cell division" evidence=IMP
GO:2000069 "regulation of post-embryonic root development" evidence=IMP
GO:0006487 "protein N-linked glycosylation" evidence=RCA
GO:0009755 "hormone-mediated signaling pathway" evidence=RCA
GO:0048825 "cotyledon development" evidence=RCA
GO:0016036 "cellular response to phosphate starvation" evidence=IMP
TAIR|locus:2132402 EOL1 "ETO1-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O65020ETO1_ARATHNo assigned EC number0.62910.99290.8927yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00024050001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (922 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query855
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 2e-08
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 7e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.001
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.001
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information 
 Score = 52.3 bits (126), Expect = 2e-08
 Identities = 30/98 (30%), Positives = 43/98 (43%), Gaps = 3/98 (3%)

Query: 220 VTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTR 279
           VT  V  K+    +  +A+ S  FKA+    F ES +  I    D VS E  RA+  +  
Sbjct: 2   VTLVVGGKKFHAHKAVLAAHSPYFKALFSSDFKESDKSEIYL--DDVSPEDFRALLNFLY 59

Query: 280 TSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASL 317
           T ++DL     V ELL  A+      +   C+  L  L
Sbjct: 60  TGKLDL-PEENVEELLELADYLQIPGLVELCEEFLLKL 96

Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures. Length = 97
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 855
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.98
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.97
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.97
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.95
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.95
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.95
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.95
KOG0547606 consensus Translocase of outer mitochondrial membr 99.95
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.94
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.93
PHA02790480 Kelch-like protein; Provisional 99.93
PHA02713557 hypothetical protein; Provisional 99.92
KOG4350620 consensus Uncharacterized conserved protein, conta 99.92
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.91
PHA03098534 kelch-like protein; Provisional 99.91
PRK14574 822 hmsH outer membrane protein; Provisional 99.9
KOG0547606 consensus Translocase of outer mitochondrial membr 99.89
KOG1126638 consensus DNA-binding cell division cycle control 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.88
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.88
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.87
PRK11788389 tetratricopeptide repeat protein; Provisional 99.87
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.85
PRK14574 822 hmsH outer membrane protein; Provisional 99.83
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.82
KOG1126638 consensus DNA-binding cell division cycle control 99.82
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.8
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.79
KOG2003 840 consensus TPR repeat-containing protein [General f 99.79
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.78
PRK11189296 lipoprotein NlpI; Provisional 99.77
KOG2076 895 consensus RNA polymerase III transcription factor 99.76
PRK12370553 invasion protein regulator; Provisional 99.76
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.75
KOG2003840 consensus TPR repeat-containing protein [General f 99.75
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.75
PRK12370553 invasion protein regulator; Provisional 99.75
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.74
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.74
PRK11189296 lipoprotein NlpI; Provisional 99.74
PLN03218 1060 maturation of RBCL 1; Provisional 99.73
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.73
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.73
KOG2075521 consensus Topoisomerase TOP1-interacting protein B 99.72
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.72
KOG4591280 consensus Uncharacterized conserved protein, conta 99.72
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.71
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.71
PLN03077 857 Protein ECB2; Provisional 99.71
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.71
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.7
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.7
KOG1129478 consensus TPR repeat-containing protein [General f 99.69
PLN03077 857 Protein ECB2; Provisional 99.69
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.68
KOG2076 895 consensus RNA polymerase III transcription factor 99.68
PLN03218 1060 maturation of RBCL 1; Provisional 99.67
KOG1125579 consensus TPR repeat-containing protein [General f 99.67
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.67
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
KOG1125579 consensus TPR repeat-containing protein [General f 99.66
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.66
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.65
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.64
PLN02789320 farnesyltranstransferase 99.64
KOG1129478 consensus TPR repeat-containing protein [General f 99.62
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.62
PLN02789320 farnesyltranstransferase 99.61
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.61
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.61
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.59
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.59
KOG07831267 consensus Uncharacterized conserved protein, conta 99.58
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.58
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.57
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.55
KOG4682488 consensus Uncharacterized conserved protein, conta 99.54
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.49
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.47
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.47
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.46
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.45
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.42
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.4
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.39
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.39
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.38
PRK15359144 type III secretion system chaperone protein SscB; 99.36
PRK15359144 type III secretion system chaperone protein SscB; 99.35
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.34
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.34
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.31
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.29
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.28
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.28
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.26
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.26
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.25
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.25
PRK10370198 formate-dependent nitrite reductase complex subuni 99.23
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.23
PRK10370198 formate-dependent nitrite reductase complex subuni 99.23
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.22
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.19
PRK04841 903 transcriptional regulator MalT; Provisional 99.19
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.19
PRK04841903 transcriptional regulator MalT; Provisional 99.17
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.17
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.12
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.11
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.09
KOG1128777 consensus Uncharacterized conserved protein, conta 99.05
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.04
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.04
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.01
KOG0553304 consensus TPR repeat-containing protein [General f 98.99
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.97
KOG0553304 consensus TPR repeat-containing protein [General f 98.96
KOG1128777 consensus Uncharacterized conserved protein, conta 98.94
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.93
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.91
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.9
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.89
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.88
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.87
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.84
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.83
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.82
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.82
KOG0511516 consensus Ankyrin repeat protein [General function 98.82
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.79
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.76
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.74
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.74
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.73
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.72
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.71
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.68
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.68
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.68
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.67
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.67
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.66
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.66
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.64
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.64
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.63
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.63
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.62
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.61
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.57
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.57
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.57
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.57
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.55
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.52
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.51
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.5
PRK10803263 tol-pal system protein YbgF; Provisional 98.48
PRK11906458 transcriptional regulator; Provisional 98.48
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.48
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.48
PRK11906458 transcriptional regulator; Provisional 98.46
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.45
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.43
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.42
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.4
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.4
PF12688120 TPR_5: Tetratrico peptide repeat 98.35
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.31
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.31
KOG07831267 consensus Uncharacterized conserved protein, conta 98.31
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.3
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.3
PF12688120 TPR_5: Tetratrico peptide repeat 98.28
COG4700251 Uncharacterized protein conserved in bacteria cont 98.27
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.27
PRK10803263 tol-pal system protein YbgF; Provisional 98.26
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.25
PRK15331165 chaperone protein SicA; Provisional 98.24
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 98.23
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.19
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.17
PF1337173 TPR_9: Tetratricopeptide repeat 98.16
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.14
COG4700251 Uncharacterized protein conserved in bacteria cont 98.12
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.12
PRK15331165 chaperone protein SicA; Provisional 98.11
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.11
KOG4555175 consensus TPR repeat-containing protein [Function 98.1
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.09
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.07
COG3898531 Uncharacterized membrane-bound protein [Function u 98.05
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.04
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.04
COG3898531 Uncharacterized membrane-bound protein [Function u 98.02
PF1337173 TPR_9: Tetratricopeptide repeat 98.01
KOG4234271 consensus TPR repeat-containing protein [General f 98.01
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.0
KOG4555175 consensus TPR repeat-containing protein [Function 97.97
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.97
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.96
KOG4234271 consensus TPR repeat-containing protein [General f 97.94
KOG2838401 consensus Uncharacterized conserved protein, conta 97.94
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.93
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.92
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.91
PF13512142 TPR_18: Tetratricopeptide repeat 97.88
PF13512142 TPR_18: Tetratricopeptide repeat 97.88
KOG2716230 consensus Polymerase delta-interacting protein PDI 97.87
KOG1987297 consensus Speckle-type POZ protein SPOP and relate 97.78
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.75
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.72
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.7
KOG2300629 consensus Uncharacterized conserved protein [Funct 97.65
KOG3473112 consensus RNA polymerase II transcription elongati 97.59
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 97.58
KOG2300 629 consensus Uncharacterized conserved protein [Funct 97.53
KOG1550552 consensus Extracellular protein SEL-1 and related 97.53
PF1342844 TPR_14: Tetratricopeptide repeat 97.51
KOG2471 696 consensus TPR repeat-containing protein [General f 97.5
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.47
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.46
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.46
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.45
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.44
PF1343134 TPR_17: Tetratricopeptide repeat 97.41
KOG1585308 consensus Protein required for fusion of vesicles 97.39
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.38
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.34
KOG2471696 consensus TPR repeat-containing protein [General f 97.32
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.31
KOG2610 491 consensus Uncharacterized conserved protein [Funct 97.31
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.3
KOG1586288 consensus Protein required for fusion of vesicles 97.28
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.27
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.21
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.2
PF1343134 TPR_17: Tetratricopeptide repeat 97.2
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.16
PF1342844 TPR_14: Tetratricopeptide repeat 97.16
KOG1550552 consensus Extracellular protein SEL-1 and related 97.12
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.11
KOG1586288 consensus Protein required for fusion of vesicles 97.1
KOG2838401 consensus Uncharacterized conserved protein, conta 97.08
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.07
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.06
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.03
KOG4507 886 consensus Uncharacterized conserved protein, conta 96.97
KOG1585308 consensus Protein required for fusion of vesicles 96.95
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.95
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 96.95
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.93
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.92
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 96.87
KOG0530318 consensus Protein farnesyltransferase, alpha subun 96.83
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.78
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 96.77
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.73
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.72
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.68
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 96.66
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.64
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 96.63
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.6
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.53
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.44
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.43
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 96.37
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.34
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 96.33
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 96.27
KOG1665302 consensus AFH1-interacting protein FIP2, contains 96.19
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.18
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 96.17
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 96.13
PF07707103 BACK: BTB And C-terminal Kelch; InterPro: IPR01170 96.11
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 96.05
PF11822317 DUF3342: Domain of unknown function (DUF3342); Int 95.98
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 95.89
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.89
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.88
KOG2714465 consensus SETA binding protein SB1 and related pro 95.88
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.77
KOG0530318 consensus Protein farnesyltransferase, alpha subun 95.7
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.67
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.66
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 95.61
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.61
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.55
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 95.45
KOG1724162 consensus SCF ubiquitin ligase, Skp1 component [Po 95.38
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.36
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.03
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 95.02
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.98
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 94.98
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 94.94
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.69
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 94.51
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 94.37
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 94.12
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 93.99
KOG4014248 consensus Uncharacterized conserved protein (conta 93.91
smart00875101 BACK BTB And C-terminal Kelch. The BACK domain is 93.83
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.65
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 93.56
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 93.43
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.4
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 93.38
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 93.36
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 93.34
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 93.25
KOG1463411 consensus 26S proteasome regulatory complex, subun 93.21
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 93.18
COG5159421 RPN6 26S proteasome regulatory complex component [ 93.15
COG4976287 Predicted methyltransferase (contains TPR repeat) 93.05
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.03
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 92.72
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.43
KOG1778319 consensus CREB binding protein/P300 and related TA 92.41
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 92.28
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.18
COG5159421 RPN6 26S proteasome regulatory complex component [ 92.06
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.97
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 91.91
KOG3783546 consensus Uncharacterized conserved protein [Funct 91.73
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.7
KOG1463411 consensus 26S proteasome regulatory complex, subun 91.67
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 91.42
KOG4507 886 consensus Uncharacterized conserved protein, conta 91.27
PRK10941269 hypothetical protein; Provisional 91.17
COG4976 287 Predicted methyltransferase (contains TPR repeat) 91.12
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 91.12
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 90.64
COG1747 711 Uncharacterized N-terminal domain of the transcrip 90.09
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 89.98
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 89.74
PRK10941269 hypothetical protein; Provisional 89.68
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 89.47
PF0146678 Skp1: Skp1 family, dimerisation domain; InterPro: 89.21
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 88.74
PF1286294 Apc5: Anaphase-promoting complex subunit 5 88.56
KOG3364149 consensus Membrane protein involved in organellar 88.45
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 88.39
KOG2581 493 consensus 26S proteasome regulatory complex, subun 87.85
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 87.81
KOG0529 421 consensus Protein geranylgeranyltransferase type I 87.66
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 87.59
KOG20411189 consensus WD40 repeat protein [General function pr 87.38
KOG2715210 consensus Uncharacterized conserved protein, conta 87.13
KOG0511516 consensus Ankyrin repeat protein [General function 87.12
KOG3364149 consensus Membrane protein involved in organellar 87.11
KOG2422665 consensus Uncharacterized conserved protein [Funct 86.94
KOG3783546 consensus Uncharacterized conserved protein [Funct 86.92
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 86.8
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 86.37
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 86.3
PF1286294 Apc5: Anaphase-promoting complex subunit 5 86.21
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 86.04
COG5201158 SKP1 SCF ubiquitin ligase, SKP1 component [Posttra 85.8
KOG1258577 consensus mRNA processing protein [RNA processing 85.63
KOG1310 758 consensus WD40 repeat protein [General function pr 85.52
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 85.4
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 85.07
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 84.17
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 84.02
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 83.8
KOG1258577 consensus mRNA processing protein [RNA processing 83.57
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 82.76
KOG0529 421 consensus Protein geranylgeranyltransferase type I 82.15
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 82.14
KOG3840438 consensus Uncharaterized conserved protein, contai 81.23
COG2912269 Uncharacterized conserved protein [Function unknow 81.23
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 81.16
KOG2041 1189 consensus WD40 repeat protein [General function pr 80.22
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 80.11
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=9.3e-41  Score=362.26  Aligned_cols=401  Identities=18%  Similarity=0.153  Sum_probs=321.0

Q ss_pred             hhhHHHHHHHHhhchhhHHHHHHHHHHhhhhHhhhhcHHHHHHHHHHHHHhcc--hhhhhhHHHHHHHhCChHHHHHHHH
Q 003035          398 SNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGH--IYSLAGLARAKYKVGQQYSAYKLIN  475 (855)
Q Consensus       398 ~~~a~~~le~~~~~~~~~~~~~~a~~~LG~~~l~~g~~~eA~~~~~~Al~~~~--~~a~~~la~~~~~~g~~~~A~~~l~  475 (855)
                      +++..+.-..+++..|   +-+++|.++|+++.++|++++|+..|+.+++.++  ..++.++|.++..+|+...|.+.+.
T Consensus        98 ~d~s~a~~~~a~r~~~---q~ae~ysn~aN~~kerg~~~~al~~y~~aiel~p~fida~inla~al~~~~~~~~a~~~~~  174 (966)
T KOG4626|consen   98 LDKSSAGSLLAIRKNP---QGAEAYSNLANILKERGQLQDALALYRAAIELKPKFIDAYINLAAALVTQGDLELAVQCFF  174 (966)
T ss_pred             hhhhhhhhhhhhhccc---hHHHHHHHHHHHHHHhchHHHHHHHHHHHHhcCchhhHHHhhHHHHHHhcCCCcccHHHHH
Confidence            4444444444555543   4467999999999999999999999999998765  6789999999999999999999999


Q ss_pred             hHHHcCCCchHHHHHHhh----ccCcchHHHHHHHHHHhCCCCchhHHHHHHHHHHhCCHHHHHHHHHHHHccCCC-HhH
Q 003035          476 SIISEHKPTGWMYQERSL----YNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLS-VDC  550 (855)
Q Consensus       476 ~~i~~~p~~~~~y~~~~~----~~~~~~A~~~l~~a~~ldP~~~~a~~~~a~~~~~~~~~~~A~~~~~k~l~~~p~-~~~  550 (855)
                      .++..+|.+.-+....+.    .+...+|...|.+|++.+|....+|.++|-++..+|+.-.|+..|.++++++|+ .++
T Consensus       175 ~alqlnP~l~ca~s~lgnLlka~Grl~ea~~cYlkAi~~qp~fAiawsnLg~~f~~~Gei~~aiq~y~eAvkldP~f~dA  254 (966)
T KOG4626|consen  175 EALQLNPDLYCARSDLGNLLKAEGRLEEAKACYLKAIETQPCFAIAWSNLGCVFNAQGEIWLAIQHYEEAVKLDPNFLDA  254 (966)
T ss_pred             HHHhcCcchhhhhcchhHHHHhhcccchhHHHHHHHHhhCCceeeeehhcchHHhhcchHHHHHHHHHHhhcCCCcchHH
Confidence            999999976443322222    234589999999999999999999999999999999999999999999999996 789


Q ss_pred             HHHHHHHHHHcCCHHHHHHHHHHHHhcCCchhhhhcccchhHHHHHHHHHhhccChhhhHHHHhhhcccccccchHHHHH
Q 003035          551 LELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVIN  630 (855)
Q Consensus       551 l~lra~~y~~~gd~~~A~~~~~~aL~~~P~~~~~~~~~~~~~l~~ll~~~~~~~~~a~~~~~~~~~~~~~~d~~al~~~~  630 (855)
                      +.++|.+|..++.++.|+..|.+++.+.|++.+.+++++.-+..+      +..+                  -++..+.
T Consensus       255 YiNLGnV~ke~~~~d~Avs~Y~rAl~lrpn~A~a~gNla~iYyeq------G~ld------------------lAI~~Yk  310 (966)
T KOG4626|consen  255 YINLGNVYKEARIFDRAVSCYLRALNLRPNHAVAHGNLACIYYEQ------GLLD------------------LAIDTYK  310 (966)
T ss_pred             HhhHHHHHHHHhcchHHHHHHHHHHhcCCcchhhccceEEEEecc------ccHH------------------HHHHHHH
Confidence            999999999999999999999999999999988888775432111      0000                  1344566


Q ss_pred             HHHHcCCCChHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHCCCHHHHHHHHHHHHhccCCh-HH
Q 003035          631 QMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTF-EA  709 (855)
Q Consensus       631 ~~l~~~p~~~~~~~~~a~~l~~~g~~~~A~~~l~~al~~~p~~~~~~~~lg~~~~~~g~~~eAl~~~~kal~~~p~~-~a  709 (855)
                      ++++..|.-+.++..+|..+-..|+..+|..+|.+++.+.|+.+++.++||.++..+|.+++|...|+++++.+|.+ .+
T Consensus       311 ral~~~P~F~~Ay~NlanALkd~G~V~ea~~cYnkaL~l~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v~p~~aaa  390 (966)
T KOG4626|consen  311 RALELQPNFPDAYNNLANALKDKGSVTEAVDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEVFPEFAAA  390 (966)
T ss_pred             HHHhcCCCchHHHhHHHHHHHhccchHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhccchHHHHHHHHHHhhChhhhhh
Confidence            77777788888888888888888888888888888888888888888888888888888888888888888888887 77


Q ss_pred             HHHHHHHHHHCCCCchhHHHHHHHHHHHhcCCCCCCCHH--HHHHHHHHHHHHcCCHHHHHHHHHHHHhcc--cHHHHHH
Q 003035          710 FFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKG--QALNNLGSIYVECGKLDQAENCYINALDIK--HTRAHQG  785 (855)
Q Consensus       710 ~~~lg~~~~~~g~~~~A~~~~~~lle~al~~~~~~~~p~--~a~~~LG~~y~~~g~~~~A~~~~~kAL~~~--~~~a~~~  785 (855)
                      +.++|.+|.++|++++|+..    |++++     .+.|.  +++.|+|.+|..+|+.+.|+++|.+||.++  ..+++.|
T Consensus       391 ~nNLa~i~kqqgnl~~Ai~~----Ykeal-----rI~P~fAda~~NmGnt~ke~g~v~~A~q~y~rAI~~nPt~AeAhsN  461 (966)
T KOG4626|consen  391 HNNLASIYKQQGNLDDAIMC----YKEAL-----RIKPTFADALSNMGNTYKEMGDVSAAIQCYTRAIQINPTFAEAHSN  461 (966)
T ss_pred             hhhHHHHHHhcccHHHHHHH----HHHHH-----hcCchHHHHHHhcchHHHHhhhHHHHHHHHHHHHhcCcHHHHHHhh
Confidence            88888888888888888777    88888     77777  788888888888888888888888888877  7777888


Q ss_pred             HHHHHHHcCCHHHHHHHHHHHHHHccCCHHHHHHHhh-------cCCHHHHHHHHH
Q 003035          786 LARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSE-------YSDREMAKNDLN  834 (855)
Q Consensus       786 lg~~~~~~g~~~~A~~~~~kal~~~p~~~~a~~~lg~-------~g~~eeA~~~~~  834 (855)
                      ||.+|...|+..+|+..|+++++++||.++++-+|..       .-|+++-.+-+.
T Consensus       462 Lasi~kDsGni~~AI~sY~~aLklkPDfpdA~cNllh~lq~vcdw~D~d~~~~kl~  517 (966)
T KOG4626|consen  462 LASIYKDSGNIPEAIQSYRTALKLKPDFPDAYCNLLHCLQIVCDWTDYDKRMKKLV  517 (966)
T ss_pred             HHHHhhccCCcHHHHHHHHHHHccCCCCchhhhHHHHHHHHHhcccchHHHHHHHH
Confidence            8888888888888888888888888888888777776       345555444333

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4350 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2075 consensus Topoisomerase TOP1-interacting protein BTBD1 [Function unknown] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG4591 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4682 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2716 consensus Polymerase delta-interacting protein PDIP1 and related proteins, contain BTB/POZ domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1987 consensus Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3473 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin C [Transcription] Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO) Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2714 consensus SETA binding protein SB1 and related proteins, contain BTB/POZ domain [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG1724 consensus SCF ubiquitin ligase, Skp1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>smart00875 BACK BTB And C-terminal Kelch Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1778 consensus CREB binding protein/P300 and related TAZ Zn-finger proteins [Transcription] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF01466 Skp1: Skp1 family, dimerisation domain; InterPro: IPR016072 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2715 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5201 SKP1 SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3840 consensus Uncharaterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query855
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-17
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-14
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-12
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-04
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-12
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-10
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-06
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-12
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 8e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-06
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-04
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-11
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-10
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-09
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-11
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-08
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 9e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 7e-11
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-10
3u4t_A 272 TPR repeat-containing protein; structural genomics 7e-05
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 2e-10
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-05
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-08
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-08
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-04
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 2e-09
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 8e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-04
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 6e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 8e-09
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 1e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 4e-04
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-08
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-06
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 5e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-08
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-08
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-07
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 9e-06
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 7e-08
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-06
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 6e-05
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 6e-05
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 7e-08
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 8e-05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-04
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 8e-08
4g1t_A472 Interferon-induced protein with tetratricopeptide 8e-08
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-06
4g1t_A 472 Interferon-induced protein with tetratricopeptide 6e-06
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 1e-07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 9e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-05
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 2e-07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 7e-06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-04
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-07
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-07
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 4e-07
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 6e-07
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-06
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 6e-07
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-05
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 6e-07
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-06
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-04
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 7e-07
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-06
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 8e-07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-06
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-06
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-05
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 5e-05
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-06
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 9e-05
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-04
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-05
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 4e-06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 6e-06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 3e-05
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 7e-04
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 8e-06
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 3e-04
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 3e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 4e-05
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 7e-05
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 7e-05
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 1e-04
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 3e-04
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 7e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 7e-04
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 2e-04
2vpk_A116 Myoneurin; transcription regulation, transcription 3e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 3e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-04
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 4e-04
2kat_A115 Uncharacterized protein; NESG, structure, structur 8e-04
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 8e-04
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
 Score = 82.8 bits (205), Expect = 8e-17
 Identities = 52/382 (13%), Positives = 117/382 (30%), Gaps = 31/382 (8%)

Query: 492 SLYNLGR--EKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFK-LSV 548
            L   G+  + +   + A + DP     Y  RA   +  G+ +AA+ ++ ++I  K    
Sbjct: 35  KLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFT 94

Query: 549 DCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPAD 608
                R  L +     + A  D   +L    +        S       +         A 
Sbjct: 95  AARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENEEKEAQSQLIKSDEMQRLRSQ---AL 151

Query: 609 CWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARN 668
                   +++      +A ++++L      + LR  ++   ++    + A+  L+ A  
Sbjct: 152 NAFGS-GDYTAA-----IAFLDKILEVCVWDAELRELRAECFIKEGEPRKAISDLKAASK 205

Query: 669 HSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTF-EAFFLKAYILADTNLDPESS 727
             +   E       + Y  G  E +LS   + + +++     F     +     L   + 
Sbjct: 206 LKNDNTEAFYKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAE 265

Query: 728 TYV--------IQLLEEALRC-PSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIK 778
             +            E  ++  PS      ++   +   + +  K  +A       L ++
Sbjct: 266 ELIRDGRYTDATSKYESVMKTEPSIAEYTVRSKERICHCFSKDEKPVEAIRVCSEVLQME 325

Query: 779 --HTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRS--EYSDREMAKNDLN 834
             +  A +  A  Y ++     A  +     E  +      E     +   ++  K D  
Sbjct: 326 PDNVNALKDRAEAYLIEEMYDEAIQDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYY 385

Query: 835 MATQLDPLRTYP-----YRYRA 851
               +            YR  A
Sbjct: 386 KILGVKRNAKKQEIIKAYRKLA 407
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query855
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.98
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.98
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.97
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.97
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.97
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.96
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.96
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.96
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.95
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.95
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.95
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.94
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.94
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.94
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.94
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.93
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.93
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 99.93
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.92
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.92
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.92
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.91
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.91
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.91
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.91
3u4t_A272 TPR repeat-containing protein; structural genomics 99.9
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.9
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.9
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.89
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.88
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.88
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.88
3u4t_A272 TPR repeat-containing protein; structural genomics 99.88
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.87
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.87
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.87
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.87
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.86
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.86
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.86
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.86
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.86
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.86
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.85
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.85
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.85
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.85
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.85
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.85
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.84
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.84
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.84
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.82
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.82
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.82
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.82
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.82
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.82
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.81
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.81
2vpk_A116 Myoneurin; transcription regulation, transcription 99.81
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.81
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.81
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.81
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.81
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.8
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.79
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.79
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.79
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.78
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.78
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.78
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.78
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.78
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.78
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.78
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.77
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.77
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.77
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.77
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.76
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.75
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.75
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.74
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.74
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.74
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.74
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.73
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.73
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.72
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.71
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.71
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.71
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.7
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.7
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.7
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.7
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.69
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.69
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.69
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.67
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.65
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.65
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.65
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.63
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.63
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.61
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.61
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.59
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.59
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.59
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.57
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.57
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.56
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.56
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.55
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.55
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.55
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.54
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.54
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.54
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.53
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.52
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.52
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.5
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.5
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.48
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.48
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 99.48
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.47
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.46
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.46
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.43
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.43
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.41
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.41
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.4
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.4
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.4
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.4
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.39
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.39
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.39
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.38
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.37
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.36
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.36
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.35
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.35
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.34
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.34
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.34
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.34
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.34
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.31
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.31
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.31
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.29
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.28
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.28
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.27
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.27
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.26
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.26
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.26
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.25
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.25
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.25
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.25
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.23
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.23
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.23
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.22
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.22
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.22
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.22
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.21
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.21
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.2
4ajy_C97 Transcription elongation factor B polypeptide 1; E 99.19
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.19
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.19
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.18
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.17
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.16
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.13
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.13
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.13
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.13
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.13
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.12
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.12
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.11
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.07
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 99.06
3k9i_A117 BH0479 protein; putative protein binding protein, 99.06
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.06
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.04
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.04
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.03
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.03
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.02
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.01
3k9i_A117 BH0479 protein; putative protein binding protein, 99.0
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.0
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 98.95
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.94
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.93
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.82
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.8
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.79
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.78
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.78
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.77
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.75
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.74
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.73
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.66
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.63
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.62
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.62
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.6
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.6
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.51
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 98.46
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.42
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.35
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 98.34
2fnj_C96 Transcription elongation factor B polypeptide 1; b 98.34
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 98.34
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.33
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.27
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.09
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.09
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.08
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.06
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.0
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.93
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.91
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.91
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 97.9
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.88
2eqx_A105 Kelch repeat and BTB domain-containing protein 4; 97.83
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.59
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 97.54
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.37
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.3
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.96
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.74
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.52
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.25
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.24
3kvt_A115 Potassium channel protein SHAW; tetramerization do 95.71
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.59
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 95.53
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.38
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 95.21
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 95.19
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 94.98
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 94.97
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 94.89
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.88
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 94.54
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.05
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 92.14
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 91.76
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 91.72
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.46
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 91.23
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 90.81
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 89.89
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 89.42
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.13
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 87.86
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 87.31
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 86.32
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 86.17
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 86.0
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 85.95
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 85.72
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 85.4
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 85.09
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 85.07
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 84.95
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 81.07
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 80.65
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 80.46
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 80.42
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=100.00  E-value=9.8e-36  Score=333.15  Aligned_cols=360  Identities=16%  Similarity=0.095  Sum_probs=216.2

Q ss_pred             hhhhHhhhhcHHHHHHHHHHHHHhcc--hhhhhhHHHHHHHhCChHHHHHHHHhHHHcCCCchHHHHHHhh----ccCcc
Q 003035          425 LGCVMFEREEYKDACYYFEAAADAGH--IYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSL----YNLGR  498 (855)
Q Consensus       425 LG~~~l~~g~~~eA~~~~~~Al~~~~--~~a~~~la~~~~~~g~~~~A~~~l~~~i~~~p~~~~~y~~~~~----~~~~~  498 (855)
                      +|..+++.|++++|+..|+++++..|  ..++..++.++...|+.++|...++.+++..|.+..++...+.    .+..+
T Consensus         5 ~a~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~a~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~~~   84 (388)
T 1w3b_A            5 LAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQ   84 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHH
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCchHHHHHHHHHHHHCCCHH
Confidence            44455555555555555555554432  2344455555555555544444433333333333222221111    01123


Q ss_pred             hHHHHHHHHHHhCCCCchhHHHHHHHHHHhCCHHHHHHHHHHHHccCCC-HhHHHHHHHHHHHcCCHHHHHHHHHHHHhc
Q 003035          499 EKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLS-VDCLELRAWLFIAADDYESALRDTLALLAL  577 (855)
Q Consensus       499 ~A~~~l~~a~~ldP~~~~a~~~~a~~~~~~~~~~~A~~~~~k~l~~~p~-~~~l~lra~~y~~~gd~~~A~~~~~~aL~~  577 (855)
                      +|+..|+++++++|++..+|..+|.++...|++++|+..|+++++.+|+ ...+..+|.++..+|++++|++.|++++..
T Consensus        85 ~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~  164 (388)
T 1w3b_A           85 EAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIET  164 (388)
T ss_dssp             HHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHcCcchHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHccCHHHHHHHHHHHHHh
Confidence            3333344444444444444555555555555555555555555555542 333444455555555555555544444443


Q ss_pred             CCchhhhhcccchhHHHHHHHHHhhccChhhhHHHHhhhcccccccchHHHHHHHHHcCCCChHHHHHHHHHHHHcCCHH
Q 003035          578 ESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQK  657 (855)
Q Consensus       578 ~P~~~~~~~~~~~~~l~~ll~~~~~~~~~a~~~~~~~~~~~~~~d~~al~~~~~~l~~~p~~~~~~~~~a~~l~~~g~~~  657 (855)
                                                                                +|.+...+..+|.++...|+++
T Consensus       165 ----------------------------------------------------------~p~~~~~~~~l~~~~~~~g~~~  186 (388)
T 1w3b_A          165 ----------------------------------------------------------QPNFAVAWSNLGCVFNAQGEIW  186 (388)
T ss_dssp             ----------------------------------------------------------CTTCHHHHHHHHHHHHTTTCHH
T ss_pred             ----------------------------------------------------------CCCCHHHHHHHHHHHHHcCCHH
Confidence                                                                      4444445556666677777777


Q ss_pred             HHHHHHHHHHhcCCCcHHHHHHHHHHHHHCCCHHHHHHHHHHHHhccCCh-HHHHHHHHHHHHCCCCchhHHHHHHHHHH
Q 003035          658 AAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTF-EAFFLKAYILADTNLDPESSTYVIQLLEE  736 (855)
Q Consensus       658 ~A~~~l~~al~~~p~~~~~~~~lg~~~~~~g~~~eAl~~~~kal~~~p~~-~a~~~lg~~~~~~g~~~~A~~~~~~lle~  736 (855)
                      +|+..|+++++.+|++..++..+|.++...|++++|+..|+++++++|++ .+++.+|.++...|++++|+..    |++
T Consensus       187 ~A~~~~~~al~~~p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~----~~~  262 (388)
T 1w3b_A          187 LAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDT----YRR  262 (388)
T ss_dssp             HHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHH----HHH
T ss_pred             HHHHHHHHHHhcCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCcCCHHHHHHHHHHHHHcCCHHHHHHH----HHH
Confidence            77777777777777777777777777777777777777777777777766 7777777777777777777777    777


Q ss_pred             HhcCCCCCCCHH--HHHHHHHHHHHHcCCHHHHHHHHHHHHhcc--cHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHccC
Q 003035          737 ALRCPSDGLRKG--QALNNLGSIYVECGKLDQAENCYINALDIK--HTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQY  812 (855)
Q Consensus       737 al~~~~~~~~p~--~a~~~LG~~y~~~g~~~~A~~~~~kAL~~~--~~~a~~~lg~~~~~~g~~~~A~~~~~kal~~~p~  812 (855)
                      ++     ...|+  .++.++|.++...|++++|++.|++++++.  ++.++.++|.++...|++++|+..++++++..|+
T Consensus       263 al-----~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~  337 (388)
T 1w3b_A          263 AI-----ELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPE  337 (388)
T ss_dssp             HH-----HTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTT
T ss_pred             HH-----hhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCcccHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCC
Confidence            77     55555  667777777777777777777777777766  6667777777777777777777777777777777


Q ss_pred             CHHHHHHHhh----cCCHHHHHHHHHHHHhcCCCCcccchhhh
Q 003035          813 SASAFEKRSE----YSDREMAKNDLNMATQLDPLRTYPYRYRA  851 (855)
Q Consensus       813 ~~~a~~~lg~----~g~~eeA~~~~~kAl~l~P~~~~~~~~~a  851 (855)
                      ++.++..+|.    .|++++|+..|+++++++|++..+|...+
T Consensus       338 ~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~~p~~~~a~~~lg  380 (388)
T 1w3b_A          338 FAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMG  380 (388)
T ss_dssp             CHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHH
T ss_pred             cHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHhHH
Confidence            7777777776    67777777777777777777766665554
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 855
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-11
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-10
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 9e-05
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 1e-04
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 7e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-04
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 8e-04
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 0.003
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.004
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 63.9 bits (154), Expect = 3e-11
 Identities = 46/387 (11%), Positives = 104/387 (26%), Gaps = 27/387 (6%)

Query: 485 GWMYQERSLYNLGR--EKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRII 542
           G M      Y  G               +P  +      +    +  ++  +       I
Sbjct: 1   GPMELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAI 60

Query: 543 -VFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHH- 600
               L  +       ++      + A+      L L+ +++  +  ++   +        
Sbjct: 61  KQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGA 120

Query: 601 ---------VRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLL 651
                                     +      + A   + +   P  +        +  
Sbjct: 121 VQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFN 180

Query: 652 RLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTF-EAF 710
                  A+     A     +  +  +  G +L +    + A++   +++S+        
Sbjct: 181 AQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVH 240

Query: 711 FLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENC 770
              A +  +  L   +    I     A+           A  NL +   E G + +AE+C
Sbjct: 241 GNLACVYYEQGLIDLA----IDTYRRAIELQPH---FPDAYCNLANALKEKGSVAEAEDC 293

Query: 771 YINALDI--KHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKR----SEYS 824
           Y  AL +   H  +   LA +   +  ++ A     K LE     A+A         +  
Sbjct: 294 YNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQG 353

Query: 825 DREMAKNDLNMATQLDPLRTYPYRYRA 851
             + A      A ++ P     Y    
Sbjct: 354 KLQEALMHYKEAIRISPTFADAYSNMG 380
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query855
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.91
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.89
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.85
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.83
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.82
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.82
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.81
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.79
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.79
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.75
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.73
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.72
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.47
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.45
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.43
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.4
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.39
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.38
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.36
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.33
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.31
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.29
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.28
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.27
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.24
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.21
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.2
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.19
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.19
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.14
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.13
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.12
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.11
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.11
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.07
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.07
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.04
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.04
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.01
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.0
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.83
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.8
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.76
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.75
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.57
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.46
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.25
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.24
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.94
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 97.89
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.84
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.68
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 97.51
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.42
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 97.01
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.87
d3kvta_103 akv3.1 voltage-gated potassium channel {California 96.76
d1t1da_100 Shaker potassium channel {California sea hare (Apl 96.48
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.79
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 92.08
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 91.7
d1fs1b155 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 89.57
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 86.51
d1nexa170 Centromere DNA-binding protein complex Cbf3 subuni 86.07
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=6.7e-32  Score=294.97  Aligned_cols=365  Identities=16%  Similarity=0.105  Sum_probs=283.8

Q ss_pred             HHHhhcccccchhhHHHHHHHHhhchhhHHHHHHHHHHhhhhHhhhhcHHHHHHHHHHHHHhcc--hhhhhhHHHHHHHh
Q 003035          387 LSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGH--IYSLAGLARAKYKV  464 (855)
Q Consensus       387 La~~~~~~~~~~~~a~~~le~~~~~~~~~~~~~~a~~~LG~~~l~~g~~~eA~~~~~~Al~~~~--~~a~~~la~~~~~~  464 (855)
                      +|..+...|+ +++|++.++++++.+|++.   .++..+|.+|...|++++|+..|+++++..|  ..++..+|.+|..+
T Consensus         5 la~~~~~~G~-~~~A~~~~~~~l~~~p~~~---~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~   80 (388)
T d1w3ba_           5 LAHREYQAGD-FEAAERHCMQLWRQEPDNT---GVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKER   80 (388)
T ss_dssp             HHHHHHHHTC-HHHHHHHHHHHHHHCTTCH---HHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHcCC-HHHHHHHHHHHHHhCCCCH---HHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhh
Confidence            5666777787 9999999999999888764   5788999999999999999999999998754  46788999999999


Q ss_pred             CChHHHHHHHHhHHHcCCCchHHHHHHhh----ccCcchHHHHHHHHHHhCCCCchhHHHHHHHHHHhCCHHHHHHHHHH
Q 003035          465 GQQYSAYKLINSIISEHKPTGWMYQERSL----YNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDR  540 (855)
Q Consensus       465 g~~~~A~~~l~~~i~~~p~~~~~y~~~~~----~~~~~~A~~~l~~a~~ldP~~~~a~~~~a~~~~~~~~~~~A~~~~~k  540 (855)
                      |++++|+..+..++...|...........    ......+...........+.........+......+....+...+.+
T Consensus        81 g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (388)
T d1w3ba_          81 GQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLK  160 (388)
T ss_dssp             TCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHH
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHH
Confidence            99999999999999988877554332221    23345666677777778888888888888888888888888888888


Q ss_pred             HHccCCC-HhHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCchhhhhcccchhHHHHHHHHHhhccChhhhHHHHhhhccc
Q 003035          541 IIVFKLS-VDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSS  619 (855)
Q Consensus       541 ~l~~~p~-~~~l~lra~~y~~~gd~~~A~~~~~~aL~~~P~~~~~~~~~~~~~l~~ll~~~~~~~~~a~~~~~~~~~~~~  619 (855)
                      .+...|+ ...+..+|.++...|++++|...+++++..+|++                                      
T Consensus       161 ~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~--------------------------------------  202 (388)
T d1w3ba_         161 AIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNF--------------------------------------  202 (388)
T ss_dssp             HHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTC--------------------------------------
T ss_pred             hhccCcchhHHHHhhcccccccCcHHHHHHHHHHHHHhCccc--------------------------------------
Confidence            8888884 6777778888888888888888888877766653                                      


Q ss_pred             ccccchHHHHHHHHHcCCCChHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHCCCHHHHHHHHHH
Q 003035          620 VDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEK  699 (855)
Q Consensus       620 ~~d~~al~~~~~~l~~~p~~~~~~~~~a~~l~~~g~~~~A~~~l~~al~~~p~~~~~~~~lg~~~~~~g~~~eAl~~~~k  699 (855)
                                          ..++..+|.++...|++++|+..|+++...+|..+..+..+|.++...|++++|+..|++
T Consensus       203 --------------------~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~  262 (388)
T d1w3ba_         203 --------------------LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRR  262 (388)
T ss_dssp             --------------------HHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHH
T ss_pred             --------------------HHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHH
Confidence                                334455666677777777777777777777777777777777777777777777777777


Q ss_pred             HHhccCCh-HHHHHHHHHHHHCCCCchhHHHHHHHHHHHhcCCCCCCCHH--HHHHHHHHHHHHcCCHHHHHHHHHHHHh
Q 003035          700 SISIERTF-EAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKG--QALNNLGSIYVECGKLDQAENCYINALD  776 (855)
Q Consensus       700 al~~~p~~-~a~~~lg~~~~~~g~~~~A~~~~~~lle~al~~~~~~~~p~--~a~~~LG~~y~~~g~~~~A~~~~~kAL~  776 (855)
                      +++++|++ .+++.+|.++...|++++|+..    +++++     ...|.  .++..+|.++...|++++|++.|+++++
T Consensus       263 al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~----~~~~~-----~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~  333 (388)
T d1w3ba_         263 AIELQPHFPDAYCNLANALKEKGSVAEAEDC----YNTAL-----RLCPTHADSLNNLANIKREQGNIEEAVRLYRKALE  333 (388)
T ss_dssp             HHHTCSSCHHHHHHHHHHHHHHSCHHHHHHH----HHHHH-----HHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTT
T ss_pred             HHHhCCCCHHHHHHHHHHHHHcCCHHHHHHH----HHhhh-----ccCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHH
Confidence            77777777 7777777777777777777777    77777     55555  6777777777777777777777777777


Q ss_pred             cc--cHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHccCCHHHHHHHhh
Q 003035          777 IK--HTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSE  822 (855)
Q Consensus       777 ~~--~~~a~~~lg~~~~~~g~~~~A~~~~~kal~~~p~~~~a~~~lg~  822 (855)
                      ++  ++.+++++|.++..+|++++|++.|+++++++|+++.+|.++|.
T Consensus       334 ~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~  381 (388)
T d1w3ba_         334 VFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGN  381 (388)
T ss_dssp             SCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHH
T ss_pred             hCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHH
Confidence            77  67777777777777777777777777777777777777777776
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure