Citrus Sinensis ID: 003075
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 850 | ||||||
| 359483940 | 845 | PREDICTED: homeobox-leucine zipper prote | 0.992 | 0.998 | 0.888 | 0.0 | |
| 359483942 | 859 | PREDICTED: homeobox-leucine zipper prote | 0.992 | 0.982 | 0.873 | 0.0 | |
| 224056521 | 844 | predicted protein [Populus trichocarpa] | 0.991 | 0.998 | 0.890 | 0.0 | |
| 359483944 | 862 | PREDICTED: homeobox-leucine zipper prote | 0.995 | 0.981 | 0.867 | 0.0 | |
| 224113651 | 843 | predicted protein [Populus trichocarpa] | 0.991 | 1.0 | 0.877 | 0.0 | |
| 356555875 | 846 | PREDICTED: homeobox-leucine zipper prote | 0.992 | 0.997 | 0.866 | 0.0 | |
| 356533043 | 846 | PREDICTED: homeobox-leucine zipper prote | 0.992 | 0.997 | 0.861 | 0.0 | |
| 45479746 | 843 | PHAVOLUTA-like HD-ZIPIII protein [Nicoti | 0.990 | 0.998 | 0.847 | 0.0 | |
| 356528394 | 849 | PREDICTED: homeobox-leucine zipper prote | 0.995 | 0.996 | 0.826 | 0.0 | |
| 449488526 | 844 | PREDICTED: homeobox-leucine zipper prote | 0.991 | 0.998 | 0.840 | 0.0 |
| >gi|359483940|ref|XP_002281868.2| PREDICTED: homeobox-leucine zipper protein HOX32-like isoform 1 [Vitis vinifera] gi|147820218|emb|CAN73584.1| hypothetical protein VITISV_033098 [Vitis vinifera] gi|297740817|emb|CBI30999.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1578 bits (4085), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 756/851 (88%), Positives = 796/851 (93%), Gaps = 7/851 (0%)
Query: 1 MALTMHNKEFANKQIMDSTKYVRYTPEQVEALERVYSECPKPSSLRRQQLIRECPILSNI 60
MAL+MH + +KQ MDS+KYVRYTPEQVEALERVYSECPKPSS+RRQQLIRECPILSNI
Sbjct: 1 MALSMHKE---SKQQMDSSKYVRYTPEQVEALERVYSECPKPSSMRRQQLIRECPILSNI 57
Query: 61 EPKQIKVWFQNRRCREKQRKEASRLQTVNRKLSAMNKLLMEENDRLQKQVSHLVYENGYM 120
EPKQIKVWFQNRRCREKQRKEASRLQTVNRKL+AMNKLLMEENDRLQKQVS LVYENGYM
Sbjct: 58 EPKQIKVWFQNRRCREKQRKEASRLQTVNRKLTAMNKLLMEENDRLQKQVSQLVYENGYM 117
Query: 121 RQQLHSAPATTTDNSCESVVMSGQHQQQQNPTPQHPQRDASNPAGLLAVAEETLAEFLSK 180
RQQL SA TTD SCESVVMSGQHQQQQNPTPQHPQRDASNPAGLLA+AEETLAEFLSK
Sbjct: 118 RQQLQSASTATTDTSCESVVMSGQHQQQQNPTPQHPQRDASNPAGLLAIAEETLAEFLSK 177
Query: 181 ATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGVAARACGLVSLDPTKIAEILKDCPSWFR 240
ATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGVAARACGLVSL+PTK+AEILKD PSWFR
Sbjct: 178 ATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGVAARACGLVSLEPTKVAEILKDRPSWFR 237
Query: 241 DCRCLDVLSVIPTGNGGTIELIYMQTYAPTTLAAARDFWLLRYSTSLEDGSLVVCERSLT 300
DCRCLDVLSVIPTGNGGTIELIYMQTYAPTTLA+ARDFW LRY+TSLEDGSLV+CERSLT
Sbjct: 238 DCRCLDVLSVIPTGNGGTIELIYMQTYAPTTLASARDFWTLRYTTSLEDGSLVICERSLT 297
Query: 301 SSTGGPTGPPPSSFVRAEMLASGFLIRPCEGGGSIIHIVDHVDLDAWSVPEVLRPLYESS 360
SSTGGPTGPP SS++RAEML SG+LIRPCEGGGSIIHIVDHVDLDAWSVPEVLRPLYESS
Sbjct: 298 SSTGGPTGPPASSYIRAEMLPSGYLIRPCEGGGSIIHIVDHVDLDAWSVPEVLRPLYESS 357
Query: 361 KILAQKMTMAAMRHIRQIAQETSGEIQYGGGRQPAVLRTFSQRLSRGFNDAINGFLDDGW 420
KILAQK T+AA+RHIRQIAQETSGEIQYGGGRQPAVLRTFSQRL RGFNDA+NGF DDGW
Sbjct: 358 KILAQKTTVAALRHIRQIAQETSGEIQYGGGRQPAVLRTFSQRLCRGFNDAVNGFADDGW 417
Query: 421 SLLSSDGGEDVTVAINSSPNKFLGSQYNWSMLPAF-GGVLCAKASMLLQNVPPALLVRFL 479
SL+ SDG EDVT+ INSSP+KFLG QYN +M P F GGVLCAKASMLLQNVPPALLVRFL
Sbjct: 418 SLMGSDGVEDVTIVINSSPSKFLGPQYNSTMFPTFGGGVLCAKASMLLQNVPPALLVRFL 477
Query: 480 REHRSEWADYGVDAYSAACLKASPYAVPCARPGGFPSSHVILPLAHTVEHEEFLEVVRLE 539
REHRSEWADYGVDAYSAACLKASPY VPCARPGGFPSS VILPLAHTVEHEEFLEVVRLE
Sbjct: 478 REHRSEWADYGVDAYSAACLKASPYEVPCARPGGFPSSQVILPLAHTVEHEEFLEVVRLE 537
Query: 540 GHAFSPEDVALARDMYLLQLCSGIDENTVGACAQLVFAPIDESFADDAPLLASGFRVIPL 599
GHAFSPEDVAL RDMYLLQLCSG+DEN GACAQLVFAPIDESFADDAPLL SGFRVIPL
Sbjct: 538 GHAFSPEDVALTRDMYLLQLCSGVDENAAGACAQLVFAPIDESFADDAPLLPSGFRVIPL 597
Query: 600 DSKAAMQDGPAASRTLDLASALEVGSGGARPAGGTELSNYNSRSVLTIAFQFTFENHMRD 659
D K DGPAA+RTLDLAS LEVG+GGARPA ++L+NYN RSVLTIAFQFTFENH+RD
Sbjct: 598 DPKT---DGPAATRTLDLASTLEVGAGGARPANESDLNNYNLRSVLTIAFQFTFENHVRD 654
Query: 660 NVAAMARQYVRSVVGSVQRVAMAISPSRLGPHAGPKALPGSPEALTLARWISRSYRIHTG 719
NVAAMARQYVRSV+ SVQRVAMAI+PSRL H G K LPGSPEALTLARWI RSYRIHTG
Sbjct: 655 NVAAMARQYVRSVMASVQRVAMAIAPSRLSSHMGLKPLPGSPEALTLARWICRSYRIHTG 714
Query: 720 GELLRADSLTGDALLKQLWHHSDAIMCCSLKTNASPVFTFANQAGLDMLETTLVALQDIM 779
GELLR DS GDA+LK LW+HSDAIMCCSLKTNASPVFTFANQAGLDMLETTLVALQDIM
Sbjct: 715 GELLRVDSQGGDAVLKLLWNHSDAIMCCSLKTNASPVFTFANQAGLDMLETTLVALQDIM 774
Query: 780 LDKILDEAGRKILCTEFAKIMQQGFAYLPGGMCVSSMGRAVSYEQAVAWKVLDDDDSNHC 839
LDKILDEAGRKILC+EF+KIMQQGFAYLP G+C SSMGR VSYEQA+AWKVL+D+DSNHC
Sbjct: 775 LDKILDEAGRKILCSEFSKIMQQGFAYLPAGICTSSMGRPVSYEQAIAWKVLNDEDSNHC 834
Query: 840 LAFMFMNWSFV 850
LAFMF+NWSFV
Sbjct: 835 LAFMFINWSFV 845
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359483942|ref|XP_003633040.1| PREDICTED: homeobox-leucine zipper protein HOX32-like isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224056521|ref|XP_002298892.1| predicted protein [Populus trichocarpa] gi|60327627|gb|AAX19053.1| class III HD-Zip protein 4 [Populus trichocarpa] gi|222846150|gb|EEE83697.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359483944|ref|XP_003633041.1| PREDICTED: homeobox-leucine zipper protein HOX32-like isoform 3 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224113651|ref|XP_002332526.1| predicted protein [Populus trichocarpa] gi|60327625|gb|AAX19052.1| class III HD-Zip protein 3 [Populus trichocarpa] gi|222832638|gb|EEE71115.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356555875|ref|XP_003546255.1| PREDICTED: homeobox-leucine zipper protein ATHB-14-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356533043|ref|XP_003535078.1| PREDICTED: homeobox-leucine zipper protein ATHB-14-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|45479746|gb|AAS66760.1| PHAVOLUTA-like HD-ZIPIII protein [Nicotiana sylvestris] | Back alignment and taxonomy information |
|---|
| >gi|356528394|ref|XP_003532788.1| PREDICTED: homeobox-leucine zipper protein HOX32-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449488526|ref|XP_004158070.1| PREDICTED: homeobox-leucine zipper protein HOX32-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 850 | ||||||
| TAIR|locus:2061544 | 852 | PHB "AT2G34710" [Arabidopsis t | 0.992 | 0.990 | 0.780 | 0.0 | |
| TAIR|locus:2028140 | 841 | PHV "AT1G30490" [Arabidopsis t | 0.98 | 0.990 | 0.763 | 0.0 | |
| TAIR|locus:2175856 | 842 | REV "AT5G60690" [Arabidopsis t | 0.976 | 0.985 | 0.683 | 1.3e-308 | |
| TAIR|locus:2034086 | 837 | ATHB-15 "AT1G52150" [Arabidops | 0.964 | 0.979 | 0.661 | 5.7e-297 | |
| TAIR|locus:2134088 | 833 | HB-8 "AT4G32880" [Arabidopsis | 0.964 | 0.984 | 0.657 | 3.7e-293 | |
| TAIR|locus:2119048 | 762 | ATML1 "AT4G21750" [Arabidopsis | 0.115 | 0.128 | 0.349 | 7.4e-19 | |
| TAIR|locus:2135368 | 743 | PDF2 "AT4G04890" [Arabidopsis | 0.105 | 0.121 | 0.346 | 4.3e-18 | |
| TAIR|locus:2207235 | 721 | HDG2 "AT1G05230" [Arabidopsis | 0.081 | 0.095 | 0.421 | 2.2e-16 | |
| TAIR|locus:2206880 | 722 | HDG11 "AT1G73360" [Arabidopsis | 0.105 | 0.124 | 0.357 | 2.4e-14 | |
| TAIR|locus:2098866 | 808 | HDG1 "AT3G61150" [Arabidopsis | 0.112 | 0.118 | 0.339 | 3.6e-14 |
| TAIR|locus:2061544 PHB "AT2G34710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3425 (1210.7 bits), Expect = 0., P = 0.
Identities = 665/852 (78%), Positives = 734/852 (86%)
Query: 1 MALTMHNKEFANKQIMDSTKYVRYTPEQVEALERVYSECPKPSSLRRQQLIRECPILSNI 60
M+ M N+E +K + DS KYVRYTPEQVEALERVY+ECPKPSSLRRQQLIRECPILSNI
Sbjct: 7 MSRDMMNRESPDKGL-DSGKYVRYTPEQVEALERVYTECPKPSSLRRQQLIRECPILSNI 65
Query: 61 EPKQIKVWFQNRRCREKQRKEASRLQTVNRKLSAMNKLLMEENDRLQKQVSHLVYENGYM 120
EPKQIKVWFQNRRCREKQRKEA+RLQTVNRKL+AMNKLLMEENDRLQKQVS+LVYENG+M
Sbjct: 66 EPKQIKVWFQNRRCREKQRKEAARLQTVNRKLNAMNKLLMEENDRLQKQVSNLVYENGHM 125
Query: 121 RQQLHSAPATTTDNSCESVVMSGXXXXXXXXXXXXXXRDASNPAGLLAVAEETLAEFLSK 180
+ QLH+A TTTDNSCESVV+SG RDA+NPAGLL++AEE LAEFLSK
Sbjct: 126 KHQLHTASGTTTDNSCESVVVSGQQHQQQNPNPQHQQRDANNPAGLLSIAEEALAEFLSK 185
Query: 181 ATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGVAARACGLVSLDPTKIAEILKDCPSWFR 240
ATGTAVDWVQMIGMKPGPDSIGIVA+SRNCSG+AARACGLVSL+P K+AEILKD PSW R
Sbjct: 186 ATGTAVDWVQMIGMKPGPDSIGIVAISRNCSGIAARACGLVSLEPMKVAEILKDRPSWLR 245
Query: 241 DCRCLDVLSVIPTGNGGTIELIYMQTYAPTTLAAARDFWLLRYSTSLEDGSLVVCERSLX 300
DCR +D LSVIP GNGGTIELIY Q YAPTTLAAARDFW LRYST LEDGS VVCERSL
Sbjct: 246 DCRSVDTLSVIPAGNGGTIELIYTQMYAPTTLAAARDFWTLRYSTCLEDGSYVVCERSLT 305
Query: 301 XXXXXXXXXXXXXFVRAEMLASGFLIRPCEGGGSIIHIVDHVDLDAWSVPEVLRPLYESS 360
FVRAEM SGFLIRPC+GGGSI+HIVDHVDLDAWSVPEV+RPLYESS
Sbjct: 306 SATGGPTGPPSSNFVRAEMKPSGFLIRPCDGGGSILHIVDHVDLDAWSVPEVMRPLYESS 365
Query: 361 KILAQKMTMAAMRHIRQIAQETSGEIQYGGGRQPAVLRTFSQRLSRGFNDAINGFLDDGW 420
KILAQKMT+AA+RH+RQIAQETSGE+QYGGGRQPAVLRTFSQRL RGFNDA+NGF+DDGW
Sbjct: 366 KILAQKMTVAALRHVRQIAQETSGEVQYGGGRQPAVLRTFSQRLCRGFNDAVNGFVDDGW 425
Query: 421 SLLSSDGGEDVTVAINSSPNKFLGSQYNWSMLPAFG-GVLCAKASMLLQNVPPALLVRFL 479
S + SDG EDVTV IN SP KF GSQY S LP+FG GVLCAKASMLLQNVPPA+LVRFL
Sbjct: 426 SPMGSDGAEDVTVMINLSPGKFGGSQYGNSFLPSFGSGVLCAKASMLLQNVPPAVLVRFL 485
Query: 480 REHRSEWADYGVDAYSAACLKASPYAVPCARPGGFPSSHVILPLAHTVEHEEFLEVVRLE 539
REHRSEWADYGVDAY+AA L+ASP+AVPCAR GGFPS+ VILPLA TVEHEE LEVVRLE
Sbjct: 486 REHRSEWADYGVDAYAAASLRASPFAVPCARAGGFPSNQVILPLAQTVEHEESLEVVRLE 545
Query: 540 GHAFSPEDVALARDMYLLQLCSGIDENTVGACAQLVFAPIDESFADDAPLLASGFRVIPL 599
GHA+SPED+ LARDMYLLQLCSG+DEN VG CAQLVFAPIDESFADDAPLL SGFR+IPL
Sbjct: 546 GHAYSPEDMGLARDMYLLQLCSGVDENVVGGCAQLVFAPIDESFADDAPLLPSGFRIIPL 605
Query: 600 DSKAAMQDGPAASRTLDLASALEVGSGGARPAGGTELSNYNSRSVLTIAFQFTFENHMRD 659
+ K+ +G +A+RTLDLASALE G R AG + + N RSVLTIAFQFTF+NH RD
Sbjct: 606 EQKST-PNGASANRTLDLASALE---GSTRQAGEADPNGCNFRSVLTIAFQFTFDNHSRD 661
Query: 660 NVAAMARQYVRSVVGSVQRVAMAISPSRLGPHAGPKALPGSPEALTLARWISRSYRIHTG 719
+VA+MARQYVRS+VGS+QRVA+AI+P R G + P ++P SPEALTL RWISRSY +HTG
Sbjct: 662 SVASMARQYVRSIVGSIQRVALAIAP-RPGSNISPISVPTSPEALTLVRWISRSYSLHTG 720
Query: 720 GELLRADSLT-GDALLKQLWHHSDAIMCCSLKTNASPVFTFANQAGLDMLETTLVALQDI 778
+L +DS T GD LL QLW+HSDAI+CCSLKTNASPVFTFANQ GLDMLETTLVALQDI
Sbjct: 721 ADLFGSDSQTSGDTLLHQLWNHSDAILCCSLKTNASPVFTFANQTGLDMLETTLVALQDI 780
Query: 779 MLDKILDEAGRKILCTEFAKIMQQGFAYLPGGMCVSSMGRAVSYEQAVAWKVLDDDDSNH 838
MLDK LDE GRK LC+EF KIMQQG+A+LP G+C SSMGR VSYEQA WKVL+DD+SNH
Sbjct: 781 MLDKTLDEPGRKALCSEFPKIMQQGYAHLPAGVCASSMGRMVSYEQATVWKVLEDDESNH 840
Query: 839 CLAFMFMNWSFV 850
CLAFMF+NWSFV
Sbjct: 841 CLAFMFVNWSFV 852
|
|
| TAIR|locus:2028140 PHV "AT1G30490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175856 REV "AT5G60690" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034086 ATHB-15 "AT1G52150" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2134088 HB-8 "AT4G32880" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2119048 ATML1 "AT4G21750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135368 PDF2 "AT4G04890" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2207235 HDG2 "AT1G05230" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2206880 HDG11 "AT1G73360" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098866 HDG1 "AT3G61150" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00028421001 | SubName- Full=Putative uncharacterized protein (Chromosome chr10 scaffold_43, whole genome shotgun sequence); (845 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 850 | |||
| pfam08670 | 148 | pfam08670, MEKHLA, MEKHLA domain | 2e-77 | |
| cd08875 | 229 | cd08875, START_ArGLABRA2_like, C-terminal lipid-bi | 1e-69 | |
| pfam01852 | 205 | pfam01852, START, START domain | 1e-52 | |
| smart00234 | 205 | smart00234, START, in StAR and phosphatidylcholine | 1e-40 | |
| pfam00046 | 57 | pfam00046, Homeobox, Homeobox domain | 4e-17 | |
| cd00086 | 59 | cd00086, homeodomain, Homeodomain; DNA binding dom | 8e-17 | |
| smart00389 | 57 | smart00389, HOX, Homeodomain | 7e-16 | |
| cd00177 | 193 | cd00177, START, Lipid-binding START domain of mamm | 2e-13 | |
| COG5576 | 156 | COG5576, COG5576, Homeodomain-containing transcrip | 4e-12 | |
| smart00338 | 65 | smart00338, BRLZ, basic region leucin zipper | 4e-06 | |
| pfam00170 | 64 | pfam00170, bZIP_1, bZIP transcription factor | 8e-05 | |
| cd08869 | 197 | cd08869, START_RhoGAP, C-terminal lipid-binding ST | 4e-04 |
| >gnl|CDD|219964 pfam08670, MEKHLA, MEKHLA domain | Back alignment and domain information |
|---|
Score = 247 bits (632), Expect = 2e-77
Identities = 91/150 (60%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
Query: 701 PEALTLARWISRSYRIHTGGELLRADSLTGDALLKQLWHHSDAIMCCSLKTNASPVFTFA 760
PEALTLARW+ +SYR HTG +LL + +GD+LLK LWHH DA++C SLK A PVF +A
Sbjct: 1 PEALTLARWLCQSYRRHTGRDLLPSADSSGDSLLKALWHHPDAVLCHSLK--ADPVFNYA 58
Query: 761 NQAGLDMLETTLVALQDIMLDKILDEAGRKILCTEFAKIMQQGFAYLPGGMCVSSMGRAV 820
NQA LD+LETT V LQD+ K +E+GRK C+E AK+MQQGFA L G+ +SSMGR
Sbjct: 59 NQAALDLLETTWVELQDLPSRKTAEESGRKERCSELAKVMQQGFACLYSGVRISSMGRRF 118
Query: 821 SYEQAVAWKVLDDDDSNHCLAFMFMNWSFV 850
S EQAVAWK+LD+D + H A MF+NWSF+
Sbjct: 119 SIEQAVAWKLLDEDGAYHGQAAMFVNWSFL 148
|
The MEKHLA domain shares similarity with the PAS domain and is found in the 3' end of plant HD-ZIP III homeobox genes, and bacterial proteins. Length = 148 |
| >gnl|CDD|176884 cd08875, START_ArGLABRA2_like, C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|216740 pfam01852, START, START domain | Back alignment and domain information |
|---|
| >gnl|CDD|214575 smart00234, START, in StAR and phosphatidylcholine transfer protein | Back alignment and domain information |
|---|
| >gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain | Back alignment and domain information |
|---|
| >gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >gnl|CDD|197696 smart00389, HOX, Homeodomain | Back alignment and domain information |
|---|
| >gnl|CDD|176851 cd00177, START, Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper | Back alignment and domain information |
|---|
| >gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor | Back alignment and domain information |
|---|
| >gnl|CDD|176878 cd08869, START_RhoGAP, C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 850 | |||
| cd08875 | 229 | START_ArGLABRA2_like C-terminal lipid-binding STAR | 100.0 | |
| PF08670 | 148 | MEKHLA: MEKHLA domain; InterPro: IPR013978 The MEK | 100.0 | |
| PF01852 | 206 | START: START domain; InterPro: IPR002913 START (St | 99.74 | |
| smart00234 | 206 | START in StAR and phosphatidylcholine transfer pro | 99.71 | |
| KOG0483 | 198 | consensus Transcription factor HEX, contains HOX a | 99.69 | |
| KOG0843 | 197 | consensus Transcription factor EMX1 and related HO | 99.48 | |
| KOG0489 | 261 | consensus Transcription factor zerknullt and relat | 99.47 | |
| KOG0488 | 309 | consensus Transcription factor BarH and related HO | 99.44 | |
| KOG0842 | 307 | consensus Transcription factor tinman/NKX2-3, cont | 99.43 | |
| KOG0487 | 308 | consensus Transcription factor Abd-B, contains HOX | 99.42 | |
| KOG0850 | 245 | consensus Transcription factor DLX and related pro | 99.4 | |
| PF00046 | 57 | Homeobox: Homeobox domain not present here.; Inter | 99.39 | |
| KOG0492 | 246 | consensus Transcription factor MSH, contains HOX d | 99.37 | |
| KOG0484 | 125 | consensus Transcription factor PHOX2/ARIX, contain | 99.34 | |
| KOG0848 | 317 | consensus Transcription factor Caudal, contains HO | 99.33 | |
| KOG0493 | 342 | consensus Transcription factor Engrailed, contains | 99.29 | |
| KOG0485 | 268 | consensus Transcription factor NKX-5.1/HMX1, conta | 99.28 | |
| cd00177 | 193 | START Lipid-binding START domain of mammalian STAR | 99.25 | |
| KOG0494 | 332 | consensus Transcription factor CHX10 and related H | 99.25 | |
| COG5576 | 156 | Homeodomain-containing transcription factor [Trans | 99.22 | |
| KOG2251 | 228 | consensus Homeobox transcription factor [Transcrip | 99.22 | |
| smart00389 | 56 | HOX Homeodomain. DNA-binding factors that are invo | 99.2 | |
| cd00086 | 59 | homeodomain Homeodomain; DNA binding domains invol | 99.19 | |
| KOG0491 | 194 | consensus Transcription factor BSH, contains HOX d | 99.09 | |
| TIGR01565 | 58 | homeo_ZF_HD homeobox domain, ZF-HD class. This mod | 99.09 | |
| KOG4577 | 383 | consensus Transcription factor LIM3, contains LIM | 99.09 | |
| cd08868 | 208 | START_STARD1_3_like Cholesterol-binding START doma | 99.07 | |
| KOG0847 | 288 | consensus Transcription factor, contains HOX domai | 99.06 | |
| cd08871 | 222 | START_STARD10-like Lipid-binding START domain of m | 99.03 | |
| cd08867 | 206 | START_STARD4_5_6-like Lipid-binding START domain o | 99.0 | |
| KOG3802 | 398 | consensus Transcription factor OCT-1, contains POU | 98.98 | |
| cd08904 | 204 | START_STARD6-like Lipid-binding START domain of ma | 98.98 | |
| KOG0844 | 408 | consensus Transcription factor EVX1, contains HOX | 98.97 | |
| KOG0486 | 351 | consensus Transcription factor PTX1, contains HOX | 98.93 | |
| cd08903 | 208 | START_STARD5-like Lipid-binding START domain of ma | 98.81 | |
| cd08905 | 209 | START_STARD1-like Cholesterol-binding START domain | 98.8 | |
| PLN00188 | 719 | enhanced disease resistance protein (EDR2); Provis | 98.6 | |
| KOG0490 | 235 | consensus Transcription factor, contains HOX domai | 98.58 | |
| cd08869 | 197 | START_RhoGAP C-terminal lipid-binding START domain | 98.58 | |
| cd08906 | 209 | START_STARD3-like Cholesterol-binding START domain | 98.58 | |
| cd08909 | 205 | START_STARD13-like C-terminal lipid-binding START | 98.57 | |
| KOG0849 | 354 | consensus Transcription factor PRD and related pro | 98.37 | |
| KOG1168 | 385 | consensus Transcription factor ACJ6/BRN-3, contain | 98.37 | |
| cd08902 | 202 | START_STARD4-like Lipid-binding START domain of ma | 98.23 | |
| cd08908 | 204 | START_STARD12-like C-terminal lipid-binding START | 98.08 | |
| KOG0775 | 304 | consensus Transcription factor SIX and related HOX | 98.02 | |
| cd08874 | 205 | START_STARD9-like C-terminal START domain of mamma | 98.0 | |
| cd08910 | 207 | START_STARD2-like Lipid-binding START domain of ma | 97.87 | |
| PF13426 | 104 | PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ | 97.86 | |
| cd08907 | 205 | START_STARD8-like C-terminal lipid-binding START d | 97.81 | |
| cd08870 | 209 | START_STARD2_7-like Lipid-binding START domain of | 97.69 | |
| cd08872 | 235 | START_STARD11-like Ceramide-binding START domain o | 97.65 | |
| cd08877 | 215 | START_2 Uncharacterized subgroup of the steroidoge | 97.56 | |
| cd08876 | 195 | START_1 Uncharacterized subgroup of the steroidoge | 97.55 | |
| PF05920 | 40 | Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 | 97.54 | |
| cd08873 | 235 | START_STARD14_15-like Lipid-binding START domain o | 97.48 | |
| KOG0774 | 334 | consensus Transcription factor PBX and related HOX | 97.44 | |
| KOG2252 | 558 | consensus CCAAT displacement protein and related h | 97.15 | |
| cd08914 | 236 | START_STARD15-like Lipid-binding START domain of m | 97.08 | |
| cd08913 | 240 | START_STARD14-like Lipid-binding START domain of m | 97.06 | |
| cd08911 | 207 | START_STARD7-like Lipid-binding START domain of ma | 96.99 | |
| KOG0490 | 235 | consensus Transcription factor, contains HOX domai | 96.91 | |
| PF00989 | 113 | PAS: PAS fold; InterPro: IPR013767 PAS domains are | 96.81 | |
| PF08448 | 110 | PAS_4: PAS fold; InterPro: IPR013656 The PAS fold | 96.58 | |
| PRK13557 | 540 | histidine kinase; Provisional | 96.17 | |
| cd08904 | 204 | START_STARD6-like Lipid-binding START domain of ma | 95.43 | |
| KOG1146 | 1406 | consensus Homeobox protein [General function predi | 95.3 | |
| PRK13559 | 361 | hypothetical protein; Provisional | 94.78 | |
| cd08869 | 197 | START_RhoGAP C-terminal lipid-binding START domain | 94.54 | |
| cd08907 | 205 | START_STARD8-like C-terminal lipid-binding START d | 94.52 | |
| cd08871 | 222 | START_STARD10-like Lipid-binding START domain of m | 94.21 | |
| TIGR00229 | 124 | sensory_box PAS domain S-box. The PAS domain was p | 93.84 | |
| PF11569 | 56 | Homez: Homeodomain leucine-zipper encoding, Homez; | 93.57 | |
| PRK09413 | 121 | IS2 repressor TnpA; Reviewed | 93.54 | |
| PRK11091 | 779 | aerobic respiration control sensor protein ArcB; P | 93.44 | |
| KOG0773 | 342 | consensus Transcription factor MEIS1 and related H | 93.3 | |
| cd00130 | 103 | PAS PAS domain; PAS motifs appear in archaea, euba | 92.42 | |
| TIGR02938 | 494 | nifL_nitrog nitrogen fixation negative regulator N | 92.13 | |
| cd08876 | 195 | START_1 Uncharacterized subgroup of the steroidoge | 90.67 | |
| cd08864 | 208 | SRPBCC_DUF3074 DUF3074, an uncharacterized ligand- | 90.47 | |
| cd00177 | 193 | START Lipid-binding START domain of mammalian STAR | 90.38 | |
| cd08877 | 215 | START_2 Uncharacterized subgroup of the steroidoge | 90.31 | |
| PF00170 | 64 | bZIP_1: bZIP transcription factor cAMP response el | 90.25 | |
| TIGR02040 | 442 | PpsR-CrtJ transcriptional regulator PpsR. This mod | 90.16 | |
| KOG4196 | 135 | consensus bZIP transcription factor MafK [Transcri | 89.68 | |
| smart00340 | 44 | HALZ homeobox associated leucin zipper. | 89.64 | |
| PRK13558 | 665 | bacterio-opsin activator; Provisional | 89.42 | |
| PRK13560 | 807 | hypothetical protein; Provisional | 89.36 | |
| cd08868 | 208 | START_STARD1_3_like Cholesterol-binding START doma | 88.91 | |
| TIGR02040 | 442 | PpsR-CrtJ transcriptional regulator PpsR. This mod | 88.46 | |
| cd08874 | 205 | START_STARD9-like C-terminal START domain of mamma | 87.86 | |
| KOG2761 | 219 | consensus START domain-containing proteins involve | 87.22 | |
| cd08909 | 205 | START_STARD13-like C-terminal lipid-binding START | 86.99 | |
| PF13188 | 64 | PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A. | 86.01 | |
| cd08875 | 229 | START_ArGLABRA2_like C-terminal lipid-binding STAR | 85.1 | |
| cd08906 | 209 | START_STARD3-like Cholesterol-binding START domain | 84.33 | |
| PRK11073 | 348 | glnL nitrogen regulation protein NR(II); Provision | 83.96 | |
| PRK11359 | 799 | cyclic-di-GMP phosphodiesterase; Provisional | 83.81 | |
| smart00234 | 206 | START in StAR and phosphatidylcholine transfer pro | 83.25 | |
| PRK10060 | 663 | RNase II stability modulator; Provisional | 82.01 | |
| PRK09776 | 1092 | putative diguanylate cyclase; Provisional | 81.26 | |
| smart00338 | 65 | BRLZ basic region leucin zipper. | 81.15 | |
| cd08870 | 209 | START_STARD2_7-like Lipid-binding START domain of | 80.94 | |
| PF08447 | 91 | PAS_3: PAS fold; InterPro: IPR013655 The PAS fold | 80.89 | |
| cd08908 | 204 | START_STARD12-like C-terminal lipid-binding START | 80.85 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 80.67 | |
| KOG4005 | 292 | consensus Transcription factor XBP-1 [Transcriptio | 80.29 |
| >cd08875 START_ArGLABRA2_like C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.5e-75 Score=605.68 Aligned_cols=211 Identities=36% Similarity=0.592 Sum_probs=195.3
Q ss_pred hhhhHHHHHHHHHHHHHHhcCCCCceEecCCCCC---CCCcccceecc------CCCcceeeeeeeEEeeChhhHHHHhc
Q 003075 163 PAGLLAVAEETLAEFLSKATGTAVDWVQMIGMKP---GPDSIGIVAVS------RNCSGVAARACGLVSLDPTKIAEILK 233 (850)
Q Consensus 163 ~~~l~~~A~~am~Ell~la~~~~plWi~~~g~~~---g~~~~~~~~~~------~~~~~eASR~~glV~m~~~~LVe~lm 233 (850)
+++|++||++||+||++||++++|+|++++|+|+ ++|.|+..+++ .||++||||+||+|+||+.+|||+||
T Consensus 1 k~~~~~lA~~am~Ell~~a~~~~plWi~~~~~~~~~l~~dey~~~f~~~~~~~~~~~~~eASR~~glV~m~~~~lVe~lm 80 (229)
T cd08875 1 KSGLLELAEEAMDELLKLAQGGEPLWIKSPGMKPEILNPDEYERMFPRHGGSKPGGFTTEASRACGLVMMNAIKLVEILM 80 (229)
T ss_pred ChHHHHHHHHHHHHHHHHhccCCCCceecCCCCccccCHHHHhhcccCcCCCCCCCCeEEEEeeeEEEecCHHHHHHHHh
Confidence 4689999999999999999999999999999877 78888554332 35999999999999999999999999
Q ss_pred CccchhhcCCcc----eeeeeccCCC----ccHHHHHHHhhcccccccccceeeEEeeccccCCCcEEEEEeecCCCCCC
Q 003075 234 DCPSWFRDCRCL----DVLSVIPTGN----GGTIELIYMQTYAPTTLAAARDFWLLRYSTSLEDGSLVVCERSLTSSTGG 305 (850)
Q Consensus 234 D~~~W~~~f~~~----~~l~~~~~g~----~G~lqLm~aE~~v~SPLvp~Re~~fLRyckq~~~G~waVvDvSld~~~~~ 305 (850)
|++||.++||++ +|+.++++|+ +|+|||||+|||+||||||+|||||||||||++||+|||||||+|+.+.
T Consensus 81 D~~kW~~~Fp~iv~~a~tl~vistg~~g~~~G~lqlmyael~~pSpLVp~Re~~fLRyc~~l~dG~w~VvdvSld~~~~- 159 (229)
T cd08875 81 DVNKWSELFPGIVSKAKTLQVISTGNGGNRNGTLQLMYAELQVPSPLVPTREFYFLRYCKQLEDGLWAVVDVSIDGVQT- 159 (229)
T ss_pred ChhhhhhhhhhhcceeeEEEEeeCCCCCCCCceehhhhhhcccCcccccCCeEEEEEEEEEeCCCeEEEEEEeeccccc-
Confidence 999999999876 9999999996 7899999999999999999999999999999999999999999998763
Q ss_pred CCCCCCCccccccccccceeeeecCCCceEEEEEEeeeccCCCccccchhhhhhhHHHHHHHHHHHH-HHHH
Q 003075 306 PTGPPPSSFVRAEMLASGFLIRPCEGGGSIIHIVDHVDLDAWSVPEVLRPLYESSKILAQKMTMAAM-RHIR 376 (850)
Q Consensus 306 ~~~~~~~~f~r~~rlPSGclIq~~~nG~skVtwVeH~e~d~~~v~~l~Rpl~~Sg~afgar~~~~aL-r~~e 376 (850)
.++.++|+||||+|||||||||+|||||||||||+|||++.+|.+||++++||+||||+||+++| ||||
T Consensus 160 --~p~~~~~~r~~~~PSGcLIq~~~nG~SkVtwVeH~e~d~~~~~~l~~~l~~sg~AfgA~rw~a~lqRqce 229 (229)
T cd08875 160 --APPPASFVRCRRLPSGCLIQDMPNGYSKVTWVEHVEVDEKPVHLLYRYLVSSGLAFGATRWVATLQRQCE 229 (229)
T ss_pred --CCCCCCccEEEEecCcEEEEECCCCceEEEEEEEEeccCCcccccchhhhhhhHHHHHHHHHHHHHHhcC
Confidence 33455789999999999999999999999999999999999999999999999999999999999 7997
|
This subfamily includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of the Arabidopsis homeobox protein GLABRA 2 and related proteins. The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Most proteins in this subgroup contain an N-terminal homeobox DNA-binding domain, some contain a leucine zipper. ArGLABRA2 plays a role in the differentiation of hairless epidermal cells of the Arabidopsis root. It acts in a cell-position-dependent manner to suppress root hair formation in those cells. |
| >PF08670 MEKHLA: MEKHLA domain; InterPro: IPR013978 The MEKHLA domain shares similarity with the PAS domain and is found in the 3' end of plant HD-ZIP III homeobox genes, and bacterial proteins | Back alignment and domain information |
|---|
| >PF01852 START: START domain; InterPro: IPR002913 START (StAR-related lipid-transfer) is a lipid-binding domain in StAR, HD-ZIP and signalling proteins [] | Back alignment and domain information |
|---|
| >smart00234 START in StAR and phosphatidylcholine transfer protein | Back alignment and domain information |
|---|
| >KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >PF00046 Homeobox: Homeobox domain not present here | Back alignment and domain information |
|---|
| >KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0485 consensus Transcription factor NKX-5 | Back alignment and domain information |
|---|
| >cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins | Back alignment and domain information |
|---|
| >KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >COG5576 Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG2251 consensus Homeobox transcription factor [Transcription] | Back alignment and domain information |
|---|
| >smart00389 HOX Homeodomain | Back alignment and domain information |
|---|
| >cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class | Back alignment and domain information |
|---|
| >KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins | Back alignment and domain information |
|---|
| >KOG0847 consensus Transcription factor, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins | Back alignment and domain information |
|---|
| >cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins | Back alignment and domain information |
|---|
| >KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >cd08904 START_STARD6-like Lipid-binding START domain of mammalian STARD6 and related proteins | Back alignment and domain information |
|---|
| >KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >cd08903 START_STARD5-like Lipid-binding START domain of mammalian STARD5 and related proteins | Back alignment and domain information |
|---|
| >cd08905 START_STARD1-like Cholesterol-binding START domain of mammalian STARD1 and related proteins | Back alignment and domain information |
|---|
| >PLN00188 enhanced disease resistance protein (EDR2); Provisional | Back alignment and domain information |
|---|
| >KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins | Back alignment and domain information |
|---|
| >cd08909 START_STARD13-like C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >cd08902 START_STARD4-like Lipid-binding START domain of mammalian STARD4 and related proteins | Back alignment and domain information |
|---|
| >cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding | Back alignment and domain information |
|---|
| >cd08910 START_STARD2-like Lipid-binding START domain of mammalian STARD2 and related proteins | Back alignment and domain information |
|---|
| >PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A | Back alignment and domain information |
|---|
| >cd08907 START_STARD8-like C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins | Back alignment and domain information |
|---|
| >cd08872 START_STARD11-like Ceramide-binding START domain of mammalian STARD11 and related domains | Back alignment and domain information |
|---|
| >cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] | Back alignment and domain information |
|---|
| >cd08873 START_STARD14_15-like Lipid-binding START domain of mammalian STARDT14, -15, and related proteins | Back alignment and domain information |
|---|
| >KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] | Back alignment and domain information |
|---|
| >cd08914 START_STARD15-like Lipid-binding START domain of mammalian STARD15 and related proteins | Back alignment and domain information |
|---|
| >cd08913 START_STARD14-like Lipid-binding START domain of mammalian STARDT14 and related proteins | Back alignment and domain information |
|---|
| >cd08911 START_STARD7-like Lipid-binding START domain of mammalian STARD7 and related proteins | Back alignment and domain information |
|---|
| >KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] | Back alignment and domain information |
|---|
| >PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] | Back alignment and domain information |
|---|
| >PRK13557 histidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd08904 START_STARD6-like Lipid-binding START domain of mammalian STARD6 and related proteins | Back alignment and domain information |
|---|
| >KOG1146 consensus Homeobox protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13559 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08907 START_STARD8-like C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins | Back alignment and domain information |
|---|
| >TIGR00229 sensory_box PAS domain S-box | Back alignment and domain information |
|---|
| >PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A | Back alignment and domain information |
|---|
| >PRK09413 IS2 repressor TnpA; Reviewed | Back alignment and domain information |
|---|
| >PRK11091 aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya | Back alignment and domain information |
|---|
| >TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL | Back alignment and domain information |
|---|
| >cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >cd08864 SRPBCC_DUF3074 DUF3074, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily | Back alignment and domain information |
|---|
| >cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins | Back alignment and domain information |
|---|
| >cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization | Back alignment and domain information |
|---|
| >TIGR02040 PpsR-CrtJ transcriptional regulator PpsR | Back alignment and domain information |
|---|
| >KOG4196 consensus bZIP transcription factor MafK [Transcription] | Back alignment and domain information |
|---|
| >smart00340 HALZ homeobox associated leucin zipper | Back alignment and domain information |
|---|
| >PRK13558 bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >PRK13560 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins | Back alignment and domain information |
|---|
| >TIGR02040 PpsR-CrtJ transcriptional regulator PpsR | Back alignment and domain information |
|---|
| >cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding | Back alignment and domain information |
|---|
| >KOG2761 consensus START domain-containing proteins involved in steroidogenesis/phosphatidylcholine transfer [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd08909 START_STARD13-like C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >PF13188 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A | Back alignment and domain information |
|---|
| >cd08875 START_ArGLABRA2_like C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins | Back alignment and domain information |
|---|
| >cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins | Back alignment and domain information |
|---|
| >PRK11073 glnL nitrogen regulation protein NR(II); Provisional | Back alignment and domain information |
|---|
| >PRK11359 cyclic-di-GMP phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >smart00234 START in StAR and phosphatidylcholine transfer protein | Back alignment and domain information |
|---|
| >PRK10060 RNase II stability modulator; Provisional | Back alignment and domain information |
|---|
| >PRK09776 putative diguanylate cyclase; Provisional | Back alignment and domain information |
|---|
| >smart00338 BRLZ basic region leucin zipper | Back alignment and domain information |
|---|
| >cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins | Back alignment and domain information |
|---|
| >PF08447 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] | Back alignment and domain information |
|---|
| >cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >KOG4005 consensus Transcription factor XBP-1 [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 850 | ||||
| 1bw5_A | 66 | The Nmr Solution Structure Of The Homeodomain Of Th | 1e-06 | ||
| 2m0c_A | 75 | Solution Nmr Structure Of Homeobox Domain Of Human | 4e-04 | ||
| 2dmu_A | 70 | Solution Structure Of The Homeobox Domain Of Homeob | 6e-04 |
| >pdb|1BW5|A Chain A, The Nmr Solution Structure Of The Homeodomain Of The Rat Insulin Gene Enhancer Protein Isl-1, 50 Structures Length = 66 | Back alignment and structure |
|
| >pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 | Back alignment and structure |
| >pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 850 | |||
| 2pso_A | 237 | STAR-related lipid transfer protein 13; alpha and | 3e-24 | |
| 2r55_A | 231 | STAR-related lipid transfer protein 5; alpha and b | 3e-24 | |
| 1jss_A | 224 | Stard4, cholesterol-regulated start protein 4; sta | 2e-19 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 1e-16 | |
| 3qsz_A | 189 | STAR-related lipid transfer protein; structural ge | 2e-16 | |
| 3fo5_A | 258 | Thioesterase, adipose associated, isoform BFIT2; o | 1e-13 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 2e-13 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 3e-13 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 7e-13 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 1e-12 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 2e-12 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 4e-12 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 4e-12 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 5e-12 | |
| 3p0l_A | 221 | Steroidogenic acute regulatory protein, mitochond; | 6e-12 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 9e-12 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 2e-11 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 4e-11 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 5e-11 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 1e-10 | |
| 1em2_A | 229 | MLN64 protein; beta barrel, lipid binding protein; | 1e-10 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 4e-10 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 7e-10 | |
| 1ln1_A | 214 | PC-TP, phosphatidylcholine transfer protein; start | 1e-09 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 2e-09 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 2e-09 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 3e-09 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 9e-09 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 2e-08 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 3e-07 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 3e-07 | |
| 1x2m_A | 64 | LAG1 longevity assurance homolog 6; homeobox domai | 4e-07 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 7e-07 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 7e-07 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 9e-07 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 1e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-05 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 2e-06 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 2e-06 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 2e-06 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 3e-06 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 5e-06 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 5e-06 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 5e-06 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 6e-06 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 6e-06 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 7e-06 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 7e-06 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 9e-06 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 1e-05 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 1e-05 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 1e-05 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 2e-05 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 2e-05 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 2e-05 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 2e-05 | |
| 3a5t_A | 107 | Transcription factor MAFG; protein-DNA complex, BZ | 2e-05 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 3e-05 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 3e-05 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 3e-05 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 3e-05 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 3e-05 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 3e-05 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 5e-05 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 6e-05 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 6e-05 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 1e-04 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 1e-04 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 2e-04 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 2e-04 | |
| 2da4_A | 80 | Hypothetical protein DKFZP686K21156; homeobox doma | 2e-04 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 5e-04 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 6e-04 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 6e-04 |
| >2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 Length = 237 | Back alignment and structure |
|---|
Score = 101 bits (252), Expect = 3e-24
Identities = 38/214 (17%), Positives = 67/214 (31%), Gaps = 17/214 (7%)
Query: 156 PQRDASNPAGLLAVAEETLAEFLSKATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGVAA 215
Q + A + +A WV + V
Sbjct: 20 FQSMEESGATFHTYLNHLIQGLQKEAKEKFKGWVTCSSTDNT--DLAFKKVGDGNPLKLW 77
Query: 216 RACGLVSLDPTKIAE-ILKDCPSWFRDCRCLDVLSVIPTGNGGTIELIYMQTYAPTTLAA 274
+A V P+ + +L++ W D V+ + E+ + +
Sbjct: 78 KASVEVEAPPSVVLNRVLRERHLWDEDFVQWKVVETL----DRQTEIYQYVLNSMAPHPS 133
Query: 275 ARDFWLLR-YSTSLEDGSLVVCERSLTSSTGGPTGPPPSSFVRAEMLASGFLIRPCEGGG 333
RDF +LR + T L G + S+ VRA ++ S +LI PC G
Sbjct: 134 -RDFVVLRTWKTDLPKGMCTLVSLSVE-----HEEAQLLGGVRAVVMDSQYLIEPCGSGK 187
Query: 334 SIIHIVDHVDLDAWSVPEVLRPLYESSKILAQKM 367
S + + +DL PE + + A ++
Sbjct: 188 SRLTHICRIDLKGH-SPEWYSKGF--GHLCAAEV 218
|
| >2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Length = 231 | Back alignment and structure |
|---|
| >1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Length = 224 | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 | Back alignment and structure |
|---|
| >3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} Length = 189 | Back alignment and structure |
|---|
| >3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Length = 258 | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 | Back alignment and structure |
|---|
| >1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 Length = 229 | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 | Back alignment and structure |
|---|
| >1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* Length = 214 | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 | Back alignment and structure |
|---|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 | Back alignment and structure |
|---|
| >3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 | Back alignment and structure |
|---|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 | Back alignment and structure |
|---|
| >2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 850 | |||
| 2r55_A | 231 | STAR-related lipid transfer protein 5; alpha and b | 99.8 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 99.59 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 99.59 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 99.58 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 99.58 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 99.58 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 99.58 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 99.58 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 99.57 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 99.57 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 99.57 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 99.57 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 99.57 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.57 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 99.56 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 99.56 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 99.56 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 99.56 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 99.56 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 99.56 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.55 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 99.55 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 99.55 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 99.55 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 99.55 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 99.55 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 99.54 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 99.54 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 99.54 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 99.54 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 99.54 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 99.54 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 99.53 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 99.53 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 99.53 | |
| 2da4_A | 80 | Hypothetical protein DKFZP686K21156; homeobox doma | 99.53 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 99.53 | |
| 1wh5_A | 80 | ZF-HD homeobox family protein; structural genomics | 99.53 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 99.53 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 99.53 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 99.52 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 99.51 | |
| 2m0c_A | 75 | Homeobox protein aristaless-like 4; structural gen | 99.51 | |
| 2ly9_A | 74 | Zinc fingers and homeoboxes protein 1; structural | 99.5 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 99.5 | |
| 1wh7_A | 80 | ZF-HD homeobox family protein; homeobox domain, st | 99.5 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 99.49 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 99.48 | |
| 1k61_A | 60 | Mating-type protein alpha-2; protein-DNA complex, | 99.48 | |
| 1puf_B | 73 | PRE-B-cell leukemia transcription factor-1; homeod | 99.48 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 99.47 | |
| 1x2n_A | 73 | Homeobox protein pknox1; homeobox domain, structur | 99.47 | |
| 1b72_B | 87 | Protein (PBX1); homeodomain, DNA, complex, DNA-bin | 99.47 | |
| 1du6_A | 64 | PBX1, homeobox protein PBX1; homeodomain, gene reg | 99.46 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 99.45 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 99.45 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 99.42 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 99.42 | |
| 1mnm_C | 87 | Protein (MAT alpha-2 transcriptional repressor); t | 99.42 | |
| 1le8_B | 83 | Mating-type protein alpha-2; matalpha2, isothermal | 99.41 | |
| 2dmn_A | 83 | Homeobox protein TGIF2LX; TGFB-induced factor 2-li | 99.41 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 99.41 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 99.4 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 99.4 | |
| 2e19_A | 64 | Transcription factor 8; homeobox domain, structura | 99.4 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 99.39 | |
| 2da6_A | 102 | Hepatocyte nuclear factor 1-beta; homeobox domain, | 99.38 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 99.37 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 99.37 | |
| 1x2m_A | 64 | LAG1 longevity assurance homolog 6; homeobox domai | 99.37 | |
| 2pso_A | 237 | STAR-related lipid transfer protein 13; alpha and | 99.36 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 99.35 | |
| 1em2_A | 229 | MLN64 protein; beta barrel, lipid binding protein; | 99.35 | |
| 3p0l_A | 221 | Steroidogenic acute regulatory protein, mitochond; | 99.33 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 99.29 | |
| 3k2a_A | 67 | Homeobox protein MEIS2; homeobox domain, DNA-bindi | 99.28 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 99.08 | |
| 2lk2_A | 89 | Homeobox protein TGIF1; NESG, structural genomics, | 99.05 | |
| 2da7_A | 71 | Zinc finger homeobox protein 1B; homeobox domain, | 99.03 | |
| 1ln1_A | 214 | PC-TP, phosphatidylcholine transfer protein; start | 98.97 | |
| 3fo5_A | 258 | Thioesterase, adipose associated, isoform BFIT2; o | 98.94 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 98.89 | |
| 1jss_A | 224 | Stard4, cholesterol-regulated start protein 4; sta | 98.85 | |
| 1mh3_A | 421 | Maltose binding-A1 homeodomain protein chimera; MA | 98.85 | |
| 2e3n_A | 255 | Lipid-transfer protein CERT; ceramide transfer, li | 98.43 | |
| 3qsz_A | 189 | STAR-related lipid transfer protein; structural ge | 98.42 | |
| 2nzz_A | 37 | Penetratin conjugated GAS (374-394) peptide; confo | 98.25 | |
| 4eet_B | 115 | Phototropin-2; LOV, blue light photoreceptor, sign | 97.51 | |
| 3t50_A | 128 | Blue-light-activated histidine kinase; PAS superfa | 97.5 | |
| 3lyx_A | 124 | Sensory BOX/ggdef domain protein; structural genom | 97.47 | |
| 3ue6_A | 166 | Aureochrome1; PAS/LOV domain, FMN-binding blue-lig | 97.4 | |
| 1n9l_A | 109 | PHOT-LOV1, putative blue light receptor; phototrop | 97.33 | |
| 2gj3_A | 120 | Nitrogen fixation regulatory protein; PAS domain, | 97.33 | |
| 4hia_A | 176 | LOV protein; PAS, HTH, signaling protein; HET: FMN | 97.26 | |
| 3p7n_A | 258 | Sensor histidine kinase; LOV domain, light-activat | 97.15 | |
| 3sw1_A | 162 | Sensory box protein; light-oxygen-voltage, LOV, PA | 97.11 | |
| 3luq_A | 114 | Sensor protein; PAS, histidine, kinase, PSI, MCSG, | 97.11 | |
| 1byw_A | 110 | Protein (human ERG potassium channel); PAS domain, | 97.1 | |
| 2z6d_A | 130 | Phototropin-2; PAS-fold, LOV-fold, alternative spl | 97.08 | |
| 3f1p_A | 117 | Endothelial PAS domain-containing protein 1; PAS d | 97.07 | |
| 3d72_A | 149 | Vivid PAS protein VVD; circadian, photoreceptor, b | 97.04 | |
| 3mqq_A | 120 | Transcriptional regulator, LUXR family; PAS domain | 96.91 | |
| 3kx0_X | 185 | Uncharacterized protein RV1364C/MT1410; PAS domain | 96.71 | |
| 1d06_A | 130 | Nitrogen fixation regulatory protein FIXL; oxygen | 96.71 | |
| 2l0w_A | 138 | Potassium voltage-gated channel, subfamily H (EAG | 96.67 | |
| 3k3c_A | 158 | Protein RV1364C/MT1410; sensor, PAS, signal transd | 96.66 | |
| 2r78_A | 117 | Sensor protein; sensory box sensor histidine kinas | 96.61 | |
| 2pr5_A | 132 | Blue-light photoreceptor; light-oxygen-voltage, LO | 96.54 | |
| 2v0u_A | 146 | NPH1-1, LOV2; kinase, transferase, ATP-binding, se | 96.52 | |
| 2r55_A | 231 | STAR-related lipid transfer protein 5; alpha and b | 96.5 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 96.4 | |
| 3f1p_B | 121 | ARYL hydrocarbon receptor nuclear translocator; PA | 96.34 | |
| 3ewk_A | 227 | Sensor protein; PAS domain, alpha/beta fold, kinas | 96.25 | |
| 3mxq_A | 152 | Sensor protein; PSI2, MCSG, structural genomics, p | 96.1 | |
| 2vv6_A | 119 | FIXL, sensor protein FIXL; signaling protein, tran | 96.05 | |
| 3ewk_A | 227 | Sensor protein; PAS domain, alpha/beta fold, kinas | 96.02 | |
| 3eeh_A | 125 | Putative light and redox sensing histidine kinase; | 95.93 | |
| 3olo_A | 118 | Two-component sensor histidine kinase; structural | 95.93 | |
| 3fc7_A | 125 | HTR-like protein, sensor protein; APC87712.1, HTR- | 95.92 | |
| 3nja_A | 125 | Probable ggdef family protein; structural genomics | 95.82 | |
| 2kdk_A | 121 | ARYL hydrocarbon receptor nuclear translocator-LI | 95.72 | |
| 3icy_A | 118 | Sensor protein; sensory box histidine kinase/respo | 95.59 | |
| 3b33_A | 115 | Sensor protein; structural genomics, PAS domain, n | 95.57 | |
| 3mjq_A | 126 | Uncharacterized protein; NESG, structural genomics | 95.53 | |
| 3bwl_A | 126 | Sensor protein; structural genomics, APC87707.1, P | 94.75 | |
| 1jss_A | 224 | Stard4, cholesterol-regulated start protein 4; sta | 94.61 | |
| 2pso_A | 237 | STAR-related lipid transfer protein 13; alpha and | 94.39 | |
| 1v9y_A | 167 | Heme PAS sensor protein; signaling protein; HET: H | 94.25 | |
| 3mfx_A | 129 | Sensory BOX/ggdef family protein; alpha-beta prote | 94.05 | |
| 3h9w_A | 115 | Diguanylate cyclase with PAS/PAC sensor; alpha-bet | 93.96 | |
| 3p0l_A | 221 | Steroidogenic acute regulatory protein, mitochond; | 93.94 | |
| 4hi4_A | 121 | Aerotaxis transducer AER2; PAS domain, diatomic GA | 93.88 | |
| 1ll8_A | 114 | PAS kinase; PAS domain, ligand binding, ligand scr | 93.84 | |
| 3a0s_A | 96 | Sensor protein; PAS-fold, kinase, phosphoprotein, | 93.61 | |
| 3qsz_A | 189 | STAR-related lipid transfer protein; structural ge | 93.47 | |
| 3fo5_A | 258 | Thioesterase, adipose associated, isoform BFIT2; o | 93.12 | |
| 1ln1_A | 214 | PC-TP, phosphatidylcholine transfer protein; start | 93.06 | |
| 3fg8_A | 118 | Uncharacterized protein RHA05790; PAS domain, stru | 92.2 | |
| 1em2_A | 229 | MLN64 protein; beta barrel, lipid binding protein; | 92.16 | |
| 2d4r_A | 147 | Hypothetical protein TTHA0849; start domain, struc | 91.44 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 89.75 | |
| 3vol_A | 233 | Aerotaxis transducer AER2; heme, oxygen sensor pro | 89.55 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 89.06 | |
| 2w0n_A | 118 | Sensor protein DCUS; signal transduction, two-comp | 88.1 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 87.56 | |
| 2ys9_A | 70 | Homeobox and leucine zipper protein homez; homeodo | 87.25 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 86.93 | |
| 4eho_A | 635 | Bacteriophytochrome, PAS/PAC sensor; photoreceptor | 86.41 | |
| 2vlg_A | 111 | Sporulation kinase A; histidine kinase, two-compon | 85.89 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 84.38 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 84.07 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 82.81 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 82.02 |
| >2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.80 E-value=3.1e-19 Score=184.07 Aligned_cols=198 Identities=19% Similarity=0.246 Sum_probs=160.6
Q ss_pred hhhhHHHHHHHHHHHHHHhcCCCCceEecCCCCCCCCcccceec-cCCCcceeeeeeeEEeeChhhHHHHhcC-----cc
Q 003075 163 PAGLLAVAEETLAEFLSKATGTAVDWVQMIGMKPGPDSIGIVAV-SRNCSGVAARACGLVSLDPTKIAEILKD-----CP 236 (850)
Q Consensus 163 ~~~l~~~A~~am~Ell~la~~~~plWi~~~g~~~g~~~~~~~~~-~~~~~~eASR~~glV~m~~~~LVe~lmD-----~~ 236 (850)
++.+.++|+++|+|++++++.+ ..|..... +.| +.++-. ..+..+.+-|..|+|.+.+.+|+++||+ +.
T Consensus 21 ~~~y~~~a~~~~~~~l~~~~~~-~~W~~~~~-~~g---v~v~~~~~~~~~~~~~k~~~~v~~~~~~v~~~l~~~d~~~r~ 95 (231)
T 2r55_A 21 QSMAAQMSEAVAEKMLQYRRDT-AGWKICRE-GNG---VSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKPAVGGLRV 95 (231)
T ss_dssp HHHHHHHHHHHHHHHHHHHHCC-SSCEEEEC-CSS---EEEEEEECSSSSSEEEEEEEEESSCHHHHHHHHCC--CCSHH
T ss_pred HHHHHHHHHHHHHHHHHHhcCC-CCCEEEEe-CCC---EEEEEEccCCCCCcEEEEEEEECCCHHHHHHHHHhhCcchhh
Confidence 6789999999999999999754 68987642 222 222211 1234568899999999999999999977 89
Q ss_pred chhhcCCcceeeeeccCCCccHHHHHHHhhc--ccccccccceeeEEeeccccCCCcEEEEEeecCCCCCCCCCCCCCcc
Q 003075 237 SWFRDCRCLDVLSVIPTGNGGTIELIYMQTY--APTTLAAARDFWLLRYSTSLEDGSLVVCERSLTSSTGGPTGPPPSSF 314 (850)
Q Consensus 237 ~W~~~f~~~~~l~~~~~g~~G~lqLm~aE~~--v~SPLvp~Re~~fLRyckq~~~G~waVvDvSld~~~~~~~~~~~~~f 314 (850)
+|-..|...++|+.+... .. ++| ++. .++++|++|||.++||+++.++|.|+|+.+|++. +..|+...+
T Consensus 96 ~Wd~~~~~~~vle~i~~~--~~--i~~-~~~~~~~~~~v~~RDfv~~r~~~~~~~g~~vi~~~Sv~~----~~~P~~~~~ 166 (231)
T 2r55_A 96 KWDENVTGFEIIQSITDT--LC--VSR-TSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEH----PLCPPKPGF 166 (231)
T ss_dssp HHCTTCSEEEEEEECSSS--EE--EEE-EECCCBTTTTBCCEEEEEEEEEEECTTSCEEEEEEECCC----TTSCCCTTC
T ss_pred hhccccceeEEEEEcCCC--EE--EEE-EEeccccCCccCCCeEEEEEEEEEcCCCEEEEEEEeccC----CCCCCCCCC
Confidence 999999999999988642 12 222 232 3456899999999999999999999999999984 345666789
Q ss_pred ccccccccceeeeecC--CCceEEEEEEeeeccCCCccccchhhhhhhHHHHHHHHHHHHH-HHHhh
Q 003075 315 VRAEMLASGFLIRPCE--GGGSIIHIVDHVDLDAWSVPEVLRPLYESSKILAQKMTMAAMR-HIRQI 378 (850)
Q Consensus 315 ~r~~rlPSGclIq~~~--nG~skVtwVeH~e~d~~~v~~l~Rpl~~Sg~afgar~~~~aLr-~~e~l 378 (850)
+|++.++|||+|++++ +|.|+|||+.|+|..-+ +| +.++++.+..+...++..|| +|+..
T Consensus 167 VR~~~~~~g~~i~p~~~~~~~t~vt~~~~~Dp~G~-iP---~~lvn~~~~~~~~~~~~~Lr~~~~~~ 229 (231)
T 2r55_A 167 VRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGY-LP---QNVVDSFFPRSMTRFYANLQKAVKQF 229 (231)
T ss_dssp EEEEECSEEEEEEECC--CCCEEEEEEECEECCSS-CC---HHHHHHHHHHHHHHHHHHHHHHHHGG
T ss_pred EEEEEEeeEEEEEEeCCCCCcEEEEEEEEeCCCCC-cc---HHHHHHHHhHhHHHHHHHHHHHHHHh
Confidence 9999999999999998 78999999999999876 55 68888999999999999996 88764
|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P | Back alignment and structure |
|---|
| >1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* | Back alignment and structure |
|---|
| >2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A | Back alignment and structure |
|---|
| >2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A | Back alignment and structure |
|---|
| >1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A | Back alignment and structure |
|---|
| >3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* | Back alignment and structure |
|---|
| >3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A | Back alignment and structure |
|---|
| >2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* | Back alignment and structure |
|---|
| >3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} | Back alignment and structure |
|---|
| >2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A | Back alignment and structure |
|---|
| >4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* | Back alignment and structure |
|---|
| >3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} | Back alignment and structure |
|---|
| >3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* | Back alignment and structure |
|---|
| >1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* | Back alignment and structure |
|---|
| >2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} | Back alignment and structure |
|---|
| >4hia_A LOV protein; PAS, HTH, signaling protein; HET: FMN; 1.95A {Rhodobacter sphaeroides} PDB: 4hnb_A* 4hj4_A* 4hj6_A* 4hj3_A* | Back alignment and structure |
|---|
| >3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} | Back alignment and structure |
|---|
| >3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 | Back alignment and structure |
|---|
| >2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* | Back alignment and structure |
|---|
| >3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A | Back alignment and structure |
|---|
| >3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* | Back alignment and structure |
|---|
| >3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A | Back alignment and structure |
|---|
| >3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1d06_A Nitrogen fixation regulatory protein FIXL; oxygen sensor, histidine kinase, PAS, high-resolution, two-C system, signaling protein; HET: HEM; 1.40A {Sinorhizobium meliloti} SCOP: d.110.3.2 PDB: 1ew0_A* | Back alignment and structure |
|---|
| >2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A | Back alignment and structure |
|---|
| >3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A | Back alignment and structure |
|---|
| >2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* | Back alignment and structure |
|---|
| >2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* | Back alignment and structure |
|---|
| >2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B | Back alignment and structure |
|---|
| >3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >2vv6_A FIXL, sensor protein FIXL; signaling protein, transferase, phosphoprotein, nitrogen FIX PER-ARNT-SIM, metal-binding, PAS, iron, heme; HET: HEM; 1.5A {Bradyrhizobium japonicum} PDB: 1xj6_A* 1xj4_A* 2vv7_A* 2vv8_A* 1lsw_A* 1dp8_A* 1dp9_A* 1drm_A* 1lsv_A* 1dp6_A* 1lsx_A* 1lt0_A* 1y28_A* 2cmn_A* 1xj3_A* 1xj2_A* 2owh_A* 2owj_A* | Back alignment and structure |
|---|
| >3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} | Back alignment and structure |
|---|
| >3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} | Back alignment and structure |
|---|
| >3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} | Back alignment and structure |
|---|
| >3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} | Back alignment and structure |
|---|
| >1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >1v9y_A Heme PAS sensor protein; signaling protein; HET: HEM; 1.32A {Escherichia coli} SCOP: d.110.3.2 PDB: 1v9z_A* 1vb6_A* 1s67_L* 1s66_L* | Back alignment and structure |
|---|
| >3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >4hi4_A Aerotaxis transducer AER2; PAS domain, diatomic GAS sensor, signaling protein; HET: HEM GOL; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1ll8_A PAS kinase; PAS domain, ligand binding, ligand screening, kinase regulation, transferase; NMR {Homo sapiens} SCOP: d.110.3.5 | Back alignment and structure |
|---|
| >3a0s_A Sensor protein; PAS-fold, kinase, phosphoprotein, transferase, two-component regulatory system; HET: PG4 PGE; 1.47A {Thermotoga maritima} PDB: 3a0v_A* | Back alignment and structure |
|---|
| >3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} | Back alignment and structure |
|---|
| >3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* | Back alignment and structure |
|---|
| >3fg8_A Uncharacterized protein RHA05790; PAS domain, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; HET: 3PB; 1.80A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3vol_A Aerotaxis transducer AER2; heme, oxygen sensor protein, PAS, HAMP, cyanoMet, CN-bound, protein; HET: HEM; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >2w0n_A Sensor protein DCUS; signal transduction, two-component regulatory system, PAS, kinase, membrane, transferase, solid state cell inner membrane; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A | Back alignment and structure |
|---|
| >2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 850 | ||||
| d1pufa_ | 77 | a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m | 2e-18 | |
| d9anta_ | 56 | a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila | 5e-17 | |
| d2e1oa1 | 57 | a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo | 1e-16 | |
| d2cuea1 | 68 | a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H | 5e-16 | |
| d1bw5a_ | 66 | a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { | 1e-15 | |
| d1le8a_ | 53 | a.4.1.1 (A:) Mating type protein A1 Homeodomain {B | 1e-15 | |
| d2ecba1 | 76 | a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote | 2e-15 | |
| d1ftta_ | 68 | a.4.1.1 (A:) Thyroid transcription factor 1 homeod | 3e-15 | |
| d1au7a1 | 58 | a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra | 1e-14 | |
| d1k61a_ | 60 | a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast | 1e-14 | |
| d1zq3p1 | 67 | a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl | 1e-14 | |
| d2psoa1 | 197 | d.129.3.2 (A:908-1104) Star-related lipid transfer | 3e-14 | |
| d1s7ea1 | 50 | a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M | 3e-14 | |
| d1jgga_ | 57 | a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( | 4e-14 | |
| d1b72a_ | 88 | a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo | 4e-14 | |
| d2cufa1 | 82 | a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM | 5e-14 | |
| d2craa1 | 58 | a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( | 5e-14 | |
| d1fjla_ | 65 | a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila | 7e-14 | |
| d1p7ia_ | 53 | a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel | 8e-14 | |
| d1x2ma1 | 52 | a.4.1.1 (A:8-59) Lag1 longevity assurance homolog | 1e-13 | |
| d1lfba_ | 78 | a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN | 5e-13 | |
| d1ig7a_ | 58 | a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu | 1e-12 | |
| d1yz8p1 | 60 | a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo | 2e-12 | |
| d1vnda_ | 77 | a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi | 3e-12 | |
| d1x2na1 | 62 | a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H | 3e-12 | |
| d1ocpa_ | 67 | a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus | 3e-12 | |
| d2cqxa1 | 59 | a.4.1.1 (A:8-66) LAG1 longevity assurance homolog | 4e-12 | |
| d1pufb_ | 73 | a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 | 6e-12 | |
| d1uhsa_ | 72 | a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse | 1e-11 | |
| d1e3oc1 | 57 | a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( | 2e-11 | |
| d1wh7a_ | 80 | a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha | 5e-11 | |
| d2ecca1 | 76 | a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H | 3e-10 | |
| d1wi3a_ | 71 | a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom | 5e-10 | |
| d1em2a_ | 214 | d.129.3.2 (A:) Lipid transport domain of Mln64 {Hu | 6e-07 | |
| d1ln1a_ | 203 | d.129.3.2 (A:) Phosphatidylcholine transfer protei | 1e-06 |
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Homeobox protein hox-a9 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 77.9 bits (192), Expect = 2e-18
Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 5/66 (7%)
Query: 20 KYVRYTPEQVEALERVYSECPKPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREK-Q 78
K YT Q LE+ + + RR ++ R N+ +Q+K+WFQNRR + K
Sbjct: 16 KRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLL----NLTERQVKIWFQNRRMKMKKI 71
Query: 79 RKEASR 84
K+ ++
Sbjct: 72 NKDRAK 77
|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 | Back information, alignment and structure |
|---|
| >d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} Length = 197 | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} Length = 203 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 850 | |||
| d2e1oa1 | 57 | Homeobox protein prh {Human (Homo sapiens) [TaxId: | 99.68 | |
| d2craa1 | 58 | Homeobox protein hox-b13 {Human (Homo sapiens) [Ta | 99.67 | |
| d1ig7a_ | 58 | Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 | 99.66 | |
| d9anta_ | 56 | Antennapedia Homeodomain {Drosophila melanogaster | 99.66 | |
| d1jgga_ | 57 | Even-skipped homeodomain {Fruit fly (Drosophila me | 99.65 | |
| d1zq3p1 | 67 | Homeotic bicoid protein {Fruit fly (Drosophila mel | 99.65 | |
| d1pufa_ | 77 | Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax | 99.64 | |
| d1p7ia_ | 53 | Engrailed Homeodomain {Drosophila melanogaster [Ta | 99.63 | |
| d1fjla_ | 65 | Paired protein {Fruit fly (Drosophila melanogaster | 99.62 | |
| d1ftta_ | 68 | Thyroid transcription factor 1 homeodomain {Rat (R | 99.61 | |
| d1yz8p1 | 60 | Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: | 99.61 | |
| d2cuea1 | 68 | Paired box protein pax6 {Human (Homo sapiens) [Tax | 99.6 | |
| d1uhsa_ | 72 | Homeodomain-only protein, Hop {Mouse (Mus musculus | 99.6 | |
| d1b72a_ | 88 | Homeobox protein hox-b1 {Human (Homo sapiens) [Tax | 99.6 | |
| d1vnda_ | 77 | VND/NK-2 protein {Fruit fly (Drosophila melanogast | 99.58 | |
| d1le8a_ | 53 | Mating type protein A1 Homeodomain {Baker's yeast | 99.56 | |
| d1au7a1 | 58 | Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta | 99.56 | |
| d1bw5a_ | 66 | Insulin gene enhancer protein isl-1 {Rat (Rattus n | 99.55 | |
| d2cufa1 | 82 | Homeobox-containing protein 1, HMBOX1 (Flj21616) { | 99.55 | |
| d1ocpa_ | 67 | Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId | 99.54 | |
| d1wi3a_ | 71 | DNA-binding protein SATB2 {Human (Homo sapiens) [T | 99.52 | |
| d1e3oc1 | 57 | Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId | 99.52 | |
| d2ecba1 | 76 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 99.48 | |
| d1s7ea1 | 50 | Hepatocyte nuclear factor 6 {Mouse (Mus musculus) | 99.46 | |
| d2ecca1 | 76 | Homeobox-leucine zipper protein Homez {Human (Homo | 99.45 | |
| d1wh7a_ | 80 | ZF-HD homeobox protein At4g24660 {Thale cress (Ara | 99.43 | |
| d1pufb_ | 73 | pbx1 {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d1x2ma1 | 52 | Lag1 longevity assurance homolog 6, LASS6 {Mouse ( | 99.38 | |
| d1lfba_ | 78 | Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat | 99.37 | |
| d1k61a_ | 60 | mat alpha2 Homeodomain {Baker's yeast (Saccharomyc | 99.37 | |
| d2cqxa1 | 59 | LAG1 longevity assurance homolog 5, LASS5 {Mouse ( | 99.31 | |
| d1x2na1 | 62 | Homeobox protein pknox1 {Human (Homo sapiens) [Tax | 99.25 | |
| d1jssa_ | 199 | Cholesterol-regulated Start protein 4 (Stard4). {M | 98.78 | |
| d2psoa1 | 197 | Star-related lipid transfer protein 13 {Human (Hom | 98.68 | |
| d1em2a_ | 214 | Lipid transport domain of Mln64 {Human (Homo sapie | 98.41 | |
| d1ln1a_ | 203 | Phosphatidylcholine transfer protein {Human (Homo | 98.15 | |
| d1jnua_ | 104 | Photoreceptor phy3 flavin-binding domain, lov2 {Ma | 98.11 | |
| d1n9la_ | 109 | Putative blue light receptor, phot-lov1 domain {Gr | 97.76 | |
| d1bywa_ | 110 | Erg potassium channel, N-terminal domain {Human (H | 97.4 | |
| d1v9ya_ | 113 | Direct oxygen sensor protein, DOS {Escherichia col | 97.29 | |
| d1ew0a_ | 130 | Histidine kinase FixL heme domain {Rhizobium melil | 97.24 | |
| d1mzua_ | 110 | PYP domain of sensor histidine kinase Ppr {Rhodosp | 97.04 | |
| d1p97a_ | 114 | Hypoxia-inducible factor Hif2a, C-terminal domain | 96.62 | |
| d1xj3a1 | 106 | Histidine kinase FixL heme domain {Bradyrhizobium | 96.47 | |
| d1ll8a_ | 114 | N-terminal PAS domain of Pas kinase {Human (Homo s | 96.05 | |
| d1nwza_ | 125 | Photoactive yellow protein, PYP {Ectothiorhodospir | 96.05 | |
| d2psoa1 | 197 | Star-related lipid transfer protein 13 {Human (Hom | 93.91 | |
| d1ln1a_ | 203 | Phosphatidylcholine transfer protein {Human (Homo | 93.62 | |
| d1jssa_ | 199 | Cholesterol-regulated Start protein 4 (Stard4). {M | 92.46 | |
| d1em2a_ | 214 | Lipid transport domain of Mln64 {Human (Homo sapie | 90.97 | |
| d2d4ra1 | 146 | Hypothetical protein TTHA0849 {Thermus thermophilu | 84.79 |
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Homeobox protein prh species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.68 E-value=1.9e-17 Score=135.02 Aligned_cols=57 Identities=28% Similarity=0.498 Sum_probs=55.0
Q ss_pred CCCcccCCHHHHHHHHHhHhcCCCCCHHHHHHHHHhCCccCCCChhhhhhhhhhhhHHHHH
Q 003075 18 STKYVRYTPEQVEALERVYSECPKPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQ 78 (850)
Q Consensus 18 ~rkR~r~T~~Ql~~LE~~F~~~~~Ps~~~r~~LA~~L~~~~gL~~rQVkvWFQNRRak~Kr 78 (850)
|++|++||++|+..||..|+.++||+..++.+||..| ||+++||++||||||+|+|+
T Consensus 1 k~~R~~ft~~Q~~~Le~~F~~n~yp~~~~r~~LA~~l----~L~~~qV~~WFqNrR~k~kk 57 (57)
T d2e1oa1 1 KGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKML----QLSERQVKTWFQNRRAKWRR 57 (57)
T ss_dssp CCCCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHT----TCCHHHHHHHHHHHHHHHHH
T ss_pred CCCCccCCHHHHHHHHHHHHhCCCCCHHHHHHHHHHh----CCCHHHhhHhhhhhhhhccC
Confidence 5788999999999999999999999999999999999 99999999999999999986
|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} | Back information, alignment and structure |
|---|
| >d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} | Back information, alignment and structure |
|---|
| >d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nwza_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]} | Back information, alignment and structure |
|---|
| >d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|