Citrus Sinensis ID: 003082


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850
MRVVFGSSSSSSSAIVATQTRLYNHRNKPNKHPVTKLFPLASSSSLSSIPTVHSSQTALLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIVESVVVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDYDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQILKIMREDGMSPDVVAYTTAIKVCVRSKRLKQAFSLFEEMKHYQIQPNLVTYITLLRARSRYGSLHEVQQCLAVYQDMWKAGYKANDTYLKELIEEWCEGVIQDKNQNQGEVTLCRRTNSQRPQSLLLEKVAVHLQKSAAENLAIDLRGLTKVEARIIVLAVLRMMKENYSLGVPVKDDLMIVLGPNKVNKIQAKHDLEVKDAITKLLQDDLGLKVFLDGPSIQHKNAHMQKLLDSESNMAETLHIELKSSTRRPKILQRLKVPKKSLHHWLQRRVGSTGR
cEEEEccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHccccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccHHHccccHHHHHHHHHHHHccccc
cEEEEEcccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccEHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHccccccEEEccccccHHHHHHccccHHHHHHHHHHHHHHHcc
mrvvfgsssssssAIVATQTRlynhrnkpnkhpvtklfplasssslssiptvhsSQTALLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIVESVVVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLnelgvaplelfdgsgfkLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLcvnkpdvnLAIRYAcivpradiLFCNFVREFGKKRDLVSALRAYDaskkhlsspnmyICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKhleakgvlkldvFTYSTIVKVFADAKWWQMALKVKEDMlsagvtpntITWSSLINACANAGLVEQAMHLFEEMLqagcepnsqCCNILLQACVEACQFDRAFRLFRSWTLSKTQValgedydgntdrisnmehkdkqsitntpnfvpnshyssfdkrfsfkpttttYNILMKACCTDYYRVKALMNEMrtvglspnhiSWTILIDacggsgnvEGALQILKIMredgmspdvVAYTTAIKVCVRSKRLKQAFSLFEEMKHYQIQPNLVTYITLLRARSRYGSLHEVQQCLAVYQDMWKAGYKANDTYLKELIEEWCEGVIqdknqnqgevtlcrrtnsqrpqSLLLEKVAVHLQKSAAENLAIDLRGLTKVEARIIVLAVLRMMKEnyslgvpvkddlmivlgpnkvnkiqAKHDLEVKDAITKLLQDdlglkvfldgpsiqhknAHMQKLLDSESNMAETLHIELKsstrrpkilqrlkvpkkSLHHWLQRRVGSTGR
mrvvfgsssssssaiVATQTRLYNHRNKPNKHPVTKLFPLASSSSLSSIPTVHSSQTALLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIVESVVVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFGKKRDLVSALRAYDAskkhlsspnmyiCRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSwtlsktqvalgedydgntDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQILKIMREDGMSPDVVAYTTAIKVCVRSKRLKQAFSLFeemkhyqiqpnLVTYITLLRARSRYGSLHEVQQCLAVYQDMWKAGYKANDTYLKELIEEWCEGVIQDKNQNQGEVTLCRRTNSQRPQSLLLEKVAVHLQKSAAEnlaidlrgltkVEARIIVLAVLRMMKENYSLGVPVKDDLMIVLGPNKVNKIQAKHDLEVKDAITKLLQDDLGLKVFLDGPSIQHKNAHMQKLLDSESNMAETLHIelksstrrpkilqrlkvpkkslhhwlqrrvgstgr
MRVVFGsssssssAIVATQTRLYNHRNKPNKHPVTKLFPLAsssslssiptvhssQTALLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIvesvvvseGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDYDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQILKIMREDGMSPDVVAYTTAIKVCVRSKRLKQAFSLFEEMKHYQIQPNLVTYITLLRARSRYGSLHEVQQCLAVYQDMWKAGYKANDTYLKELIEEWCEGVIQDKNQNQGEVTLCRRTNSQRPQSLLLEKVAVHLQKSAAENLAIDLRGLTKVEARIIVLAVLRMMKENYSLGVPVKDDLMIVLGPNKVNKIQAKHDLEVKDAITKLLQDDLGLKVFLDGPSIQHKNAHMQKLLDSESNMAETLHIELKSSTRRPKILQRLKVPKKSLHHWLQRRVGSTGR
************************************************************************YYADMASKLAKDGRLEEFAMIVESVVVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDY*****************************YSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQILKIMREDGMSPDVVAYTTAIKVCVRSKRLKQAFSLFEEMKHYQIQPNLVTYITLLRARSRYGSLHEVQQCLAVYQDMWKAGYKANDTYLKELIEEWCEGVIQDKNQ**GEVTLCR*********LLLEKVAVHLQKSAAENLAIDLRGLTKVEARIIVLAVLRMMKENYSLGVPVKDDLMIVLGPNKVNKIQAKHDLEVKDAITKLLQDDLGLKVFLDGP************************************************************
*RVVF**SSSS***IVATQTRLYNHRNKPNKHPVTKLFPLASSSSLSSIPTVHSSQTALLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIVESVVVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDYDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQILKIMREDGMSPDVVAYTTAIKVCVRSKRLKQAFSLFEEMKHYQIQPNLVTYITLLRARSRYGSLHEVQQCLAVYQDMWKAGYKANDTYLKELIEEWCEGVIQDKNQNQGEVTLCRRTNSQRPQSLLLEKVAVHLQKSAAENLAIDLRGLTKVEARIIVLAVLRMMKENYSLGVPVKDDLMIVLGPNKVNKIQAKHDLEVKDAITKLLQDDLGLKVFLDGPSIQHKNAHMQKLLD***************STRRPKILQRLKVPKKSLHHWLQRRV*****
**************IVATQTRLYNHRNKPNKHPVTKLFPLAS****************LLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIVESVVVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDYDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQILKIMREDGMSPDVVAYTTAIKVCVRSKRLKQAFSLFEEMKHYQIQPNLVTYITLLRARSRYGSLHEVQQCLAVYQDMWKAGYKANDTYLKELIEEWCEGVIQDKNQNQGEVTLCRRTNSQRPQSLLLEKVAVHLQKSAAENLAIDLRGLTKVEARIIVLAVLRMMKENYSLGVPVKDDLMIVLGPNKVNKIQAKHDLEVKDAITKLLQDDLGLKVFLDGPSIQHKNAHMQKLLDSESNMAETLHIELKSSTRRPKILQRLKVPKKSLHHWLQRRVGSTGR
MRVVFGSSSSSSSAIVATQTRLYNHRNKPNKHPVTKLFPLASSSSLSSIPTVHSSQTALLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIVESVVVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDYDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQILKIMREDGMSPDVVAYTTAIKVCVRSKRLKQAFSLFEEMKHYQIQPNLVTYITLLRARSRYGSLHEVQQCLAVYQDMWKAGYKANDTYLKELIEEWCEGVIQDKNQNQGEVTLCRRTNSQRPQSLLLEKVAVHLQKSAAENLAIDLRGLTKVEARIIVLAVLRMMKENYSLGVPVKDDLMIVLGPNKVNKIQAKHDLEVKDAITKLLQDDLGLKVFLDGPSIQHKNAHMQKLLDSESNMAETLHIELKSSTRRPKILQRLKVPKKSLHHWLQRRVGS***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRVVFGSSSSSSSAIVATQTRLYNHRNKPNKHPVTKLFPLASSSSLSSIPTVHSSQTALLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIVESVVVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDYDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQILKIMREDGMSPDVVAYTTAIKVCVRSKRLKQAFSLFEEMKHYQIQPNLVTYITLLRARSRYGSLHEVQQCLAVYQDMWKAGYKANDTYLKELIEEWCEGVIQDKNQNQGEVTLCRRTNSQRPQSLLLEKVAVHLQKSAAENLAIDLRGLTKVEARIIVLAVLRMMKENYSLGVPVKDDLMIVLGPNKVNKIQAKHDLEVKDAITKLLQDDLGLKVFLDGPSIQHKNAHMQKLLDSESNMAETLHIELKSSTRRPKILQRLKVPKKSLHHWLQRRVGSTGR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query850 2.2.26 [Sep-21-2011]
Q8GYL7852 Pentatricopeptide repeat- yes no 0.98 0.977 0.546 0.0
Q3ECK2548 Pentatricopeptide repeat- no no 0.385 0.598 0.272 2e-28
Q9S7Q2 862 Pentatricopeptide repeat- no no 0.452 0.446 0.234 4e-27
Q9FIX3747 Pentatricopeptide repeat- no no 0.5 0.568 0.232 4e-27
Q9LYZ9819 Pentatricopeptide repeat- no no 0.501 0.520 0.220 3e-26
Q0WMY5952 Pentatricopeptide repeat- no no 0.442 0.394 0.241 4e-26
Q9M9X9987 Pentatricopeptide repeat- no no 0.465 0.401 0.239 7e-26
Q9SZ52 1112 Pentatricopeptide repeat- no no 0.431 0.330 0.223 3e-25
Q8L844709 Pentatricopeptide repeat- no no 0.445 0.534 0.224 3e-25
Q0WVK7741 Pentatricopeptide repeat- no no 0.52 0.596 0.224 1e-24
>sp|Q8GYL7|PP361_ARATH Pentatricopeptide repeat-containing protein At5g02830, chloroplastic OS=Arabidopsis thaliana GN=At5g02830 PE=2 SV=3 Back     alignment and function desciption
 Score =  912 bits (2358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/855 (54%), Positives = 605/855 (70%), Gaps = 22/855 (2%)

Query: 3   VVFGSSSSSSSAIVATQTRLY------NHRNKPNKHPVTKLFP---LASSSSLSSIPTVH 53
           +VFGSSS+ ++       R Y      N + K N    TKL P      S S +S+   H
Sbjct: 6   IVFGSSSAITNP-HHHHRRCYATAPESNRKTKSNSS-FTKLLPSLPQQHSPSPASVSATH 63

Query: 54  SSQTALLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIVESVVVSEG-NVSKFASMLS 112
           S  +   + VR       +YYAD ASKLA+DGR+E+ A+I E++    G NV++FASM+ 
Sbjct: 64  SLSSHFSNVVRWIPDGSLEYYADFASKLAEDGRIEDVALIAETLAAESGANVARFASMVD 123

Query: 113 LEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVE 172
            ++++ GI  ++R+G+I+ VV  LK++ ++G+APL+L D S  KL++ + + + +S +VE
Sbjct: 124 YDLLSKGISSNLRQGKIESVVYTLKRIEKVGIAPLDLVDDSSVKLMRKQFRAMANSVQVE 183

Query: 173 MFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFG 232
             + LME+L      +KEL + F +V+ CV   +  LAIRYAC++P  ++L C  +  FG
Sbjct: 184 KAIDLMEILAGLGFKIKELVDPFDVVKSCVEISNPQLAIRYACLLPHTELLLCRIIHGFG 243

Query: 233 KKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIY 292
           KK D+VS + AY+A K+ L +PNMYICRT+IDVCG+CGDY+KSR IYEDL  +N+  NIY
Sbjct: 244 KKGDMVSVMTAYEACKQILDTPNMYICRTMIDVCGLCGDYVKSRYIYEDLLKENIKPNIY 303

Query: 293 VFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKH 352
           V NSLMNVN+HDL +TL+VYKNMQ L V ADM SYNILLK CCLAG   LAQ+IY E K 
Sbjct: 304 VINSLMNVNSHDLGYTLKVYKNMQILDVTADMTSYNILLKTCCLAGRVDLAQDIYKEAKR 363

Query: 353 LEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAG 412
           +E+ G+LKLD FTY TI+KVFADAK W+ ALKVK+DM S GVTPNT TWSSLI+ACANAG
Sbjct: 364 MESSGLLKLDAFTYCTIIKVFADAKMWKWALKVKDDMKSVGVTPNTHTWSSLISACANAG 423

Query: 413 LVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGED- 471
           LVEQA HLFEEML +GCEPNSQC NILL ACVEACQ+DRAFRLF+SW  S    +L  D 
Sbjct: 424 LVEQANHLFEEMLASGCEPNSQCFNILLHACVEACQYDRAFRLFQSWKGSSVNESLYADD 483

Query: 472 --YDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDY 529
               G T   + +++    S+ N  +   NS Y    KRF FKPTT TYNIL+KAC TDY
Sbjct: 484 IVSKGRTSSPNILKNNGPGSLVNRNS---NSPYIQASKRFCFKPTTATYNILLKACGTDY 540

Query: 530 YRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQILKIMREDGMSPDVVAYTTA 589
           YR K LM+EM+++GLSPN I+W+ LID CGGSG+VEGA++IL+ M   G  PDVVAYTTA
Sbjct: 541 YRGKELMDEMKSLGLSPNQITWSTLIDMCGGSGDVEGAVRILRTMHSAGTRPDVVAYTTA 600

Query: 590 IKVCVRSKRLKQAFSLFEEMKHYQIQPNLVTYITLLRARSRYGSLHEVQQCLAVYQDMWK 649
           IK+C  +K LK AFSLFEEM+ YQI+PN VTY TLL+ARS+YGSL EV+QCLA+YQDM  
Sbjct: 601 IKICAENKCLKLAFSLFEEMRRYQIKPNWVTYNTLLKARSKYGSLLEVRQCLAIYQDMRN 660

Query: 650 AGYKANDTYLKELIEEWCEGVIQDKNQNQGEVTLCRRTNSQRPQSLLLEKVAVHLQKSAA 709
           AGYK ND +LKELIEEWCEGVIQ+  Q+Q +++     N+ RP SLL+EKVA H+Q+  A
Sbjct: 661 AGYKPNDHFLKELIEEWCEGVIQENGQSQDKISDQEGDNAGRPVSLLIEKVATHMQERTA 720

Query: 710 ENLAIDLRGLTKVEARIIVLAVLRMMKENYSLGVPVKDDLMIVLGPNKVNKIQAKHDLEV 769
            NLAIDL+GLTK+EAR++VLAVLRM+KE+Y  G  V DD++I++G ++ N +  K ++ V
Sbjct: 721 GNLAIDLQGLTKIEARLVVLAVLRMIKEDYMRGDVVIDDVLIIIGTDEANTVSGKQEITV 780

Query: 770 KDAITKLLQDDLGLKVFLDGPSIQHKNAHMQKLLDSESNMAETLHIELKSSTRRPKILQR 829
           ++A+ KLL+D+L L V   G     ++AH     D E N    + I   SSTRRP IL+R
Sbjct: 781 QEALVKLLRDELSLVVLPAGQRNIIQDAHCVDDADQE-NTKSFVSI---SSTRRPAILER 836

Query: 830 LKVPKKSLHHWLQRR 844
           L V K SL+ WLQRR
Sbjct: 837 LMVTKASLYQWLQRR 851





Arabidopsis thaliana (taxid: 3702)
>sp|Q3ECK2|PPR92_ARATH Pentatricopeptide repeat-containing protein At1g62680, mitochondrial OS=Arabidopsis thaliana GN=At1g62680 PE=2 SV=2 Back     alignment and function description
>sp|Q9S7Q2|PP124_ARATH Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 Back     alignment and function description
>sp|Q0WMY5|PP365_ARATH Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 Back     alignment and function description
>sp|Q9M9X9|PPR18_ARATH Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 Back     alignment and function description
>sp|Q8L844|PP413_ARATH Pentatricopeptide repeat-containing protein At5g42310, mitochondrial OS=Arabidopsis thaliana GN=At5g42310 PE=2 SV=1 Back     alignment and function description
>sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query850
225439759842 PREDICTED: pentatricopeptide repeat-cont 0.937 0.946 0.625 0.0
224068636828 predicted protein [Populus trichocarpa] 0.915 0.939 0.606 0.0
449448705849 PREDICTED: pentatricopeptide repeat-cont 0.975 0.976 0.581 0.0
449521499855 PREDICTED: LOW QUALITY PROTEIN: pentatri 0.977 0.971 0.574 0.0
30679784852 pentatricopeptide repeat-containing prot 0.98 0.977 0.546 0.0
39104565852 unknown protein [Arabidopsis thaliana] 0.98 0.977 0.545 0.0
255568444786 pentatricopeptide repeat-containing prot 0.874 0.945 0.593 0.0
356572391811 PREDICTED: pentatricopeptide repeat-cont 0.937 0.982 0.536 0.0
357510555829 Pentatricopeptide repeat-containing prot 0.889 0.911 0.531 0.0
7413558798 putative protein [Arabidopsis thaliana] 0.911 0.971 0.486 0.0
>gi|225439759|ref|XP_002273255.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Vitis vinifera] gi|297741486|emb|CBI32618.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1004 bits (2595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/817 (62%), Positives = 624/817 (76%), Gaps = 20/817 (2%)

Query: 40  LASSSSLSSIPTVHS--SQTALLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIVESV 97
           L +S+S    P + S  S+  LLS VR DL++    Y+D+A+KL +DGR ++F+ + E++
Sbjct: 36  LLTSTSARLSPPISSLRSRHPLLSDVRWDLNN----YSDLATKLVQDGRFDDFSTMAETL 91

Query: 98  VVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKL 157
           ++S   +S+      +E+V++GI   +REGR+ CVV VL+K+++LG+ PLELFDGS  +L
Sbjct: 92  ILSGVELSQL-----VELVSAGISGLLREGRVYCVVEVLRKVDKLGICPLELFDGSTLEL 146

Query: 158 LKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIV 217
           L  EC+R+L+ G+VE  V L+E+L+ F  PVK+L E    +++CVNK + NLA+RYACI+
Sbjct: 147 LSKECRRILNCGQVEEVVELIEILDGFHFPVKKLLEPLDFIKICVNKRNPNLAVRYACIL 206

Query: 218 PRADILFCNFVREFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRA 277
           P A ILFC  + EFGKKRDL SAL A++ASK+ L  PNMY  RT+IDVCG+C  Y KSR 
Sbjct: 207 PHAQILFCTIIHEFGKKRDLGSALTAFEASKQKLIGPNMYCYRTMIDVCGLCSHYQKSRY 266

Query: 278 IYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLA 337
           IYE+L +Q +T NIYVFNSLMNVN HDL +T  VYKNMQ LGV ADMASYNILLKACC+A
Sbjct: 267 IYEELLAQKITPNIYVFNSLMNVNVHDLSYTFNVYKNMQNLGVTADMASYNILLKACCVA 326

Query: 338 GNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPN 397
           G   LAQEIY EV++LE+ G+LKLDVFTYSTI+KVFADAK WQMALK+KEDMLSAGV PN
Sbjct: 327 GRVDLAQEIYREVQNLESNGMLKLDVFTYSTIIKVFADAKLWQMALKIKEDMLSAGVIPN 386

Query: 398 TITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFR 457
           T+TWS+LI++CANAG+ EQA+ LF+EML AGCEPNSQC NILL ACVEACQ+DRAFRLF+
Sbjct: 387 TVTWSALISSCANAGITEQAIQLFKEMLLAGCEPNSQCYNILLHACVEACQYDRAFRLFQ 446

Query: 458 SWTLSKTQVALGEDYDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTT 517
           SW  S+ Q                +E K +  IT+ PN + NSH+ SF K F F PTTTT
Sbjct: 447 SWKDSRFQEI---SGGTGNGNTVGVELKHQNCITSMPNCLSNSHHLSFSKSFPFTPTTTT 503

Query: 518 YNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQILKIMRED 577
           YNILMKAC TDYYR KALM+EM+T GLSPNHISW+ILID CGG+GN+ GA++ILK MRE 
Sbjct: 504 YNILMKACGTDYYRAKALMDEMKTAGLSPNHISWSILIDICGGTGNIVGAVRILKTMREA 563

Query: 578 GMSPDVVAYTTAIKVCVRSKRLKQAFSLFEEMKHYQIQPNLVTYITLLRARSRYGSLHEV 637
           G+ PDVVAYTTAIK CV SK LK AFSLF EMK YQIQPNLVTY TLLRARSRYGSLHEV
Sbjct: 564 GIKPDVVAYTTAIKYCVESKNLKIAFSLFAEMKRYQIQPNLVTYNTLLRARSRYGSLHEV 623

Query: 638 QQCLAVYQDMWKAGYKANDTYLKELIEEWCEGVIQDKNQNQGEVTLCRRTNSQRPQSLLL 697
           QQCLA+YQ M KAGYK+ND YLKELIEEWCEGVIQD N NQ + +   R +  RPQSLLL
Sbjct: 624 QQCLAIYQHMRKAGYKSNDYYLKELIEEWCEGVIQDNNLNQSKFSSVNRADWGRPQSLLL 683

Query: 698 EKVAVHLQKSAAENLAIDLRGLTKVEARIIVLAVLRMMKENYSLGVPVKDDLMIVLGPNK 757
           EKVA HLQKS AE+LAIDL+GLT+VEARI+VLAVLRM+KENY LG P+KDD++I+LG  K
Sbjct: 684 EKVAAHLQKSVAESLAIDLQGLTQVEARIVVLAVLRMIKENYILGHPIKDDILIILGIKK 743

Query: 758 VNKIQAKHDLEVKDAITKLLQDDLGLKVFLDGPSIQ-HKNAHMQKLLDSESNMAETLH-- 814
           V+    +H+  VK AI KLLQD+LGL+V   GP I   K  ++     S+ +  E L   
Sbjct: 744 VDANLVEHESPVKGAIIKLLQDELGLEVAFAGPKIALDKRINLGGPPGSDPDWQEALGRN 803

Query: 815 ---IELKSSTRRPKILQRLKVPKKSLHHWLQRRVGST 848
               EL+SSTRRP +LQR KV +KSL HWLQRRVG+T
Sbjct: 804 RLPTELESSTRRPAVLQRFKVTRKSLDHWLQRRVGAT 840




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224068636|ref|XP_002326162.1| predicted protein [Populus trichocarpa] gi|222833355|gb|EEE71832.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449448705|ref|XP_004142106.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449521499|ref|XP_004167767.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|30679784|ref|NP_195903.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332278227|sp|Q8GYL7.3|PP361_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g02830, chloroplastic; Flags: Precursor gi|332003140|gb|AED90523.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|39104565|dbj|BAC42187.2| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255568444|ref|XP_002525196.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535493|gb|EEF37162.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356572391|ref|XP_003554352.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|357510555|ref|XP_003625566.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355500581|gb|AES81784.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|7413558|emb|CAB86037.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query850
TAIR|locus:2151236852 AT5G02830 [Arabidopsis thalian 0.901 0.899 0.571 1.7e-233
TAIR|locus:2026207548 AT1G62680 [Arabidopsis thalian 0.385 0.598 0.272 1.9e-26
TAIR|locus:2157607709 AT5G42310 [Arabidopsis thalian 0.472 0.566 0.255 9.9e-24
TAIR|locus:2024296598 AT1G09900 "AT1G09900" [Arabido 0.356 0.506 0.245 2.5e-18
TAIR|locus:2151281819 AT5G02860 [Arabidopsis thalian 0.536 0.556 0.215 2.9e-23
TAIR|locus:2175443952 AT5G04810 [Arabidopsis thalian 0.495 0.442 0.230 3e-23
TAIR|locus:2015494629 RPF3 "RNA processing factor 3" 0.421 0.569 0.244 9e-23
TAIR|locus:2163041527 AT5G41170 [Arabidopsis thalian 0.428 0.690 0.239 1.4e-22
TAIR|locus:2031301577 AT1G63400 [Arabidopsis thalian 0.429 0.632 0.244 3.2e-22
TAIR|locus:2116772 1112 PGR3 "AT4G31850" [Arabidopsis 0.485 0.371 0.229 3.6e-22
TAIR|locus:2151236 AT5G02830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2252 (797.8 bits), Expect = 1.7e-233, P = 1.7e-233
 Identities = 444/777 (57%), Positives = 571/777 (73%)

Query:    72 DYYADMASKLAKDGRLEEFAMIXXXXXXXXG-NVSKFASMLSLEMVASGIVKSIREGRID 130
             +YYAD ASKLA+DGR+E+ A+I        G NV++FASM+  ++++ GI  ++R+G+I+
Sbjct:    82 EYYADFASKLAEDGRIEDVALIAETLAAESGANVARFASMVDYDLLSKGISSNLRQGKIE 141

Query:   131 CVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKE 190
              VV  LK++ ++G+APL+L D S  KL++ + + + +S +VE  + LME+L      +KE
Sbjct:   142 SVVYTLKRIEKVGIAPLDLVDDSSVKLMRKQFRAMANSVQVEKAIDLMEILAGLGFKIKE 201

Query:   191 LDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFGKKRDLVSALRAYDASKKH 250
             L + F +V+ CV   +  LAIRYAC++P  ++L C  +  FGKK D+VS + AY+A K+ 
Sbjct:   202 LVDPFDVVKSCVEISNPQLAIRYACLLPHTELLLCRIIHGFGKKGDMVSVMTAYEACKQI 261

Query:   251 LSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLE 310
             L +PNMYICRT+IDVCG+CGDY+KSR IYEDL  +N+  NIYV NSLMNVN+HDL +TL+
Sbjct:   262 LDTPNMYICRTMIDVCGLCGDYVKSRYIYEDLLKENIKPNIYVINSLMNVNSHDLGYTLK 321

Query:   311 VYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIV 370
             VYKNMQ L V ADM SYNILLK CCLAG   LAQ+IY E K +E+ G+LKLD FTY TI+
Sbjct:   322 VYKNMQILDVTADMTSYNILLKTCCLAGRVDLAQDIYKEAKRMESSGLLKLDAFTYCTII 381

Query:   371 KVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCE 430
             KVFADAK W+ ALKVK+DM S GVTPNT TWSSLI+ACANAGLVEQA HLFEEML +GCE
Sbjct:   382 KVFADAKMWKWALKVKDDMKSVGVTPNTHTWSSLISACANAGLVEQANHLFEEMLASGCE 441

Query:   431 PNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGED---YDGNTDRISNMEHKDK 487
             PNSQC NILL ACVEACQ+DRAFRLF+SW  S    +L  D     G T   + +++   
Sbjct:   442 PNSQCFNILLHACVEACQYDRAFRLFQSWKGSSVNESLYADDIVSKGRTSSPNILKNNGP 501

Query:   488 QSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPN 547
              S+ N  +   NS Y    KRF FKPTT TYNIL+KAC TDYYR K LM+EM+++GLSPN
Sbjct:   502 GSLVNRNS---NSPYIQASKRFCFKPTTATYNILLKACGTDYYRGKELMDEMKSLGLSPN 558

Query:   548 HISWTILIDACGGSGNVEGALQILKIMREDGMSPDVVAYTTAIKVCVRSKRLKQAFSLFE 607
              I+W+ LID CGGSG+VEGA++IL+ M   G  PDVVAYTTAIK+C  +K LK AFSLFE
Sbjct:   559 QITWSTLIDMCGGSGDVEGAVRILRTMHSAGTRPDVVAYTTAIKICAENKCLKLAFSLFE 618

Query:   608 EMKHYQIQPNLVTYITLLRARSRYGSLHEVQQCLAVYQDMWKAGYKANDTYLKELIEEWC 667
             EM+ YQI+PN VTY TLL+ARS+YGSL EV+QCLA+YQDM  AGYK ND +LKELIEEWC
Sbjct:   619 EMRRYQIKPNWVTYNTLLKARSKYGSLLEVRQCLAIYQDMRNAGYKPNDHFLKELIEEWC 678

Query:   668 EGVIQDKNQNQGEVTLCRRTNSQRPQSLLLEKVAVHLQKSAAENLAIDLRGLTKVEARII 727
             EGVIQ+  Q+Q +++     N+ RP SLL+EKVA H+Q+  A NLAIDL+GLTK+EAR++
Sbjct:   679 EGVIQENGQSQDKISDQEGDNAGRPVSLLIEKVATHMQERTAGNLAIDLQGLTKIEARLV 738

Query:   728 VLAVLRMMKENYSLGVPVKDDLMIVLGPNKVNKIQAKHDLEVKDAITKLLQDDLGLKVFL 787
             VLAVLRM+KE+Y  G  V DD++I++G ++ N +  K ++ V++A+ KLL+D+L L V  
Sbjct:   739 VLAVLRMIKEDYMRGDVVIDDVLIIIGTDEANTVSGKQEITVQEALVKLLRDELSLVVLP 798

Query:   788 DGPSIQHKNAHMQKLLDSESNMAETLHIELKSSTRRPKILQRLKVPKKSLHHWLQRR 844
              G     ++AH     D E N    + I   SSTRRP IL+RL V K SL+ WLQRR
Sbjct:   799 AGQRNIIQDAHCVDDADQE-NTKSFVSI---SSTRRPAILERLMVTKASLYQWLQRR 851


GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2026207 AT1G62680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157607 AT5G42310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024296 AT1G09900 "AT1G09900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151281 AT5G02860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175443 AT5G04810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015494 RPF3 "RNA processing factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163041 AT5G41170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031301 AT1G63400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116772 PGR3 "AT4G31850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8GYL7PP361_ARATHNo assigned EC number0.54610.980.9776yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00023063001
SubName- Full=Chromosome chr8 scaffold_29, whole genome shotgun sequence; (818 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query850
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-27
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-24
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-15
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-12
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-11
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-09
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 5e-08
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-07
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 6e-07
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-07
pfam0153531 pfam01535, PPR, PPR repeat 6e-06
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 1e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-05
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 4e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-04
pfam0153531 pfam01535, PPR, PPR repeat 6e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.001
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.001
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.002
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score =  119 bits (299), Expect = 2e-27
 Identities = 88/362 (24%), Positives = 156/362 (43%), Gaps = 63/362 (17%)

Query: 254 PNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMN----VNAHDLKFTL 309
            N++    +ID C   G   K+   Y  +RS+NV  +  VFN+L++      A D  F  
Sbjct: 505 ANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAF-- 562

Query: 310 EVYKNM--QKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYS 367
           +V   M  +   +  D  +   L+KAC  AG    A+E+Y  +     KG  ++    Y+
Sbjct: 563 DVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEV----YT 618

Query: 368 TIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQA 427
             V   +    W  AL + +DM   GV P+ + +S+L++   +AG +++A  + ++  + 
Sbjct: 619 IAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQ 678

Query: 428 GCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDYDGNTDRISNMEHKDK 487
           G +  +   + L+ AC  A  + +A  L+      K                        
Sbjct: 679 GIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIK------------------------ 714

Query: 488 QSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKAL--MNEMRTVGLS 545
                                   +PT +T N L+ A C      KAL  ++EM+ +GL 
Sbjct: 715 -----------------------LRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLC 751

Query: 546 PNHISWTILIDACGGSGNVEGALQILKIMREDGMSPDVVAYTTAIKVCVRSKRLKQAFSL 605
           PN I+++IL+ A     + +  L +L   +EDG+ P++V       +C+R  R ++A +L
Sbjct: 752 PNTITYSILLVASERKDDADVGLDLLSQAKEDGIKPNLVMCRCITGLCLR--RFEKACAL 809

Query: 606 FE 607
            E
Sbjct: 810 GE 811


Length = 1060

>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 850
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.91
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.88
KOG4626966 consensus O-linked N-acetylglucosamine transferase 99.87
PRK11788389 tetratricopeptide repeat protein; Provisional 99.84
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.83
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.83
PRK11788389 tetratricopeptide repeat protein; Provisional 99.83
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.82
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.79
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.78
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.78
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.77
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.76
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.75
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.73
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.73
PRK14574822 hmsH outer membrane protein; Provisional 99.71
PRK14574 822 hmsH outer membrane protein; Provisional 99.69
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.68
KOG2003840 consensus TPR repeat-containing protein [General f 99.67
KOG2076895 consensus RNA polymerase III transcription factor 99.63
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.61
KOG2076895 consensus RNA polymerase III transcription factor 99.5
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.4
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.39
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.36
KOG2003840 consensus TPR repeat-containing protein [General f 99.35
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.34
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.33
PF1304150 PPR_2: PPR repeat family 99.33
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.32
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.3
KOG0547606 consensus Translocase of outer mitochondrial membr 99.29
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.29
PF1304150 PPR_2: PPR repeat family 99.28
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.26
KOG1126638 consensus DNA-binding cell division cycle control 99.26
KOG1915677 consensus Cell cycle control protein (crooked neck 99.26
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.25
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.24
KOG1126638 consensus DNA-binding cell division cycle control 99.23
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.22
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.21
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.21
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.21
KOG0547606 consensus Translocase of outer mitochondrial membr 99.21
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.2
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.19
PRK12370553 invasion protein regulator; Provisional 99.18
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.14
PRK12370553 invasion protein regulator; Provisional 99.12
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.1
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.09
KOG2376652 consensus Signal recognition particle, subunit Srp 99.08
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.05
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.05
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.04
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.02
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.01
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.01
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.98
KOG1915677 consensus Cell cycle control protein (crooked neck 98.95
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.93
KOG2376652 consensus Signal recognition particle, subunit Srp 98.93
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.87
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.85
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.84
PRK11189296 lipoprotein NlpI; Provisional 98.82
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.82
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.81
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.8
KOG1129478 consensus TPR repeat-containing protein [General f 98.77
PRK11189296 lipoprotein NlpI; Provisional 98.77
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.76
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.72
KOG1129478 consensus TPR repeat-containing protein [General f 98.72
PF1285434 PPR_1: PPR repeat 98.72
PRK04841903 transcriptional regulator MalT; Provisional 98.68
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.67
PF1285434 PPR_1: PPR repeat 98.66
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.65
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.64
KOG1125579 consensus TPR repeat-containing protein [General f 98.63
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.59
KOG2047835 consensus mRNA splicing factor [RNA processing and 98.52
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.52
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.51
PRK04841903 transcriptional regulator MalT; Provisional 98.49
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.44
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.42
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.39
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.36
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.35
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.33
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.33
KOG1125579 consensus TPR repeat-containing protein [General f 98.3
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 98.29
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 98.26
PRK10370198 formate-dependent nitrite reductase complex subuni 98.26
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.25
PLN02789320 farnesyltranstransferase 98.22
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.22
PLN02789320 farnesyltranstransferase 98.22
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.18
KOG1128777 consensus Uncharacterized conserved protein, conta 98.15
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 98.15
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.1
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.07
PRK10370198 formate-dependent nitrite reductase complex subuni 98.06
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.05
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.05
PRK15359144 type III secretion system chaperone protein SscB; 98.04
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.04
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.02
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.01
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.0
PRK15359144 type III secretion system chaperone protein SscB; 97.99
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.98
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.97
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.96
KOG11271238 consensus TPR repeat-containing protein [RNA proce 97.96
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.95
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.91
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.89
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.89
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.88
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.86
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.86
KOG1128777 consensus Uncharacterized conserved protein, conta 97.86
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.85
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.82
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.73
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.69
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.67
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.66
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.63
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.63
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.57
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.56
smart0046380 SMR Small MutS-related domain. 97.55
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.5
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.5
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.48
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.47
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.39
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.38
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.36
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.36
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.31
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.18
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.17
PF12688120 TPR_5: Tetratrico peptide repeat 97.16
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.14
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.14
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.13
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.13
KOG0553304 consensus TPR repeat-containing protein [General f 97.02
PF0171383 Smr: Smr domain; InterPro: IPR002625 This family i 97.01
KOG0553304 consensus TPR repeat-containing protein [General f 96.96
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.95
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.92
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.88
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.88
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.85
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.85
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.68
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.65
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.63
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.63
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.62
PRK15331165 chaperone protein SicA; Provisional 96.61
KOG20411189 consensus WD40 repeat protein [General function pr 96.6
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.59
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.58
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.58
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.55
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.51
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 96.51
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.42
COG4700251 Uncharacterized protein conserved in bacteria cont 96.4
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.38
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.37
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.36
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.33
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.33
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.32
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.31
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.31
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.3
KOG1585308 consensus Protein required for fusion of vesicles 96.28
PRK10803263 tol-pal system protein YbgF; Provisional 96.24
PF12688120 TPR_5: Tetratrico peptide repeat 96.21
PRK10803263 tol-pal system protein YbgF; Provisional 96.16
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.0
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 95.99
PRK10153517 DNA-binding transcriptional activator CadC; Provis 95.97
CHL00033168 ycf3 photosystem I assembly protein Ycf3 95.95
KOG3941406 consensus Intermediate in Toll signal transduction 95.92
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.89
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 95.87
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.84
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.83
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.68
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.52
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 95.49
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.48
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 95.46
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.42
PRK15331165 chaperone protein SicA; Provisional 95.31
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.29
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.26
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.24
PF1337173 TPR_9: Tetratricopeptide repeat 95.12
COG4700251 Uncharacterized protein conserved in bacteria cont 95.11
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 95.04
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.87
KOG15381081 consensus Uncharacterized conserved protein WDR10, 94.86
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.84
KOG3941406 consensus Intermediate in Toll signal transduction 94.68
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.64
PF1337173 TPR_9: Tetratricopeptide repeat 94.63
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.36
KOG15381081 consensus Uncharacterized conserved protein WDR10, 94.33
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.1
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.02
PF13512142 TPR_18: Tetratricopeptide repeat 93.89
KOG2796366 consensus Uncharacterized conserved protein [Funct 93.82
PF13512142 TPR_18: Tetratricopeptide repeat 93.78
PF13170297 DUF4003: Protein of unknown function (DUF4003) 93.77
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.43
KOG1585308 consensus Protein required for fusion of vesicles 93.39
KOG4555175 consensus TPR repeat-containing protein [Function 93.21
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.13
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 93.11
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.02
KOG1941518 consensus Acetylcholine receptor-associated protei 92.87
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.59
PF13281374 DUF4071: Domain of unknown function (DUF4071) 92.58
KOG1941518 consensus Acetylcholine receptor-associated protei 92.47
COG4105254 ComL DNA uptake lipoprotein [General function pred 92.44
COG3118304 Thioredoxin domain-containing protein [Posttransla 92.41
smart00299140 CLH Clathrin heavy chain repeat homology. 92.34
PRK11906458 transcriptional regulator; Provisional 91.9
COG3898531 Uncharacterized membrane-bound protein [Function u 91.81
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 91.8
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 91.69
KOG20411189 consensus WD40 repeat protein [General function pr 91.58
PF1342844 TPR_14: Tetratricopeptide repeat 91.39
COG4105254 ComL DNA uptake lipoprotein [General function pred 91.31
KOG2610491 consensus Uncharacterized conserved protein [Funct 91.19
COG3898531 Uncharacterized membrane-bound protein [Function u 91.15
PRK11906458 transcriptional regulator; Provisional 91.11
KOG4555175 consensus TPR repeat-containing protein [Function 90.93
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 90.9
PF1342844 TPR_14: Tetratricopeptide repeat 90.57
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 90.03
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 89.96
COG0457291 NrfG FOG: TPR repeat [General function prediction 89.95
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.55
PF13281374 DUF4071: Domain of unknown function (DUF4071) 89.51
KOG4234271 consensus TPR repeat-containing protein [General f 89.39
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 89.21
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.18
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 88.99
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 88.97
PF1343134 TPR_17: Tetratricopeptide repeat 88.97
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 88.79
COG3118304 Thioredoxin domain-containing protein [Posttransla 88.4
smart00299140 CLH Clathrin heavy chain repeat homology. 88.26
COG3629280 DnrI DNA-binding transcriptional activator of the 88.18
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 88.01
KOG1586288 consensus Protein required for fusion of vesicles 87.86
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 87.58
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 87.47
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 87.35
COG3629280 DnrI DNA-binding transcriptional activator of the 87.14
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 87.01
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 86.52
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 86.48
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 86.34
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 86.32
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 86.32
COG2840184 Uncharacterized protein conserved in bacteria [Fun 86.04
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 84.65
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 84.37
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 84.33
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 84.2
KOG2610491 consensus Uncharacterized conserved protein [Funct 83.75
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 83.55
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 83.34
COG2976207 Uncharacterized protein conserved in bacteria [Fun 83.28
PF1343134 TPR_17: Tetratricopeptide repeat 81.97
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 81.17
KOG4234271 consensus TPR repeat-containing protein [General f 80.91
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 80.87
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.1e-70  Score=646.05  Aligned_cols=613  Identities=21%  Similarity=0.349  Sum_probs=523.6

Q ss_pred             hhHHHHHHHHHhhcCChHHHHHHHHHHHHhcCC-hhhHhhhhHHHHHHHHHHHhhhcCchhHHHHHHHHHHHcCCCCccc
Q 003082           71 NDYYADMASKLAKDGRLEEFAMIVESVVVSEGN-VSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLEL  149 (850)
Q Consensus        71 ~~~~~~l~~~l~~~g~~~~A~~l~~~~~~~~~~-p~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~l~~~~~~~~~p~~~  149 (850)
                      ...|..+...|++.|++++|+++|+.|.+.+.. ++..       ....++..+.+.|.+++|..+|+.|..    |+..
T Consensus       370 ~~~~~~~y~~l~r~G~l~eAl~Lfd~M~~~gvv~~~~v-------~~~~li~~~~~~g~~~eAl~lf~~M~~----pd~~  438 (1060)
T PLN03218        370 SPEYIDAYNRLLRDGRIKDCIDLLEDMEKRGLLDMDKI-------YHAKFFKACKKQRAVKEAFRFAKLIRN----PTLS  438 (1060)
T ss_pred             chHHHHHHHHHHHCcCHHHHHHHHHHHHhCCCCCchHH-------HHHHHHHHHHHCCCHHHHHHHHHHcCC----CCHH
Confidence            677777888888888888888888888887643 2211       122334456677888888888887762    5543


Q ss_pred             cchhhhHHHHHHHHhhhhcCcHHHHHHHHHHHHhCCCCCCCcccHHHHHHHHHcCCChHHHHHHhhhCCCCcchHHHHHH
Q 003082          150 FDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVR  229 (850)
Q Consensus       150 ~~~~~~~~l~~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~p~~~~~~~~li~  229 (850)
                          +++.++..|   ++.|++++|.++++.|.+.++.|+                               ..+|+.||.
T Consensus       439 ----Tyn~LL~a~---~k~g~~e~A~~lf~~M~~~Gl~pD-------------------------------~~tynsLI~  480 (1060)
T PLN03218        439 ----TFNMLMSVC---ASSQDIDGALRVLRLVQEAGLKAD-------------------------------CKLYTTLIS  480 (1060)
T ss_pred             ----HHHHHHHHH---HhCcCHHHHHHHHHHHHHcCCCCC-------------------------------HHHHHHHHH
Confidence                355555554   357888888888888888776554                               378999999


Q ss_pred             HHHhcCChHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCcCHHHHHHHHHhhc--CChHH
Q 003082          230 EFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNA--HDLKF  307 (850)
Q Consensus       230 ~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~pd~~t~~~ll~~~~--~~~~~  307 (850)
                      +|++.|++++|.++|++|.+.|+.||..+|+.||.+|++.|++++|.++|++|.+.|+.||..+|++||.+++  |++++
T Consensus       481 ~y~k~G~vd~A~~vf~eM~~~Gv~PdvvTynaLI~gy~k~G~~eeAl~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~de  560 (1060)
T PLN03218        481 TCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDR  560 (1060)
T ss_pred             HHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999865  69999


Q ss_pred             HHHHHHHHHH--cCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHHhhhcCCcccCHhHHHHHHHHHHhcCCHHHHHHH
Q 003082          308 TLEVYKNMQK--LGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKV  385 (850)
Q Consensus       308 a~~l~~~m~~--~g~~pd~~t~~~Ll~~~~~~g~~~~A~~i~~~m~~~~~~g~~~~d~~ty~~li~~~~~~g~~~~A~~l  385 (850)
                      |.++|++|..  .|+.||..+|++||.+|++.|++++|.++|+.|.+   .| +.|+..+|+++|.+|++.|++++|.++
T Consensus       561 A~~lf~eM~~~~~gi~PD~vTynaLI~ay~k~G~ldeA~elf~~M~e---~g-i~p~~~tynsLI~ay~k~G~~deAl~l  636 (1060)
T PLN03218        561 AFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHE---YN-IKGTPEVYTIAVNSCSQKGDWDFALSI  636 (1060)
T ss_pred             HHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHCCCHHHHHHHHHHHHH---cC-CCCChHHHHHHHHHHHhcCCHHHHHHH
Confidence            9999999976  68999999999999999999999999999999987   44 789999999999999999999999999


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHhCCHHHHHHHHHHHhhcccc
Q 003082          386 KEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQ  465 (850)
Q Consensus       386 ~~~m~~~g~~p~~~ty~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~~~~~ll~~~~~~g~~~~A~~l~~~m~~~~~~  465 (850)
                      |++|.+.|+.||..||+++|++|++.|++++|.++|++|.+.|+.||..+|++||.+|++.|++++|.++|++|...   
T Consensus       637 f~eM~~~Gv~PD~~TynsLI~a~~k~G~~eeA~~l~~eM~k~G~~pd~~tynsLI~ay~k~G~~eeA~~lf~eM~~~---  713 (1060)
T PLN03218        637 YDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSI---  713 (1060)
T ss_pred             HHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHc---
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999998754   


Q ss_pred             ccccCccCCchhhhhhhhhhhcccccCCCCCcCCCcccccccccCCCcCHHHHHHHHHHHhc--cHHHHHHHHHHHHHcC
Q 003082          466 VALGEDYDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCT--DYYRVKALMNEMRTVG  543 (850)
Q Consensus       466 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~t~~~li~~~~~--~~~~a~~l~~~m~~~g  543 (850)
                                                                  |+.||..+||++|.+|++  +.++|.++|++|.+.|
T Consensus       714 --------------------------------------------g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~~G  749 (1060)
T PLN03218        714 --------------------------------------------KLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLG  749 (1060)
T ss_pred             --------------------------------------------CCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcC
Confidence                                                        368999999999999985  6899999999999999


Q ss_pred             CCCCHHHHHHHHHHHHcCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHH----c-------------------CCHH
Q 003082          544 LSPNHISWTILIDACGGSGNVEGALQILKIMREDGMSPDVVAYTTAIKVCVR----S-------------------KRLK  600 (850)
Q Consensus       544 ~~p~~~ty~~li~~~~~~g~~~~A~~l~~~m~~~g~~pd~~ty~~li~~~~~----~-------------------g~~~  600 (850)
                      +.||..||+++|.+|++.|++++|.++|++|.+.|+.||..+|++++..|.+    .                   +..+
T Consensus       750 i~Pd~~Ty~sLL~a~~k~G~le~A~~l~~~M~k~Gi~pd~~tynsLIglc~~~y~ka~~l~~~v~~f~~g~~~~~n~w~~  829 (1060)
T PLN03218        750 LCPNTITYSILLVASERKDDADVGLDLLSQAKEDGIKPNLVMCRCITGLCLRRFEKACALGEPVVSFDSGRPQIENKWTS  829 (1060)
T ss_pred             CCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHHHhhhhhhhhhhhccccccccchHH
Confidence            9999999999999999999999999999999999999999999999976432    1                   2346


Q ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhhhhhhhhhcccc
Q 003082          601 QAFSLFEEMKHYQIQPNLVTYITLLRARSRYGSLHEVQQCLAVYQDMWKAGYKANDTYLKELIEEWCEGVIQDKNQNQGE  680 (850)
Q Consensus       601 ~A~~l~~~m~~~g~~p~~~t~~~li~a~~~~g~~~~a~~a~~l~~~M~~~g~~p~~~~~~~li~~~~~~~~~~~~~~~~~  680 (850)
                      +|..+|++|.+.|+.||..||+.+|.++++.+..+.   +..++++|...+..|+..+|++||+++++-           
T Consensus       830 ~Al~lf~eM~~~Gi~Pd~~T~~~vL~cl~~~~~~~~---~~~m~~~m~~~~~~~~~~~y~~Li~g~~~~-----------  895 (1060)
T PLN03218        830 WALMVYRETISAGTLPTMEVLSQVLGCLQLPHDATL---RNRLIENLGISADSQKQSNLSTLVDGFGEY-----------  895 (1060)
T ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHHHhcccccHHH---HHHHHHHhccCCCCcchhhhHHHHHhhccC-----------
Confidence            899999999999999999999999988878887665   666888898899999999999999988531           


Q ss_pred             hhhhhhcCCCchhHHHHHHHHHHHhhhhh---hhHHHHhhccchhHHHHHHHHHHHHHHhhhhcCCCCCCcEE-------
Q 003082          681 VTLCRRTNSQRPQSLLLEKVAVHLQKSAA---ENLAIDLRGLTKVEARIIVLAVLRMMKENYSLGVPVKDDLM-------  750 (850)
Q Consensus       681 ~~~~~~~~~~~~~~~~~e~~~~~~~~~~~---~~~~~~l~~~~~~~a~~~~~~~l~~~~~~~~~~~~~~~~~~-------  750 (850)
                              .+++..++.|+...++.++..   ..|.+|++.|+.++|...++.||+.++.+...|..+|...+       
T Consensus       896 --------~~~A~~l~~em~~~Gi~p~~~~~~~~~~~d~~~~~~~aa~~~l~~wl~~~~~~~~~g~~lp~~~~~~~~~~~  967 (1060)
T PLN03218        896 --------DPRAFSLLEEAASLGVVPSVSFKKSPIVIDAEELPVFAAEVYLLTILKGLKHRLAAGAKLPNVTILLPTEKK  967 (1060)
T ss_pred             --------hHHHHHHHHHHHHcCCCCCcccccCceEEEcccCcchhHHHHHHHHHHHHHHHHhccCcCCcceeeeccccc
Confidence                    134677888888888777663   35889999999999999999999999999999999999888       


Q ss_pred             -EEecCCcccccCcccchHHHHHHHHHhhhcccceEeccCCccccchhhhhhhccccchhhhhhhcccccccccccchhh
Q 003082          751 -IVLGPNKVNKIQAKHDLEVKDAITKLLQDDLGLKVFLDGPSIQHKNAHMQKLLDSESNMAETLHIELKSSTRRPKILQR  829 (850)
Q Consensus       751 -i~~g~gk~s~~~g~~~~~v~~~v~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  829 (850)
                       +.|+-|.++....   .-+=.+|..+|++ |+.+--        ..                           |.- |.
T Consensus       968 ~~~~~~g~~~~~~~---~~~~~~~~~~l~~-l~~~~~--------~~---------------------------~~~-g~ 1007 (1060)
T PLN03218        968 EIYTPKGEKTINLA---GRVGQAVAALLRR-LGLPYQ--------GS---------------------------ESH-GK 1007 (1060)
T ss_pred             eeeccCCchhHHHH---HHHHHHHHHHHHH-hCCCCC--------CC---------------------------CCC-Ce
Confidence             4444444322221   2255777778866 332211        11                           222 66


Q ss_pred             ccccccchHHHHHhhh
Q 003082          830 LKVPKKSLHHWLQRRV  845 (850)
Q Consensus       830 ~~~~~~~~~~~~~~~~  845 (850)
                      +..+..+|.+|||-|.
T Consensus      1008 ~~~~~~~~~~wl~~~~ 1023 (1060)
T PLN03218       1008 LRINGLSLRRWFQPKL 1023 (1060)
T ss_pred             EEeccHHHHHHhcccC
Confidence            8899999999999886



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>smart00463 SMR Small MutS-related domain Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF01713 Smr: Smr domain; InterPro: IPR002625 This family includes the Smr (Small MutS Related) proteins, and the C-terminal region of the MutS2 protein Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG2840 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query850
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-14
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-13
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 77.5 bits (189), Expect = 1e-14
 Identities = 20/143 (13%), Positives = 41/143 (28%), Gaps = 5/143 (3%)

Query: 534 ALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQILKIMRE---DGMSPDVVAYTTAI 590
           A   +     LS            C  +  +  A  +L +            +  Y   +
Sbjct: 113 APSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVM 172

Query: 591 KVCVRSKRLKQAFSLFEEMKHYQIQPNLVTYITLLRARSRYGSLHEVQQCLAVYQDMWKA 650
               R    K+   +   +K   + P+L++Y   L+   R        +     + M + 
Sbjct: 173 LGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERC--LEQMSQE 230

Query: 651 GYKANDTYLKELIEEWCEGVIQD 673
           G K    +   L+ E     +  
Sbjct: 231 GLKLQALFTAVLLSEEDRATVLK 253


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query850
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.94
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.87
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.85
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.85
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.85
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.84
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.82
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.78
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.77
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.76
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.74
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.71
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.71
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.7
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.7
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.69
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.69
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.68
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.65
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.64
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.64
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.64
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.64
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.63
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.62
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.62
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.61
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.6
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.56
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.56
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.55
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.48
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.44
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.43
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.42
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.4
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.39
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.38
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.38
3u4t_A272 TPR repeat-containing protein; structural genomics 99.37
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.36
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.36
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.34
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.34
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.33
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.33
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.33
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.32
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.32
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.32
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.3
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.29
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.28
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.28
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.28
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.28
3u4t_A272 TPR repeat-containing protein; structural genomics 99.27
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.25
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.22
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.2
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.19
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.19
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.18
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.17
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.17
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.16
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.15
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.12
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.12
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.11
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.09
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.07
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.07
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.03
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.98
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.97
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.96
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.94
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.93
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.93
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.88
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.86
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.78
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.75
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.73
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.73
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.72
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.68
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.68
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.68
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.67
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.65
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.64
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.64
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.63
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.62
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.59
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.58
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.57
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 98.55
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.53
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.52
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.52
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.51
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.49
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.47
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.47
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 98.42
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.4
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.39
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.39
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.39
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.37
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.37
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.36
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.36
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.35
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.32
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.29
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.29
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.28
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.26
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.25
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.21
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.14
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.14
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.14
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.14
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.13
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.13
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.11
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.1
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.1
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.09
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.08
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.08
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.07
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.06
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.06
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.06
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.06
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.05
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.04
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.04
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.02
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.01
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.0
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.0
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.0
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.97
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.95
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.95
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.93
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.92
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.9
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.9
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.89
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.88
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.87
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.85
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.85
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.83
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.83
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.76
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.75
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.72
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.72
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.71
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.7
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.7
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.69
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.69
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.66
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.66
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.65
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.61
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.61
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.58
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.58
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.56
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.55
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.54
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.53
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.5
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.47
3k9i_A117 BH0479 protein; putative protein binding protein, 97.46
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.44
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.43
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.43
3k9i_A117 BH0479 protein; putative protein binding protein, 97.42
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.27
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.19
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.16
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.07
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.0
3fau_A82 NEDD4-binding protein 2; SMR, small-MUTS related d 96.99
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.96
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 96.92
2d9i_A96 NEDD4-binding protein 2; SMR domain, N4BP2, BCL-3 96.89
2vkc_A135 NEDD4-binding protein 2; human BCL3 binding protei 96.84
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.81
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.62
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.62
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.54
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.41
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.34
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.29
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.24
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 95.89
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 95.77
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 95.68
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.45
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.14
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.98
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.98
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 94.79
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.67
3qd7_X137 Uncharacterized protein YDAL; alpha/beta/alpha fol 93.99
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.75
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 93.64
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.15
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 92.83
1pc2_A152 Mitochondria fission protein; unknown function; NM 92.23
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 91.32
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 89.86
1pc2_A152 Mitochondria fission protein; unknown function; NM 89.8
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 89.47
2zqe_A83 MUTS2 protein; alpha/beta, ATP-binding, DNA-bindin 89.26
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 88.97
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 88.58
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 88.48
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 87.72
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 86.51
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 86.23
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 86.13
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 86.0
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 85.67
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 84.39
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 84.01
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 83.24
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 82.71
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=1.3e-33  Score=329.09  Aligned_cols=367  Identities=6%  Similarity=-0.011  Sum_probs=307.9

Q ss_pred             cchHHHHHHHHHhcCChHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHH--HH-HHHHHhCCCCcCHHHHHHH
Q 003082          221 DILFCNFVREFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSR--AI-YEDLRSQNVTLNIYVFNSL  297 (850)
Q Consensus       221 ~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~--~~-~~~m~~~g~~pd~~t~~~l  297 (850)
                      ..+++.++.+|.+.|++++|+++|++|.+.++ .+...+..+...+...+..+.+.  .+ +..+...+..++..+|+.+
T Consensus       200 ~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p-~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~  278 (597)
T 2xpi_A          200 ASMCYLRGQVYTNLSNFDRAKECYKEALMVDA-KCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLK  278 (597)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCT-TCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCc-hhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHH
Confidence            47889999999999999999999999998643 35566777766554443332222  22 5555555555566667776


Q ss_pred             HHhhc--CChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHHhhhcCCcccCHhHHHHHHHHHHh
Q 003082          298 MNVNA--HDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFAD  375 (850)
Q Consensus       298 l~~~~--~~~~~a~~l~~~m~~~g~~pd~~t~~~Ll~~~~~~g~~~~A~~i~~~m~~~~~~g~~~~d~~ty~~li~~~~~  375 (850)
                      +..+.  |++++|.++|+++.+.  +++..+++.++.+|.+.|++++|.++|+++.+.     .+.+..+|+.++.+|.+
T Consensus       279 ~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~-----~~~~~~~~~~l~~~~~~  351 (597)
T 2xpi_A          279 LNKTSHEDELRRAEDYLSSINGL--EKSSDLLLCKADTLFVRSRFIDVLAITTKILEI-----DPYNLDVYPLHLASLHE  351 (597)
T ss_dssp             SCTTTTHHHHHHHHHHHHTSTTG--GGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH-----CTTCCTTHHHHHHHHHH
T ss_pred             HHHHcCcchHHHHHHHHHHhhcC--CchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHc-----CcccHHHHHHHHHHHHH
Confidence            76654  5899999999999875  589999999999999999999999999999873     23477889999999999


Q ss_pred             cCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHhCCHHHHHHH
Q 003082          376 AKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRL  455 (850)
Q Consensus       376 ~g~~~~A~~l~~~m~~~g~~p~~~ty~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~~~~~ll~~~~~~g~~~~A~~l  455 (850)
                      .|++++|..+++++.+.. ..+..+|+.++..|.+.|++++|.++|+++.+.. +.+..+|+.++.+|.+.|++++|.++
T Consensus       352 ~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~  429 (597)
T 2xpi_A          352 SGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMD-PQFGPAWIGFAHSFAIEGEHDQAISA  429 (597)
T ss_dssp             HTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHH
T ss_pred             hCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHH
Confidence            999999999999998654 3478999999999999999999999999998863 45678999999999999999999999


Q ss_pred             HHHHhhccccccccCccCCchhhhhhhhhhhcccccCCCCCcCCCcccccccccCCCcCHHHHHHHHHHHh--ccHHHHH
Q 003082          456 FRSWTLSKTQVALGEDYDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACC--TDYYRVK  533 (850)
Q Consensus       456 ~~~m~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~t~~~li~~~~--~~~~~a~  533 (850)
                      |+++....                                                +.+..+|+.++.+|.  ++.++|.
T Consensus       430 ~~~~~~~~------------------------------------------------~~~~~~~~~l~~~~~~~g~~~~A~  461 (597)
T 2xpi_A          430 YTTAARLF------------------------------------------------QGTHLPYLFLGMQHMQLGNILLAN  461 (597)
T ss_dssp             HHHHHHTT------------------------------------------------TTCSHHHHHHHHHHHHHTCHHHHH
T ss_pred             HHHHHHhC------------------------------------------------ccchHHHHHHHHHHHHcCCHHHHH
Confidence            99987542                                                357788999998887  5789999


Q ss_pred             HHHHHHHHcCCCCCHHHHHHHHHHHHcCCCHHHHHHHHHHHHHC----CCCCC--HHHHHHHHHHHHHcCCHHHHHHHHH
Q 003082          534 ALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQILKIMRED----GMSPD--VVAYTTAIKVCVRSKRLKQAFSLFE  607 (850)
Q Consensus       534 ~l~~~m~~~g~~p~~~ty~~li~~~~~~g~~~~A~~l~~~m~~~----g~~pd--~~ty~~li~~~~~~g~~~~A~~l~~  607 (850)
                      ++|+++.+... .+..+|+.++..|.+.|++++|.++|++|.+.    +..|+  ..+|+.++.+|.+.|++++|.++|+
T Consensus       462 ~~~~~~~~~~~-~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~  540 (597)
T 2xpi_A          462 EYLQSSYALFQ-YDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALN  540 (597)
T ss_dssp             HHHHHHHHHCC-CCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             HHHHHHHHhCC-CChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHH
Confidence            99999988633 37889999999999999999999999999875    77888  7899999999999999999999999


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHHc
Q 003082          608 EMKHYQIQPNLVTYITLLRARSRYGSLHEVQQCLAVYQDMWKA  650 (850)
Q Consensus       608 ~m~~~g~~p~~~t~~~li~a~~~~g~~~~a~~a~~l~~~M~~~  650 (850)
                      ++.+.+ ..+..+|..+..+|.+.|++++   |.+.|+++.+.
T Consensus       541 ~~~~~~-p~~~~~~~~l~~~~~~~g~~~~---A~~~~~~~l~~  579 (597)
T 2xpi_A          541 QGLLLS-TNDANVHTAIALVYLHKKIPGL---AITHLHESLAI  579 (597)
T ss_dssp             HHHHHS-SCCHHHHHHHHHHHHHTTCHHH---HHHHHHHHHHH
T ss_pred             HHHHhC-CCChHHHHHHHHHHHHhCCHHH---HHHHHHHHHhc
Confidence            998854 3489999999999999999888   66688888774



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3fau_A NEDD4-binding protein 2; SMR, small-MUTS related domain, nicking endonuclease, alternative splicing, ATP-binding, coiled coil, cytoplasm, hydrolase; 1.90A {Homo sapiens} SCOP: d.68.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2d9i_A NEDD4-binding protein 2; SMR domain, N4BP2, BCL-3 binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.68.8.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qd7_X Uncharacterized protein YDAL; alpha/beta/alpha fold, endonuclease, hydrolase; 2.30A {Escherichia coli} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2zqe_A MUTS2 protein; alpha/beta, ATP-binding, DNA-binding, nucleotide-binding, DN protein; 1.70A {Thermus thermophilus} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query850
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.85
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.82
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.42
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.33
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.08
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.02
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.97
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.88
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.82
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.71
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.69
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.65
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.61
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.48
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.42
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.31
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.17
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.16
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.06
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.05
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.97
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.92
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.89
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.86
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.85
d2d9ia183 Nedd4-binding protein 2 {Human (Homo sapiens) [Tax 97.82
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.81
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.81
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.8
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.72
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.68
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.6
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.52
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.49
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.48
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.42
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.41
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.39
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.31
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.26
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.26
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.22
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.18
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.08
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.03
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.97
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.97
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.92
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.83
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.75
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.58
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 95.99
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.97
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.78
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 93.34
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 92.68
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 85.18
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.85  E-value=1.5e-17  Score=178.29  Aligned_cols=376  Identities=14%  Similarity=0.095  Sum_probs=233.6

Q ss_pred             HHhhhhcCcHHHHHHHHHHHHhCCCCCCCcccHHHHHHHHHcCCChHHHHHHhhhC----CCCcchHHHHHHHHHhcCCh
Q 003082          162 CQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIV----PRADILFCNFVREFGKKRDL  237 (850)
Q Consensus       162 ~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~----p~~~~~~~~li~~~~~~g~~  237 (850)
                      +..+.+.|++++|++.++++++..  |++...+..++..+.+.|++++|+.+++.+    |....++..++..|.+.|++
T Consensus         6 a~~~~~~G~~~~A~~~~~~~l~~~--p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~   83 (388)
T d1w3ba_           6 AHREYQAGDFEAAERHCMQLWRQE--PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQL   83 (388)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHHC--TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCH
T ss_pred             HHHHHHcCCHHHHHHHHHHHHHhC--CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhccc
Confidence            344556799999999999988765  777667777777777777777777766553    55666677777777777777


Q ss_pred             HHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCcCHHHHHHHHH-hhcCChHHHHHHHHHHH
Q 003082          238 VSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMN-VNAHDLKFTLEVYKNMQ  316 (850)
Q Consensus       238 ~~A~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~pd~~t~~~ll~-~~~~~~~~a~~l~~~m~  316 (850)
                      ++|+..|....+... .+...+..........+....+........................ ...+....+...+....
T Consensus        84 ~~A~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  162 (388)
T d1w3ba_          84 QEAIEHYRHALRLKP-DFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAI  162 (388)
T ss_dssp             HHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHH
T ss_pred             ccccccccccccccc-ccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhh
Confidence            777777777666432 2333344444444444444444444444443322222222222222 23345555555555554


Q ss_pred             HcCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHHhhhcCCcccCHhHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCC
Q 003082          317 KLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTP  396 (850)
Q Consensus       317 ~~g~~pd~~t~~~Ll~~~~~~g~~~~A~~i~~~m~~~~~~g~~~~d~~ty~~li~~~~~~g~~~~A~~l~~~m~~~g~~p  396 (850)
                      ... +-+...+..+...+...|++++|...++...+.     -+-+...|..+...+...|++++|...++.....+.. 
T Consensus       163 ~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~-----~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~-  235 (388)
T d1w3ba_         163 ETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL-----DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPN-  235 (388)
T ss_dssp             HHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHH-----CTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTT-
T ss_pred             ccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHh-----CcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhh-
Confidence            432 234555666666666666777776666666552     1223445666666666666777776666666654432 


Q ss_pred             CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHhCCHHHHHHHHHHHhhccccccccCccCCch
Q 003082          397 NTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDYDGNT  476 (850)
Q Consensus       397 ~~~ty~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~~~~~ll~~~~~~g~~~~A~~l~~~m~~~~~~~~~~~~~~~~~  476 (850)
                      +...+..+...+.+.|++++|...|++..+.. +-+..++..+...|.+.|++++|.+.++...                
T Consensus       236 ~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~----------------  298 (388)
T d1w3ba_         236 HAVVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTAL----------------  298 (388)
T ss_dssp             CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHH----------------
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhh----------------
Confidence            45556666666666666666666666666542 2344556666666666666666666665433                


Q ss_pred             hhhhhhhhhhcccccCCCCCcCCCcccccccccCCCcCHHHHHHHHHHHhccHHHHHHHHHHHHHcCCCCCHHHHHHHHH
Q 003082          477 DRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILID  556 (850)
Q Consensus       477 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~t~~~li~~~~~~~~~a~~l~~~m~~~g~~p~~~ty~~li~  556 (850)
                                                                                      .. .+.+...+..+..
T Consensus       299 ----------------------------------------------------------------~~-~~~~~~~~~~l~~  313 (388)
T d1w3ba_         299 ----------------------------------------------------------------RL-CPTHADSLNNLAN  313 (388)
T ss_dssp             ----------------------------------------------------------------HH-CTTCHHHHHHHHH
T ss_pred             ----------------------------------------------------------------cc-CCccchhhhHHHH
Confidence                                                                            21 2235567777778


Q ss_pred             HHHcCCCHHHHHHHHHHHHHCCCCC-CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCC-HHHHHHHHHHHHhcCC
Q 003082          557 ACGGSGNVEGALQILKIMREDGMSP-DVVAYTTAIKVCVRSKRLKQAFSLFEEMKHYQIQPN-LVTYITLLRARSRYGS  633 (850)
Q Consensus       557 ~~~~~g~~~~A~~l~~~m~~~g~~p-d~~ty~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~-~~t~~~li~a~~~~g~  633 (850)
                      .|.+.|++++|...|++..+.  .| +..+|..+..+|.+.|++++|.+.|++..+  +.|+ ...|..+..++.+.|+
T Consensus       314 ~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~--l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         314 IKREQGNIEEAVRLYRKALEV--FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIR--ISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHTTTCHHHHHHHHHHHTTS--CTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHT--TCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcCC
Confidence            888888888888888887764  34 466778888888888888888888888875  4564 6667777776666553



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2d9ia1 d.68.8.1 (A:8-90) Nedd4-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure