Citrus Sinensis ID: 003115

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840------

MATSAACVRISSFHYNNNNFSKLCFFRTLDNSSSMLERLLCSSSLHHFLSHKTKLSSLPRNYLYPFRRPLAVISHRPIHPYKVVAMAERTPASTSHSRNKHTNRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSASASSNKLPDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARNNFSADKVVALVCQNFSCSPPVTDPISLENLLLEKPSSTA

cccccEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHHccccccccccccHHHHHHHHHccccEEEEEccccccHHHHHHHHccccHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHcccccccEEEEccccccEEEEcccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccccccEEEcccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHcccHHHHHHHcccccccccccccccccccccccccEEEcccccHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHccccccccccccccccccEEEEccccccccccccHHHHHHHHHccccccc

ccccEEEEEEEEEEEccccccEEEEEEcccccHHHHHHHHHcHHHHccccccccccccccccccccccccEEccccccccccEEEccccccccccccccccccHHcccccHHHHHHcccccccccccHHHHHHHHHccccEEEEEccccccHHHHEcccccccHHHHHHHHHccEEEEEcccccccHHHHHHHHHHHHcccccccEEEEEccccccEEEEcccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccHHccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccEEEccccccccccccccccccEEEEEcHHHHHHHHccHHHHHHHHccccccccEccccccccccccccccEcEccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccEEEcccccccEEEEccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHccccHHHHccccccccEEEEEEEccccccccccHHHHHHHHHccccccc

MATSAACVRISsfhynnnnfskLCFFRTLDNSSSMLERLLCSSSlhhflshktklsslprnylypfrrplavishrpihpykvvamaertpastshsrnkhtnrlaaehspyllqhahnpvdwfawGEEAFAEArkrdvpiflsigystchwchvmevesfEDEGVAKLLNDWFVSIkvdreerpdvdkVYMTYVQALyggggwplsvflspdlkplmggtyfppedkygrpgfKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSasassnklpdelpQNALRLCAEQLSKSydsrfggfgsapkfprpvEIQMMLYHSKkledtgksgeasegQKMVLFTLQCMakggihdhvgggfhrysvderwhvphfekmlYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRrdmigpggeifsaedadsaetegatrkkegaFYVWTSKEVEDILGEHAILFKEhyylkptgncdlsrmsdphnefkgknVLIELndssasasklgmPLEKYLNILGECRRKLfdvrskrprphlddkvivSWNGLVISSFARASKILKSEAesamfnfpvvgsdrkEYMEVAESAASFIRRHLYDEQTHRLqhsfrngpskapgfldDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDelfldregggyfnttgedpsvllrvkedhdgaepsgnsvSVINLVRLASIvagsksdyyrqNAEHSLAVFETRLKDMAMAVPLMCCAAdmlsvpsrkHVVLVGHKSSVDFENMLAAAHAsydlnktvihidpadteemdfweehnsnnasmarnnfSADKVVALVCQnfscsppvtdpislenlllekpssta

MATSAACVRISSfhynnnnfsKLCFFRTLDNSSSMLERLLCSSSLHHFLSHKTKLSSLPRNYLYPFRRPLAVISHRPIHPYKVVAMAErtpastshsrnKHTNRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSikvdreerpdvdkVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGtyfppedkygrpgFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSASASSNKLPDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGeifsaedadsaetegatrkkegafyvWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLfdvrskrprphlddkvivswNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDgaepsgnsvsvinLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARNNFSADKVVALVCQNFScsppvtdpislenlllekpssta

MATSAACVRISSFHYNNNNFSKLCFFRTLDNSSSMLERllcssslhhflshktklsslPRNYLYPFRRPLAVISHRPIHPYKVVAMAERTPASTSHSRNKHTNRLAAEHSPYLLQHAHNPVDwfawgeeafaeaRKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQlsealsasassNKLPDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARNNFSADKVVALVCQNFSCSPPVTDPISLENLLLEKPSSTA

*****ACVRISSFHYNNNNFSKLCFFRTLDNSSSMLERLLCSSSLHHFLSHKTKLSSLPRNYLYPFRRPLAVISHRPIHPYKVVAM************************PYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLA***AF********************************************************IQMML********************MVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIF******************GAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDL**************VLI************GMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRL**********APGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTG****VLL***************VSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPADTEEMDFW*************NFSADKVVALVCQNFSCSPPVTDPI**************

*****AC*RISSFHYNNNNFSKLCFFRTLDNSSSMLERLLCSSSLHHFLSHKTK*******************************************************SPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLA**GAFA***********************NALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARNNFSADKVVALVCQNFSCSPPVTDPISLEN**********

MATSAACVRISSFHYNNNNFSKLCFFRTLDNSSSMLERLLCSSSLHHFLSHKTKLSSLPRNYLYPFRRPLAVISHRPIHPYKVVAMA***************NRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEA**********PDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKL**********EGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSA************RKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARNNFSADKVVALVCQNFSCSPPVTDPISLENLLLEKPSSTA

***SAACVRISSFHYNNNNFSKLCFFRTLDNSSSMLERLLCSSSLHHFLSHKTKLSSLPRNYLYPFRRPLAVISHRPIHPYKVVAM***************TNRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSASAS****PDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARNNFSADKVVALVCQNFSCSPPVTDPISLENLLLE******

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		846	2.2.26 [Sep-21-2011]
Q8TB22		786	Spermatogenesis-associate	yes	no	0.835	0.899	0.431	1e-172
Q80YT5		790	Spermatogenesis-associate	yes	no	0.826	0.884	0.422	1e-165
Q6T393		789	Spermatogenesis-associate	yes	no	0.829	0.889	0.414	1e-164
Q09214		729	Uncharacterized protein B	yes	no	0.833	0.967	0.384	1e-142
P37512		689	Uncharacterized protein Y	yes	no	0.787	0.966	0.373	1e-132
P37509		79	Uncharacterized protein Y	no	no	0.059	0.632	0.745	3e-16

>sp\|Q8TB22\|SPT20_HUMAN Spermatogenesis-associated protein 20 OS=Homo sapiens GN=SPATA20 PE=2 SV=3	Back alignment and function desciption

 Score =  605 bits (1561), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 333/772 (43%), Positives = 460/772 (59%), Gaps = 65/772 (8%)

Query: 91  PASTSHSRNKHTNRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTC 150
           P+ST     +  NRL  E SPYLLQHA+NPVDW+ WG+EAF +ARK + PIFLS+GYSTC
Sbjct: 54  PSSTPQ---RVPNRLIHEKSPYLLQHAYNPVDWYPWGQEAFDKARKENKPIFLSVGYSTC 110

Query: 151 HWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFL 210
           HWCH+ME ESF++E + +LL++ FVS+KVDREERPDVDKVYMT+VQA   GGGWP++V+L
Sbjct: 111 HWCHMMEEESFQNEEIGRLLSEDFVSVKVDREERPDVDKVYMTFVQATSSGGGWPMNVWL 170

Query: 211 SPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSAS 270
           +P+L+P +GGTYFPPED   R GF+T+L ++++ W + ++ L ++     ++++ AL A 
Sbjct: 171 TPNLQPFVGGTYFPPEDGLTRVGFRTVLLRIREQWKQNKNTLLENS----QRVTTALLAR 226

Query: 271 ASSNKLPDELPQNALRL---CAEQLSKSYDSRFGGFGSAPKFPRPVEIQMML--YHSKKL 325
           +  +    +LP +A  +   C +QL + YD  +GGF  APKFP PV +  +   + S +L
Sbjct: 227 SEISVGDRQLPPSAATVNNRCFQQLDEGYDEEYGGFAEAPKFPTPVILSFLFSYWLSHRL 286

Query: 326 EDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQL 385
              G     S  Q+M L TL+ MA GGI DHVG GFHRYS D +WHVPHFEKMLYDQ QL
Sbjct: 287 TQDG-----SRAQQMALHTLKMMANGGIRDHVGQGFHRYSTDRQWHVPHFEKMLYDQAQL 341

Query: 386 ANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAF 445
           A  Y  AF L+ D FYS + + IL Y+ R +    G  +SAEDADS    G  R KEGA+
Sbjct: 342 AVAYSQAFQLSGDEFYSDVAKGILQYVARSLSHRSGGFYSAEDADSPPERG-QRPKEGAY 400

Query: 446 YVWTSKEVEDILGEHAI----------LFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLI 495
           YVWT KEV+ +L E  +          L  +HY L   GN  +S   DP  E +G+NVL 
Sbjct: 401 YVWTVKEVQQLLPEPVLGATEPLTSGQLLMKHYGLTEAGN--ISPSQDPKGELQGQNVLT 458

Query: 496 ELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFAR 555
                  +A++ G+ +E    +L     KLF  R  RP+PHLD K++ +WNGL++S +A 
Sbjct: 459 VRYSLELTAARFGLDVEAVRTLLNSGLEKLFQARKHRPKPHLDSKMLAAWNGLMVSGYAV 518

Query: 556 ASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGP--- 612
              +L              G DR   +  A + A F++RH++D  + RL  +   GP   
Sbjct: 519 TGAVL--------------GQDR--LINYATNGAKFLKRHMFDVASGRLMRTCYTGPGGT 562

Query: 613 ---SKAP--GFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNT 667
              S  P  GFL+DYAF++ GLLDLYE    + WL WA+ LQ+TQD+LF D +GGGYF +
Sbjct: 563 VEHSNPPCWGFLEDYAFVVRGLLDLYEASQESAWLEWALRLQDTQDKLFWDSQGGGYFCS 622

Query: 668 TGEDPSVL-LRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETR 726
             E  + L LR+K+D DGAEPS NSVS  NL+RL     G K   +       L  F  R
Sbjct: 623 EAELGAGLPLRLKDDQDGAEPSANSVSAHNLLRLHGFT-GHKD--WMDKCVCLLTAFSER 679

Query: 727 LKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPA 786
           ++ + +A+P M  A       + K +V+ G + + D + ++   H+ Y  NK +I    A
Sbjct: 680 MRRVPVALPEMVRALSA-QQQTLKQIVICGDRQAKDTKALVQCVHSVYIPNKVLIL---A 735

Query: 787 DTEEMDFWEEHNSNNASMARNNFSADKVVALVCQNFSCSPPVTDPISLENLL 838
           D +   F        +++ R     D+  A VC+N +CS P+TDP  L  LL
Sbjct: 736 DGDPSSFLSRQLPFLSTLRRLE---DQATAYVCENQACSVPITDPCELRKLL 784

May play a role in fertility regulation.
Homo sapiens (taxid: 9606)

>sp\|Q80YT5\|SPT20_MOUSE Spermatogenesis-associated protein 20 OS=Mus musculus GN=Spata20 PE=2 SV=1	Back alignment and function description

>sp\|Q6T393\|SPT20_RAT Spermatogenesis-associated protein 20 OS=Rattus norvegicus GN=Spata20 PE=1 SV=1	Back alignment and function description

>sp\|Q09214\|YP65_CAEEL Uncharacterized protein B0495.5 OS=Caenorhabditis elegans GN=B0495.5 PE=4 SV=2	Back alignment and function description

>sp\|P37512\|YYAL_BACSU Uncharacterized protein YyaL OS=Bacillus subtilis (strain 168) GN=yyaL PE=4 SV=1	Back alignment and function description

>sp\|P37509\|YYAO_BACSU Uncharacterized protein YyaO OS=Bacillus subtilis (strain 168) GN=yyaO PE=4 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		846
359479833		819	PREDICTED: spermatogenesis-associated pr	0.918	0.948	0.822	0.0
296086616		754	unnamed protein product [Vitis vinifera]	0.888	0.997	0.835	0.0
255559290		874	conserved hypothetical protein [Ricinus	0.897	0.868	0.830	0.0
449436537		855	PREDICTED: spermatogenesis-associated pr	0.960	0.950	0.759	0.0
449498445		855	PREDICTED: LOW QUALITY PROTEIN: spermato	0.960	0.950	0.754	0.0
356570951		755	PREDICTED: spermatogenesis-associated pr	0.877	0.982	0.800	0.0
115432144		839	cold-induced thioredoxin domain-containi	0.903	0.910	0.801	0.0
356505532		809	PREDICTED: spermatogenesis-associated pr	0.932	0.975	0.774	0.0
357511183		809	Spermatogenesis-associated protein [Medi	0.933	0.976	0.757	0.0
224132400		756	predicted protein [Populus trichocarpa]	0.860	0.962	0.835	0.0

>gi\|359479833\|ref\|XP_002267103.2\| PREDICTED: spermatogenesis-associated protein 20-like [Vitis vinifera]	Back alignment and taxonomy information

 Score = 1345 bits (3481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 640/778 (82%), Positives = 700/778 (89%), Gaps = 1/778 (0%)

Query: 68  RPLAVISHRPIHPYKVVAMAERTPASTSHSRNKHTNRLAAEHSPYLLQHAHNPVDWFAWG 127
           R L +   R +H  KV+AMAER+  + SHS +K+TNRLAAEHSPYLLQHAHNPVDW+ WG
Sbjct: 43  RTLPLFPRRHVHTLKVLAMAERSMKTASHS-HKYTNRLAAEHSPYLLQHAHNPVDWYPWG 101

Query: 128 EEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDV 187
           EEAF+E+RKRDVPIFLSIGYSTCHWCHVMEVESFE+EGVAKLLNDWFVSIKVDREERPDV
Sbjct: 102 EEAFSESRKRDVPIFLSIGYSTCHWCHVMEVESFENEGVAKLLNDWFVSIKVDREERPDV 161

Query: 188 DKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDK 247
           DKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPP+DKYGRPGFKT+LRKVKDAW+ 
Sbjct: 162 DKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPDDKYGRPGFKTVLRKVKDAWEN 221

Query: 248 KRDMLAQSGAFAIEQLSEALSASASSNKLPDELPQNALRLCAEQLSKSYDSRFGGFGSAP 307
           KRD+L +SGAFAIEQLSEALSA+ASSNKL D +PQ AL LCAEQL+ +YD  +GGFGSAP
Sbjct: 222 KRDVLVKSGAFAIEQLSEALSATASSNKLADGIPQQALHLCAEQLAGNYDPEYGGFGSAP 281

Query: 308 KFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVD 367
           KFPRPVEIQ+MLYH KKLE++GKSGEA+E  KMV F+LQCMA+GG+HDH+GGGFHRYSVD
Sbjct: 282 KFPRPVEIQLMLYHYKKLEESGKSGEANEVLKMVAFSLQCMARGGVHDHIGGGFHRYSVD 341

Query: 368 ERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAE 427
           E WHVPHFEKMLYDQGQLAN YLD FS+TKDVFYS + RDILDYLRRDMIGP GEIFSAE
Sbjct: 342 ECWHVPHFEKMLYDQGQLANAYLDVFSITKDVFYSCVSRDILDYLRRDMIGPEGEIFSAE 401

Query: 428 DADSAETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNE 487
           DADSAE+E A RKKEGAFY+WTSKEVED++GEHA LFK+HYY+KP+GNCDLSRMSDPHNE
Sbjct: 402 DADSAESEDAARKKEGAFYIWTSKEVEDVIGEHASLFKDHYYIKPSGNCDLSRMSDPHNE 461

Query: 488 FKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNG 547
           FKGKNVLIE N +SA ASKLGMP+EKYL+ILG CRRKLFDVR  RPRPHLDDKVIVSWNG
Sbjct: 462 FKGKNVLIERNCASAMASKLGMPVEKYLDILGTCRRKLFDVRLNRPRPHLDDKVIVSWNG 521

Query: 548 LVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHS 607
           L ISSFARASKILKSEAE   F FPVVG D KEYMEVAE AASFIR+ LYDEQT RL+HS
Sbjct: 522 LAISSFARASKILKSEAEGTKFRFPVVGCDPKEYMEVAEKAASFIRKWLYDEQTRRLRHS 581

Query: 608 FRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNT 667
           FRNGPSKAPGFLDDYAFLISGLLD+YEFG  T WLVWAIELQ+TQDELFLD+EGGGYFNT
Sbjct: 582 FRNGPSKAPGFLDDYAFLISGLLDIYEFGGNTNWLVWAIELQDTQDELFLDKEGGGYFNT 641

Query: 668 TGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETRL 727
            GEDPSVLLRVKEDHDGAEPSGNSVSVINLVRL S+VAGS  + +R+NAEH LAVFETRL
Sbjct: 642 PGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLTSMVAGSWFERHRRNAEHLLAVFETRL 701

Query: 728 KDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPAD 787
           KDMAMAVPLMCC ADM SVPSRK VVLVGHKSSV+FE+MLAAAHA YD N+TVIHIDP +
Sbjct: 702 KDMAMAVPLMCCGADMFSVPSRKQVVLVGHKSSVEFEDMLAAAHAQYDPNRTVIHIDPTE 761

Query: 788 TEEMDFWEEHNSNNASMARNNFSADKVVALVCQNFSCSPPVTDPISLENLLLEKPSST 845
           TE+M+FWE  NSN A MA+NNF+ DKVVALVCQNF+CS PVTD  SL+ LL  KPSS 
Sbjct: 762 TEQMEFWEAMNSNIALMAKNNFAPDKVVALVCQNFTCSSPVTDSTSLKALLCLKPSSA 819

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|296086616\|emb\|CBI32251.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255559290\|ref\|XP_002520665.1\| conserved hypothetical protein [Ricinus communis] gi\|223540050\|gb\|EEF41627.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|449436537\|ref\|XP_004136049.1\| PREDICTED: spermatogenesis-associated protein 20-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449498445\|ref\|XP_004160539.1\| PREDICTED: LOW QUALITY PROTEIN: spermatogenesis-associated protein 20-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356570951\|ref\|XP_003553646.1\| PREDICTED: spermatogenesis-associated protein 20-like [Glycine max]	Back alignment and taxonomy information

>gi\|115432144\|gb\|ABI97349.1\| cold-induced thioredoxin domain-containing protein [Ammopiptanthus mongolicus]	Back alignment and taxonomy information

>gi\|356505532\|ref\|XP_003521544.1\| PREDICTED: spermatogenesis-associated protein 20-like [Glycine max]	Back alignment and taxonomy information

>gi\|357511183\|ref\|XP_003625880.1\| Spermatogenesis-associated protein [Medicago truncatula] gi\|355500895\|gb\|AES82098.1\| Spermatogenesis-associated protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|224132400\|ref\|XP_002321330.1\| predicted protein [Populus trichocarpa] gi\|222862103\|gb\|EEE99645.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		846
TAIR\|locus:2125541		818	AT4G03200 [Arabidopsis thalian	0.913	0.944	0.728	2.8e-311
ZFIN\|ZDB-GENE-030131-7269		818	spata20 "spermatogenesis assoc	0.838	0.866	0.433	8e-156
UNIPROTKB\|Q8TB22		786	SPATA20 "Spermatogenesis-assoc	0.839	0.903	0.420	1.1e-149
UNIPROTKB\|F1NIQ1		685	SPATA20 "Uncharacterized prote	0.786	0.970	0.448	2.3e-149
UNIPROTKB\|A4FV36		789	SPATA20 "Uncharacterized prote	0.862	0.925	0.419	7.9e-149
UNIPROTKB\|F1RT97		789	LOC100738512 "Uncharacterized	0.862	0.925	0.417	1.6e-148
UNIPROTKB\|E2QU41		789	SPATA20 "Uncharacterized prote	0.854	0.916	0.408	7.1e-148
UNIPROTKB\|F1PTK3		789	MYCBPAP "Uncharacterized prote	0.854	0.916	0.408	7.1e-148
UNIPROTKB\|F6UYN9		821	MYCBPAP "Uncharacterized prote	0.854	0.880	0.408	7.1e-148
UNIPROTKB\|I3LGI2		773	LOC100738512 "Uncharacterized	0.829	0.908	0.420	1.2e-145

TAIR\|locus:2125541 AT4G03200 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2986 (1056.2 bits), Expect = 2.8e-311, P = 2.8e-311
 Identities = 564/774 (72%), Positives = 642/774 (82%)

Query:    66 FRRPLAVISHRPIHPYKVVAMAERTPAS-TSHSRNKHTNRLAAEHSPYLLQHAHNPVDXX 124
             F  P   I  RPI   KV+AMAE + +S TS +  KHTNRLAAEHSPYLLQHAHNPVD  
Sbjct:    43 FSSPFPPILSRPISSGKVLAMAEESSSSSTSSTSQKHTNRLAAEHSPYLLQHAHNPVDWY 102

Query:   125 XXXXXXXXXXRKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREER 184
                       RKRDVPIFLSIGYSTCHWCHVMEVESFEDE VAKLLN+ FVSIKVDREER
Sbjct:   103 PWGEEAFEEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEEVAKLLNNSFVSIKVDREER 162

Query:   185 PDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDA 244
             PDVDKVYM++VQALYGGGGWPLSVFLSPDLKPLMGGTYFPP D YGRPGFKT+L+KVKDA
Sbjct:   163 PDVDKVYMSFVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPNDNYGRPGFKTLLKKVKDA 222

Query:   245 WDKKRDMLAQSGAFAIEQXXXXXXXXXXXNKLPDELPQNALRLCAEQLSKSYDSRFGGFG 304
             W+ KRD L +SG +AIE+           +KL D + + A+  CA+QLS+SYDS FGGFG
Sbjct:   223 WNSKRDTLVKSGTYAIEELSKALSASTGADKLSDGISREAVSTCAKQLSRSYDSEFGGFG 282

Query:   305 SAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRY 364
             SAPKFPRPVEIQ+MLYH KKL+++GK+ EA E + MVLF+LQ MA GG+HDH+GGGFHRY
Sbjct:   283 SAPKFPRPVEIQLMLYHYKKLKESGKTSEADEEKSMVLFSLQGMANGGMHDHIGGGFHRY 342

Query:   365 SVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIF 424
             SVDE WHVPHFEKMLYDQGQLANVYLD FS+TKDV YSY+ RDILDYLRRDMI P G IF
Sbjct:   343 SVDECWHVPHFEKMLYDQGQLANVYLDGFSITKDVMYSYVARDILDYLRRDMIAPEGGIF 402

Query:   425 SAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDP 484
             SAEDADS E EGA RKKEGAFY+WTS E++++LGE+A LFKEHYY+K +GNCDLS  SDP
Sbjct:   403 SAEDADSFEFEGAKRKKEGAFYIWTSDEIDEVLGENADLFKEHYYVKKSGNCDLSSRSDP 462

Query:   485 HNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVS 544
             HNEF GKNVLIE N++SA ASK  + +EKY  ILGECRRKLFDVR KRP+PHLDDK+IVS
Sbjct:   463 HNEFAGKNVLIERNETSAMASKFSLSVEKYQEILGECRRKLFDVRLKRPKPHLDDKIIVS 522

Query:   545 WNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRL 604
             WNGLVISSFARASKILK+E ES  + FPVV S  ++Y+EVAE AA FIR +LYDEQ+ RL
Sbjct:   523 WNGLVISSFARASKILKAEPESTKYYFPVVNSQPEDYIEVAEKAALFIRGNLYDEQSRRL 582

Query:   605 QHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGY 664
             QHS+R GPSKAP FLDDYAFLISGLLDLYE G G +WL WAI+LQ TQDEL+LDREGG Y
Sbjct:   583 QHSYRQGPSKAPAFLDDYAFLISGLLDLYENGGGIEWLKWAIKLQETQDELYLDREGGAY 642

Query:   665 FNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLAVFE 724
             FNT G+DPSVLLRVKEDHDGAEPSGNSVS INLVRLASIVAG K++ Y   A   LAVFE
Sbjct:   643 FNTEGQDPSVLLRVKEDHDGAEPSGNSVSAINLVRLASIVAGEKAESYLNTAHRLLAVFE 702

Query:   725 TRLKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHID 784
              RL+++A+AVPLMCC+ADM+SVPSRK VVLVG KSS +  NML+AAH+ YD NKTVIHID
Sbjct:   703 LRLRELAVAVPLMCCSADMISVPSRKQVVLVGSKSSPELTNMLSAAHSVYDPNKTVIHID 762

Query:   785 PADTEEMDFWEEHNSNNASMARNNFSADKVVALVCQNFSCSPPVTDPISLENLL 838
             P+ ++E++FWEEHNSN A MA+ N +++KVVALVCQ+F+CSPPV D  SL  LL
Sbjct:   763 PSSSDEIEFWEEHNSNVAEMAKKNRNSEKVVALVCQHFTCSPPVFDSSSLTRLL 816

GO:0003824 "catalytic activity" evidence=IEA

GO:0005576 "extracellular region" evidence=ISM

GO:0009507 "chloroplast" evidence=IDA

ZFIN\|ZDB-GENE-030131-7269 spata20 "spermatogenesis associated 20" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8TB22 SPATA20 "Spermatogenesis-associated protein 20" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NIQ1 SPATA20 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|A4FV36 SPATA20 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RT97 LOC100738512 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QU41 SPATA20 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PTK3 MYCBPAP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F6UYN9 MYCBPAP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LGI2 LOC100738512 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q6T393	SPT20_RAT	No assigned EC number	0.4149	0.8297	0.8897	yes	no
Q80YT5	SPT20_MOUSE	No assigned EC number	0.4222	0.8262	0.8848	yes	no
Q09214	YP65_CAEEL	No assigned EC number	0.3840	0.8333	0.9670	yes	no
Q8TB22	SPT20_HUMAN	No assigned EC number	0.4313	0.8356	0.8994	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00023575001	SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (745 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00020486001	SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (564 aa)	•		0.539
	GSVIVG00019071001	SubName- Full=Chromosome chr15 scaffold_19, whole genome shotgun sequence; (636 aa)	•		0.508
	GSVIVG00015131001	SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (189 aa)	•		0.451
	GSVIVG00010970001	RecName- Full=Aminomethyltransferase; EC=2.1.2.10;; The glycine cleavage system catalyzes the d [...] (408 aa)	•		0.442
	GSVIVG00036740001	SubName- Full=Chromosome chr4 scaffold_83, whole genome shotgun sequence; (456 aa)	•	•	0.441
	GSVIVG00030474001	SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (329 aa)	•		0.427

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		846
COG1331		667	COG1331, COG1331, Highly conserved protein contain	0.0
pfam03190		163	pfam03190, DUF255, Protein of unknown function, DU	1e-107
cd02955		124	cd02955, SSP411, TRX domain, SSP411 protein family	8e-82
pfam13899		81	pfam13899, Thioredoxin_7, Thioredoxin-like	5e-09
cd02953		104	cd02953, DsbDgamma, DsbD gamma family; DsbD gamma	1e-05
pfam13098		105	pfam13098, Thioredoxin_2, Thioredoxin-like domain	2e-05

>gnl\|CDD\|224250 COG1331, COG1331, Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

 Score =  695 bits (1795), Expect = 0.0
 Identities = 302/740 (40%), Positives = 399/740 (53%), Gaps = 80/740 (10%)

Query: 102 TNRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESF 161
            NRL  E SPYLLQHAHNPVDW+ WGEEAFA+A++ D PI LSIGYSTCHWCHVM  ESF
Sbjct: 7   PNRLINEKSPYLLQHAHNPVDWYPWGEEAFAKAKEEDKPILLSIGYSTCHWCHVMAHESF 66

Query: 162 EDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGT 221
           ED  +A +LN+ FV +KVDREERPDVD +YM   QA+ G GGWPL+VFL+PD KP   GT
Sbjct: 67  EDPEIAAILNENFVPVKVDREERPDVDSLYMNASQAITGQGGWPLTVFLTPDGKPFFAGT 126

Query: 222 YFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSASASSNKLPDELP 281
           YFP ED+YGRPGFK +L  +++ W + R+ L QS     E++ EAL   A  +   +EL 
Sbjct: 127 YFPKEDRYGRPGFKQLLEAIRETWREDREELLQSA----ERVLEALEGLARPSA-GEELD 181

Query: 282 QNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMV 341
           +  L   AE L++S+D  +GGFGSAPKFP P  +  +L +S +  D            MV
Sbjct: 182 EEVLDRAAEALARSFDREYGGFGSAPKFPPPHLLLFLLRYSLRTGD-------ERALDMV 234

Query: 342 LFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFY 401
           L TL  MA+GGI+DH+GGGF RYS D  W VPHFEKMLYD   L   Y +A+  T D  Y
Sbjct: 235 LRTLDAMARGGIYDHLGGGFFRYSTDREWLVPHFEKMLYDNALLLRAYAEAYRATGDDLY 294

Query: 402 SYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHA 461
                 ILDYL R++  P G  +S+ DADS + E      EG +Y W+ +E++++LGE A
Sbjct: 295 RRAAEGILDYLLRELYSPEGGFYSSLDADS-DGE------EGKYYTWSVEELKEVLGEDA 347

Query: 462 ILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGEC 521
            L  +++ +   GN            F+G+NVL        +  +    LE         
Sbjct: 348 ELACKYFDVSEEGN------------FEGRNVLHVPGPLEEAIEEAEEKLE-------RA 388

Query: 522 RRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEY 581
           R KL   R KR +P  DDKV+  WNGL+I++ A A ++L                   EY
Sbjct: 389 REKLLAAREKRKQPSRDDKVLTDWNGLMIAALAEAGRVL----------------GDPEY 432

Query: 582 MEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKW 641
           +E AE AA FI  +LY     RL   +R G +   G L+DYAFLI GLL LYE      +
Sbjct: 433 LEAAERAADFILDNLYV---DRLLRRYRGGEAAVAGLLEDYAFLILGLLALYEATGDLAY 489

Query: 642 LVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLA 701
           L  AIEL +     F D + GG+++T  +   +L+R KE  DGA PSGN+V+   L+RL+
Sbjct: 490 LEKAIELADEAIADFWD-DEGGFYDTPSDSEDLLIRPKEPTDGATPSGNAVAAQALLRLS 548

Query: 702 SIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSV 761
            +   ++   Y + AE  L  F    +    A   +  AA+ L +     +V+ G   S 
Sbjct: 549 LLTGDAR---YLEAAEDILQAFAGLAERAPFAHAGLLLAAEFL-ISGPLVIVVAGDPRS- 603

Query: 762 DFENMLAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARNNFSADKVVALVCQN 821
               +L AA   Y   K ++             E + S                A VC  
Sbjct: 604 ---ELLRAALRLYLPEKVLVVGT----------EGYVSLLVDGMLGGGKT----AYVCTG 646

Query: 822 FSCSPPVTDPISLENLLLEK 841
            +C PPVT P  L  LL   
Sbjct: 647 DACLPPVTSPEELAELLAVL 666

Length = 667

>gnl\|CDD\|202571 pfam03190, DUF255, Protein of unknown function, DUF255	Back alignment and domain information

>gnl\|CDD\|239253 cd02955, SSP411, TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif	Back alignment and domain information

>gnl\|CDD\|222442 pfam13899, Thioredoxin_7, Thioredoxin-like	Back alignment and domain information

>gnl\|CDD\|239251 cd02953, DsbDgamma, DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD	Back alignment and domain information

>gnl\|CDD\|221921 pfam13098, Thioredoxin_2, Thioredoxin-like domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		846
COG1331		667	Highly conserved protein containing a thioredoxin	100.0
KOG2244		786	consensus Highly conserved protein containing a th	100.0
PF03190		163	Thioredox_DsbH: Protein of unknown function, DUF25	100.0
cd02955		124	SSP411 TRX domain, SSP411 protein family; members	99.97
cd00249		384	AGE AGE domain; N-acyl-D-glucosamine 2-epimerase d	99.92
cd00249		384	AGE AGE domain; N-acyl-D-glucosamine 2-epimerase d	99.87
cd02960		130	AGR Anterior Gradient (AGR) family; members of thi	99.81
PF13899		82	Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_	99.77
PF07221		346	GlcNAc_2-epim: N-acylglucosamine 2-epimerase (GlcN	99.75
cd02958		114	UAS UAS family; UAS is a domain of unknown functio	99.71
cd02959		117	ERp19 Endoplasmic reticulum protein 19 (ERp19) fam	99.7
COG2942		388	N-acyl-D-glucosamine 2-epimerase [Carbohydrate tra	99.63
cd02951		125	SoxW SoxW family; SoxW is a bacterial periplasmic	99.6
smart00594		122	UAS UAS domain.	99.54
cd02953		104	DsbDgamma DsbD gamma family; DsbD gamma is the C-t	99.51
PF03663		370	Glyco_hydro_76: Glycosyl hydrolase family 76 ; Int	99.49
COG1331		667	Highly conserved protein containing a thioredoxin	99.47
PF07221		346	GlcNAc_2-epim: N-acylglucosamine 2-epimerase (GlcN	99.42
PRK00293		571	dipZ thiol:disulfide interchange protein precursor	99.41
COG4232		569	Thiol:disulfide interchange protein [Posttranslati	99.35
PF13098		112	Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_	99.26
cd02991		116	UAS_ETEA UAS family, ETEA subfamily; composed of p	99.19
COG2143		182	Thioredoxin-related protein [Posttranslational mod	99.13
PF03663		370	Glyco_hydro_76: Glycosyl hydrolase family 76 ; Int	99.12
cd02950		142	TxlA TRX-like protein A (TxlA) family; TxlA was or	99.03
KOG2244		786	consensus Highly conserved protein containing a th	98.99
cd02954		114	DIM1 Dim1 family; Dim1 is also referred to as U5 s	98.92
cd04791		321	LanC_SerThrkinase Lanthionine synthetase C-like do	98.87
PRK10996		139	thioredoxin 2; Provisional	98.87
cd02949		97	TRX_NTR TRX domain, novel NADPH thioredoxin reduct	98.85
PLN00410		142	U5 snRNP protein, DIM1 family; Provisional	98.82
cd02956		96	ybbN ybbN protein family; ybbN is a hypothetical p	98.81
cd02948		102	TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus	98.76
cd03000		104	PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o	98.72
cd02984		97	TRX_PICOT TRX domain, PICOT (for PKC-interacting c	98.72
cd02986		114	DLP Dim1 family, Dim1-like protein (DLP) subfamily	98.7
PF07470		336	Glyco_hydro_88: Glycosyl Hydrolase Family 88; Inte	98.69
COG2942		388	N-acyl-D-glucosamine 2-epimerase [Carbohydrate tra	98.69
TIGR01126		102	pdi_dom protein disulfide-isomerase domain. This m	98.68
cd02985		103	TRX_CDSP32 TRX family, chloroplastic drought-induc	98.67
cd02997		104	PDI_a_PDIR PDIa family, PDIR subfamily; composed o	98.63
cd02993		109	PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat	98.63
cd03003		101	PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam	98.61
KOG0910		150	consensus Thioredoxin-like protein [Posttranslatio	98.61
cd02963		111	TRX_DnaJ TRX domain, DnaJ domain containing protei	98.59
PHA02278		103	thioredoxin-like protein	98.56
cd02961		101	PDI_a_family Protein Disulfide Isomerase (PDIa) fa	98.55
TIGR01068		101	thioredoxin thioredoxin. Several proteins, such as	98.55
cd02996		108	PDI_a_ERp44 PDIa family, endoplasmic reticulum pro	98.55
cd03004		104	PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam	98.54
cd02962		152	TMX2 TMX2 family; composed of proteins similar to	98.53
cd03006		113	PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil	98.48
PTZ00051		98	thioredoxin; Provisional	98.46
PRK09381		109	trxA thioredoxin; Provisional	98.45
cd02947		93	TRX_family TRX family; composed of two groups: Gro	98.44
KOG0907		106	consensus Thioredoxin [Posttranslational modificat	98.43
cd03002		109	PDI_a_MPD1_like PDI family, MPD1-like subfamily; c	98.42
cd02999		100	PDI_a_ERp44_like PDIa family, endoplasmic reticulu	98.41
PF00085		103	Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio	98.39
cd02995		104	PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain	98.37
cd03005		102	PDI_a_ERp46 PDIa family, endoplasmic reticulum pro	98.35
cd02998		105	PDI_a_ERp38 PDIa family, endoplasmic reticulum pro	98.35
TIGR00385		173	dsbE periplasmic protein thiol:disulfide oxidoredu	98.32
PTZ00443		224	Thioredoxin domain-containing protein; Provisional	98.3
cd02994		101	PDI_a_TMX PDIa family, TMX subfamily; composed of	98.29
cd04791		321	LanC_SerThrkinase Lanthionine synthetase C-like do	98.29
cd03001		103	PDI_a_P5 PDIa family, P5 subfamily; composed of eu	98.29
cd02975		113	PfPDO_like_N Pyrococcus furiosus protein disulfide	98.29
cd02989		113	Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior	98.29
cd02952		119	TRP14_like Human TRX-related protein 14 (TRP14)-li	98.24
cd03065		120	PDI_b_Calsequestrin_N PDIb family, Calsequestrin s	98.23
cd03009		131	TryX_like_TryX_NRX Tryparedoxin (TryX)-like family	98.22
PRK15412		185	thiol:disulfide interchange protein DsbE; Provisio	98.22
COG3118		304	Thioredoxin domain-containing protein [Posttransla	98.21
cd03008		146	TryX_like_RdCVF Tryparedoxin (TryX)-like family, R	98.14
cd03010		127	TlpA_like_DsbE TlpA-like family, DsbE (also known	98.11
PF07944		520	DUF1680: Putative glycosyl hydrolase of unknown fu	98.11
TIGR01295		122	PedC_BrcD bacteriocin transport accessory protein,	98.1
cd02992		114	PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas	98.09
PRK14018		521	trifunctional thioredoxin/methionine sulfoxide red	98.04
PF13905		95	Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_	98.04
cd03011		123	TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso	98.03
PTZ00102		477	disulphide isomerase; Provisional	98.03
cd02967		114	mauD Methylamine utilization (mau) D family; mauD	98.03
cd02966		116	TlpA_like_family TlpA-like family; composed of Tlp	98.02
cd02964		132	TryX_like_family Tryparedoxin (TryX)-like family;	98.0
PTZ00102		477	disulphide isomerase; Provisional	97.98
cd02957		113	Phd_like Phosducin (Phd)-like family; composed of	97.98
COG4225		357	Predicted unsaturated glucuronyl hydrolase involve	97.98
cd02965		111	HyaE HyaE family; HyaE is also called HupG and Hox	97.98
TIGR01130		462	ER_PDI_fam protein disulfide isomerases, eukaryoti	97.96
PHA02125		75	thioredoxin-like protein	97.95
TIGR00411		82	redox_disulf_1 small redox-active disulfide protei	97.89
TIGR02738		153	TrbB type-F conjugative transfer system pilin asse	97.84
PLN02309		457	5'-adenylylsulfate reductase	97.84
TIGR00424		463	APS_reduc 5'-adenylylsulfate reductase, thioredoxi	97.82
PRK03147		173	thiol-disulfide oxidoreductase; Provisional	97.74
cd02982		103	PDI_b'_family Protein Disulfide Isomerase (PDIb')	97.74
PF06662		189	C5-epim_C: D-glucuronyl C5-epimerase C-terminus; I	97.73
PF07470		336	Glyco_hydro_88: Glycosyl Hydrolase Family 88; Inte	97.71
cd02987		175	Phd_like_Phd Phosducin (Phd)-like family, Phd subf	97.7
KOG0908		288	consensus Thioredoxin-like protein [Posttranslatio	97.69
TIGR02740		271	TraF-like TraF-like protein. This protein is relat	97.68
TIGR00412		76	redox_disulf_2 small redox-active disulfide protei	97.62
TIGR01626		184	ytfJ_HI0045 conserved hypothetical protein YtfJ-fa	97.62
cd02973		67	TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-	97.56
cd04793		382	LanC LanC is the cyclase enzyme of the lanthionine	97.55
TIGR02187		215	GlrX_arch Glutaredoxin-like domain protein. This f	97.55
TIGR02661		189	MauD methylamine dehydrogenase accessory protein M	97.54
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	97.5
cd04792		825	LanM-like LanM-like proteins. LanM is a bifunction	97.49
cd03026		89	AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid	97.49
cd04434		343	LanC_like LanC-like proteins. LanC is the cyclase	97.48
cd03012		126	TlpA_like_DipZ_like TlpA-like family, DipZ-like su	97.47
PF07944		520	DUF1680: Putative glycosyl hydrolase of unknown fu	97.41
TIGR02187		215	GlrX_arch Glutaredoxin-like domain protein. This f	97.39
PF08534		146	Redoxin: Redoxin; InterPro: IPR013740 This redoxin	97.3
TIGR01130		462	ER_PDI_fam protein disulfide isomerases, eukaryoti	97.26
COG3533		589	Uncharacterized protein conserved in bacteria [Fun	97.12
PF06662		189	C5-epim_C: D-glucuronyl C5-epimerase C-terminus; I	97.11
COG4225		357	Predicted unsaturated glucuronyl hydrolase involve	97.0
cd02969		171	PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot	96.98
cd02990		136	UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1	96.97
cd03007		116	PDI_a_ERp29_N PDIa family, endoplasmic reticulum p	96.96
KOG2501		157	consensus Thioredoxin, nucleoredoxin and related p	96.92
cd01659		69	TRX_superfamily Thioredoxin (TRX) superfamily; a l	96.88
PLN02399		236	phospholipid hydroperoxide glutathione peroxidase	96.87
PTZ00062		204	glutaredoxin; Provisional	96.76
PRK13728		181	conjugal transfer protein TrbB; Provisional	96.75
cd04794		343	euk_LANCL eukaryotic Lanthionine synthetase C-like	96.72
cd03017		140	PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit	96.71
COG3533		589	Uncharacterized protein conserved in bacteria [Fun	96.69
PLN03009		495	cellulase	96.66
PF00759		444	Glyco_hydro_9: Glycosyl hydrolase family 9; InterP	96.64
PRK09437		154	bcp thioredoxin-dependent thiol peroxidase; Review	96.63
PTZ00470		522	glycoside hydrolase family 47 protein; Provisional	96.62
PLN02340		614	endoglucanase	96.49
cd04792		825	LanM-like LanM-like proteins. LanM is a bifunction	96.48
PLN02345		469	endoglucanase	96.47
cd02889		348	SQCY Squalene cyclase (SQCY) domain; found in clas	96.46
PTZ00056		199	glutathione peroxidase; Provisional	96.44
KOG0191		383	consensus Thioredoxin/protein disulfide isomerase	96.43
COG4403		963	LcnDR2 Lantibiotic modifying enzyme [Defense mecha	96.39
PLN02171		629	endoglucanase	96.39
KOG2787		403	consensus Lanthionine synthetase C-like protein 1	96.38
PF06917		557	Pectate_lyase_2: Periplasmic pectate lyase; InterP	96.37
PLN02266		510	endoglucanase	96.36
KOG4277		468	consensus Uncharacterized conserved protein, conta	96.35
PLN02308		492	endoglucanase	96.33
cd02988		192	Phd_like_VIAF Phosducin (Phd)-like family, Viral i	96.31
KOG0190		493	consensus Protein disulfide isomerase (prolyl 4-hy	96.25
KOG0190		493	consensus Protein disulfide isomerase (prolyl 4-hy	96.23
TIGR02180		84	GRX_euk Glutaredoxin. This model represents eukary	96.2
PLN02613		498	endoglucanase	96.16
PF00578		124	AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per	96.12
PLN02909		486	Endoglucanase	96.03
cd04434		343	LanC_like LanC-like proteins. LanC is the cyclase	96.03
TIGR02540		153	gpx7 putative glutathione peroxidase Gpx7. This mo	95.97
PLN02412		167	probable glutathione peroxidase	95.97
PLN02420		525	endoglucanase	95.92
PTZ00470		522	glycoside hydrolase family 47 protein; Provisional	95.89
cd02968		142	SCO SCO (an acronym for Synthesis of Cytochrome c	95.88
TIGR02196		74	GlrX_YruB Glutaredoxin-like protein, YruB-family.	95.88
PLN00119		489	endoglucanase	95.79
PF01532		452	Glyco_hydro_47: Glycosyl hydrolase family 47; Inte	95.77
PF14595		129	Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A.	95.69
PRK10382		187	alkyl hydroperoxide reductase subunit C; Provision	95.65
TIGR03137		187	AhpC peroxiredoxin. This gene contains two invaria	95.59
PF01532		452	Glyco_hydro_47: Glycosyl hydrolase family 47; Inte	95.57
PF05147		355	LANC_like: Lanthionine synthetase C-like protein;	95.54
KOG2507		506	consensus Ubiquitin regulatory protein UBXD2, cont	95.49
cd00340		152	GSH_Peroxidase Glutathione (GSH) peroxidase family	95.48
cd02976		73	NrdH NrdH-redoxin (NrdH) family; NrdH is a small m	95.22
cd03014		143	PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical	95.21
PRK00522		167	tpx lipid hydroperoxide peroxidase; Provisional	95.16
cd03419		82	GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h	95.11
cd04794		343	euk_LANCL eukaryotic Lanthionine synthetase C-like	95.09
PTZ00256		183	glutathione peroxidase; Provisional	95.08
COG0526		127	TrxA Thiol-disulfide isomerase and thioredoxins [P	94.94
cd02892		634	SQCY_1 Squalene cyclase (SQCY) domain subgroup 1;	94.79
TIGR02200		77	GlrX_actino Glutaredoxin-like protein. This family	94.73
PLN02175		484	endoglucanase	94.67
KOG1752		104	consensus Glutaredoxin and related proteins [Postt	94.65
cd04793		382	LanC LanC is the cyclase enzyme of the lanthionine	94.64
cd02971		140	PRX_family Peroxiredoxin (PRX) family; composed of	94.33
KOG0191		383	consensus Thioredoxin/protein disulfide isomerase	94.24
TIGR01577		616	oligosac_amyl oligosaccharide amylase. The name of	94.23
cd03018		149	PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik	93.97
PRK15000		200	peroxidase; Provisional	93.91
TIGR02189		99	GlrX-like_plant Glutaredoxin-like family. This fam	93.82
cd03015		173	PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-	93.79
PF06110		119	DUF953: Eukaryotic protein of unknown function (DU	93.51
PRK13190		202	putative peroxiredoxin; Provisional	93.41
TIGR02190		79	GlrX-dom Glutaredoxin-family domain. This C-termin	93.21
PRK11657		251	dsbG disulfide isomerase/thiol-disulfide oxidase;	92.99
cd02066		72	GRX_family Glutaredoxin (GRX) family; composed of	92.94
PRK11200		85	grxA glutaredoxin 1; Provisional	92.9
PRK11509		132	hydrogenase-1 operon protein HyaE; Provisional	92.83
PTZ00253		199	tryparedoxin peroxidase; Provisional	92.68
PF06202		370	GDE_C: Amylo-alpha-1,6-glucosidase ; InterPro: IPR	92.68
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	92.51
PF06917		557	Pectate_lyase_2: Periplasmic pectate lyase; InterP	92.47
PHA03050		108	glutaredoxin; Provisional	92.42
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	92.35
TIGR00365		97	monothiol glutaredoxin, Grx4 family. The gene for	92.32
PF00462		60	Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl	92.24
PTZ00137		261	2-Cys peroxiredoxin; Provisional	92.21
cd02892		634	SQCY_1 Squalene cyclase (SQCY) domain subgroup 1;	92.11
COG4833		377	Predicted glycosyl hydrolase [Carbohydrate transpo	92.09
cd03027		73	GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg	91.39
PRK13599		215	putative peroxiredoxin; Provisional	90.88
PRK10638		83	glutaredoxin 3; Provisional	90.28
cd02970		149	PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot	90.25
PRK10877		232	protein disulfide isomerase II DsbC; Provisional	90.22
TIGR01577		616	oligosac_amyl oligosaccharide amylase. The name of	90.16
PF13728		215	TraF: F plasmid transfer operon protein	90.02
cd03028		90	GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte	89.9
KOG0912		375	consensus Thiol-disulfide isomerase and thioredoxi	89.79
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	89.78
KOG3414		142	consensus Component of the U4/U6.U5 snRNP/mitosis	89.58
PRK13191		215	putative peroxiredoxin; Provisional	89.37
COG4403		963	LcnDR2 Lantibiotic modifying enzyme [Defense mecha	89.36
TIGR02194		72	GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red	89.36
cd03418		75	GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b	89.29
TIGR01507		635	hopene_cyclase squalene-hopene cyclase. SHC is an	88.95
TIGR02183		86	GRXA Glutaredoxin, GrxA family. This model include	88.9
KOG2204		625	consensus Mannosyl-oligosaccharide alpha-1,2-manno	88.76
cd03016		203	PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub	88.59
PRK10606		183	btuE putative glutathione peroxidase; Provisional	88.44
TIGR02181		79	GRX_bact Glutaredoxin, GrxC family. This family of	88.39
PLN02993		763	lupeol synthase	87.64
cd02896		297	complement_C3_C4_C5 Proteins similar to C3, C4 and	87.6
KOG2431		546	consensus 1, 2-alpha-mannosidase [Carbohydrate tra	87.48
PRK10329		81	glutaredoxin-like protein; Provisional	87.13
PF05147		355	LANC_like: Lanthionine synthetase C-like protein;	87.04
PF13192		76	Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY	86.81
PF02966		133	DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th	86.49
TIGR01507		635	hopene_cyclase squalene-hopene cyclase. SHC is an	86.44
TIGR03463		634	osq_cycl 2,3-oxidosqualene cyclase. This model ide	86.25
KOG2431		546	consensus 1, 2-alpha-mannosidase [Carbohydrate tra	86.24
PF05592		509	Bac_rhamnosid: Bacterial alpha-L-rhamnosidase; Int	86.13
TIGR02474		290	pec_lyase pectate lyase, PelA/Pel-15E family. Memb	86.06
cd02889		348	SQCY Squalene cyclase (SQCY) domain; found in clas	85.08
COG0695		80	GrxC Glutaredoxin and related proteins [Posttransl	84.76
PRK13189		222	peroxiredoxin; Provisional	84.44
PRK11097		376	endo-1,4-D-glucanase; Provisional	84.44
TIGR01561		575	gde_arch glycogen debranching enzyme, archaeal typ	84.4
TIGR02739		256	TraF type-F conjugative transfer system pilin asse	84.17
PLN03012		759	Camelliol C synthase	83.04
PRK13703		248	conjugal pilus assembly protein TraF; Provisional	82.9
PRK12759		410	bifunctional gluaredoxin/ribonucleoside-diphosphat	81.73
cd03029		72	GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb	81.6
KOG2787		403	consensus Lanthionine synthetase C-like protein 1	81.23
KOG2429		622	consensus Glycosyl hydrolase, family 47 [Carbohydr	81.12
PRK10137		786	alpha-glucosidase; Provisional	80.49

>COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=100.00  E-value=4.8e-171  Score=1454.38  Aligned_cols=661  Identities=45%  Similarity=0.769  Sum_probs=619.3

Q ss_pred             ccccccccCCChhhhhccCCCccCccchHHHHHHHHhcCCCEEEEEeccCChhhhhhhhcccCCHHHHHHHhcCeEEEEE
Q 003115          100 KHTNRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKV  179 (846)
Q Consensus       100 ~~~NrL~~e~SpYL~~ha~~~v~W~~~~~eAl~~Ak~e~KpI~l~~g~~wC~wC~~me~etf~d~eVa~~ln~~FV~vkv  179 (846)
                      .++|||++|+||||||||+|||+|++|++|||++||+|||||||||||+||||||||++|+|+||+||++||++||+|||
T Consensus         5 ~~~NrL~~e~SpYL~~ha~nPV~W~pW~~eAf~~A~~edkPIflSIGys~CHWChVM~~ESf~d~eiA~~lN~~FV~IKV   84 (667)
T COG1331           5 SMPNRLINEKSPYLLQHAHNPVDWYPWGEEAFAKAKEEDKPILLSIGYSTCHWCHVMAHESFEDPEIAAILNENFVPVKV   84 (667)
T ss_pred             CcCccCccCCCHHHHhccCCCccccccCHHHHHHHHHhCCCEEEEeccccccchHHHhhhcCCCHHHHHHHHhCceeeeE
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCccHHHHHHHHHHHhcCCCCCCcEEEECCCCceeccccccCCCCCCCcccHHHHHHHHHHHHHHcHHHHHHHHHHH
Q 003115          180 DREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFA  259 (846)
Q Consensus       180 D~ee~p~~~~~y~~~~~~~~g~~G~P~~v~l~pdg~~~~~~tY~p~~~~~~~~~f~~~L~~i~~~~~~~~~~~~~~a~~~  259 (846)
                      |||||||||++||+++|+++|+||||++|||||||+||+++||+|+++++|+|||+++|++|.+.|+++|++++++|+++
T Consensus        85 DREERPDvD~~Ym~~~q~~tG~GGWPLtVfLTPd~kPFfagTY~P~e~r~g~pGf~~lL~~i~~~W~edr~~~~~~a~~~  164 (667)
T COG1331          85 DREERPDVDSLYMNASQAITGQGGWPLTVFLTPDGKPFFAGTYFPKEDRYGRPGFKQLLEAIRETWREDREELLQSAERV  164 (667)
T ss_pred             ChhhccCHHHHHHHHHHHhccCCCCceeEEECCCCceeeeeeecCCcccCCCcCHHHHHHHHHHHHHhhHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhcccCCCCCCCCCCHHHHHHHHHHHHhhccccCCCCCCCCCCCChhHHHHHHHhhhhccccCCCCCcHHHHH
Q 003115          260 IEQLSEALSASASSNKLPDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQK  339 (846)
Q Consensus       260 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~D~~~GGfg~apKFP~~~~l~~ll~~~~~~~~~~~~~~~~~~~~  339 (846)
                      .+.++....+.     .+..++++.+++++++|.+.||++|||||++||||+|+.+.|||+++.+++       ++++++
T Consensus       165 ~~~l~~~~~~~-----~~~~l~~~~l~~~~~~l~~~~D~~~GGfg~~pKFP~~~~l~~Llr~~~~~~-------d~~~~~  232 (667)
T COG1331         165 LEALEGLARPS-----AGEELDEEVLDRAAEALARSFDREYGGFGSAPKFPPPHLLLFLLRYSLRTG-------DERALD  232 (667)
T ss_pred             HHHHHhccCCC-----ccccCChHHHHHHHHHHHHhcchhhCCcCCCCCCCChHHHHHHHHHHHhhC-------CHHHHH
Confidence            99998755221     123556788999999999999999999999999999999999999987754       479999


Q ss_pred             HHHHHHHHHHhCCCcccCCCcEEEEEcCCCCCCCCCchhHHHHHHHHHHHHHHHHccCChHHHHHHHHHHHHHHHhccCC
Q 003115          340 MVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGP  419 (846)
Q Consensus       340 ~~~~TL~~m~~GGi~D~vgGGF~RYsvD~~W~vPHFEKMLyDNA~Ll~~ya~Ay~~t~~~~y~~~A~~t~~fl~r~m~~~  419 (846)
                      |+++||++|+.|||||||||||||||||+.|.||||||||||||+|+.+|++||+.|||+.|+++|++|++||+|+|++|
T Consensus       233 ~~~~TL~~ma~GGIyDhlgGGF~RYStD~~WlvPHFEKMLyDnA~l~~~y~~ay~~tgd~~y~~~a~~i~~~l~rel~sp  312 (667)
T COG1331         233 MVLRTLDAMARGGIYDHLGGGFFRYSTDREWLVPHFEKMLYDNALLLRAYAEAYRATGDDLYRRAAEGILDYLLRELYSP  312 (667)
T ss_pred             HHHHHHHHHHccCCccccCCceeeeecCCceechhHHHHHHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhcCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCceeeeccCCCccccccccccCCceEEecHHHHHHHhhhhHHHHHHHhcccCCCCcCCCCCCCCCCCCCCcceeeccCC
Q 003115          420 GGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELND  499 (846)
Q Consensus       420 ~Ggfysa~DADs~~~~~~~~~~EGayY~wt~~Ei~~~L~~~~~~~~~~f~i~~~Gn~e~~~~~d~~g~feg~nvL~~~~~  499 (846)
                      +||||+|+|||++       ++||+||+||.+||+++||+++++|+++|+|+++||            |+|+||||+..+
T Consensus       313 ~ggFyss~DAD~~-------g~EG~~Y~Ws~eEi~~~Lg~d~~~~~~~f~vs~~Gn------------feGrnvL~~~~~  373 (667)
T COG1331         313 EGGFYSSLDADSD-------GEEGKYYTWSVEELKEVLGEDAELACKYFDVSEEGN------------FEGRNVLHVPGP  373 (667)
T ss_pred             CCceeecccccCc-------ccCCCeeecCHHHHHHHhcccHHHHHHHcccCCCCC------------cCCceeecccCc
Confidence            9999999999994       699999999999999999999999999999999999            689999999988


Q ss_pred             chHHHHHcCCCHHHHHHHHHHHHHHHHhhhcCCCCCCCCchhhhchHHHHHHHHHHHHHHhhhhhhhhcccCCCCCCChH
Q 003115          500 SSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRK  579 (846)
Q Consensus       500 ~~~~a~~~g~~~~~l~~~l~~~r~~L~~~R~~R~~P~~DdKilt~WNglmI~ALa~A~~v~~d~~~~~~~~~~~~~~~~~  579 (846)
                      .++ +      ++++.+.++.+|+||+.+|.+|++|++||||+|+||||||.||+.|+++++|                +
T Consensus       374 ~~~-~------~~~~~~~l~~~r~kL~~~R~~R~~P~~Ddkvlt~wNglmi~aLa~a~~~~~d----------------~  430 (667)
T COG1331         374 LEE-A------IEEAEEKLERAREKLLAAREKRKQPSRDDKVLTDWNGLMIAALAEAGRVLGD----------------P  430 (667)
T ss_pred             hhh-h------hhhhHHHHHHHHHHHHHHHHhCCCCCCCcceeeccHHHHHHHHHHHHHHcCC----------------h
Confidence            665 1      7888999999999999999999999999999999999999999999999998                8


Q ss_pred             HHHHHHHHHHHHHHHhccccCCCeEEEEecCCCCCCCCCcchHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHcccc
Q 003115          580 EYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDR  659 (846)
Q Consensus       580 ~yLe~A~~~a~~l~~~l~d~~~G~l~~~~~dg~~~~~~~leDyA~~i~aLl~LYe~Tgd~~yL~~A~~L~~~~~~~F~D~  659 (846)
                      +|++.|+++++||.+.+++   +++.|.+++|.....++++|||++|.|+++||++|+|.+||+.|++|++.++++|||+
T Consensus       431 ~~l~~A~~~~~fi~~~l~~---~rl~~~~~~G~a~~~g~leDYA~~i~gll~lye~t~d~~yL~~A~~L~~~~i~~f~d~  507 (667)
T COG1331         431 EYLEAAERAADFILDNLYV---DRLLRRYRGGEAAVAGLLEDYAFLILGLLALYEATGDLAYLEKAIELADEAIADFWDD  507 (667)
T ss_pred             HHHHHHHHHHHHHHHhhcc---cchheeeecCcccccccchhHHHHHHHHHHHHHhhCcHHHHHHHHHHHHHHHHHhcCC
Confidence            9999999999999999997   3899999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcccccCCCCCcccccccCCCCCCCCChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHHHHHHHHhhhhhHHHHHH
Q 003115          660 EGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCC  739 (846)
Q Consensus       660 ~~Ggyf~t~~~~~~l~~R~k~~~D~a~PS~Nsv~a~~L~rL~~lt~~~~~~~y~~~A~~~l~~~~~~i~~~p~~~~~~~~  739 (846)
                      + ||||+++.+++.+++|.++..|+++||+||+++.+|++|+.+||+   ..|.+.|+++|+.|.+.+.++|.++++++.
T Consensus       508 ~-gGf~~t~~~~~~l~ir~~~~~D~a~~S~na~~~~~L~~Ls~ltg~---~~y~e~A~~~L~a~~~~~~~~p~~~~~~~~  583 (667)
T COG1331         508 E-GGFYDTPSDSEDLLIRPKEPTDGATPSGNAVAAQALLRLSLLTGD---ARYLEAAEDILQAFAGLAERAPFAHAGLLL  583 (667)
T ss_pred             C-CCcccCCCcccccccCCCCCCCCCCCCHHHHHHHHHHHHHhhcCc---hhHHHHHHHHHHHHHHHHHhCCccchHHHH
Confidence            8 679999999999999999999999999999999999999999996   889999999999999999999999999999


Q ss_pred             HHHHhcCCCccEEEEecCCCchhHHHHHHHHHhcCCCCeEEEEeCCCCcchhhhhhhccccchhhhcccCCCCccEEEEc
Q 003115          740 AADMLSVPSRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARNNFSADKVVALVC  819 (846)
Q Consensus       740 a~~~~~~~~~~~vvivg~~~~~~~~~ll~~~~~~~~P~~~v~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~ayVC  819 (846)
                      |++++..+ ..+|||+|    ....++++++.+.|+|++++++...+.             +.++.+....+|+ ++|||
T Consensus       584 a~~~~~~~-~~~ivvv~----~~~~~~~~~~~~~~~P~~~l~~~~~~~-------------~~~~~~~~l~~g~-~ayvC  644 (667)
T COG1331         584 AAEFLISG-PLVIVVAG----DPRSELLRAALRLYLPEKVLVVGTEGY-------------VSLLVDGMLGGGK-TAYVC  644 (667)
T ss_pred             HHHHHcCC-ceEEEEeC----CCcHHHHHHHHhcCCcceEEEEecccc-------------cCcchhhccCCCC-eEEEe
Confidence            99998876 57888888    234679999999999999998765431             1111111112444 99999


Q ss_pred             cCCccCCCCCCHHHHHHHhhc
Q 003115          820 QNFSCSPPVTDPISLENLLLE  840 (846)
Q Consensus       820 ~~~~C~~Pvt~~e~L~~~L~~  840 (846)
                      +|++|++||+++++|.++|..
T Consensus       645 ~~~~C~~P~~~~e~l~~~l~~  665 (667)
T COG1331         645 TGDACLPPVTSPEELAELLAV  665 (667)
T ss_pred             cCCccCCCcCCHHHHHHHHhh
Confidence            999999999999999999975

>KOG2244 consensus Highly conserved protein containing a thioredoxin domain [General function prediction only]	Back alignment and domain information

>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins	Back alignment and domain information

>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif	Back alignment and domain information

>cd00249 AGE AGE domain; N-acyl-D-glucosamine 2-epimerase domain; Responsible for intermediate epimerization during biosynthesis of N-acetylneuraminic acid	Back alignment and domain information

>cd00249 AGE AGE domain; N-acyl-D-glucosamine 2-epimerase domain; Responsible for intermediate epimerization during biosynthesis of N-acetylneuraminic acid	Back alignment and domain information

>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus	Back alignment and domain information

>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A	Back alignment and domain information

>PF07221 GlcNAc_2-epim: N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase); InterPro: IPR010819 N-acylglucosamine 2-epimerase (AGE, 5	Back alignment and domain information

>cd02958 UAS UAS family; UAS is a domain of unknown function	Back alignment and domain information

>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain	Back alignment and domain information

>COG2942 N-acyl-D-glucosamine 2-epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation	Back alignment and domain information

>smart00594 UAS UAS domain	Back alignment and domain information

>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD	Back alignment and domain information

>PF03663 Glyco_hydro_76: Glycosyl hydrolase family 76 ; InterPro: IPR005198 O-Glycosyl hydrolases 3	Back alignment and domain information

>COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07221 GlcNAc_2-epim: N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase); InterPro: IPR010819 N-acylglucosamine 2-epimerase (AGE, 5	Back alignment and domain information

>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional	Back alignment and domain information

>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion]	Back alignment and domain information

>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A	Back alignment and domain information

>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals	Back alignment and domain information

>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF03663 Glyco_hydro_76: Glycosyl hydrolase family 76 ; InterPro: IPR005198 O-Glycosyl hydrolases 3	Back alignment and domain information

>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus	Back alignment and domain information

>KOG2244 consensus Highly conserved protein containing a thioredoxin domain [General function prediction only]	Back alignment and domain information

>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein	Back alignment and domain information

>cd04791 LanC_SerThrkinase Lanthionine synthetase C-like domain associated with serine threonine kinases	Back alignment and domain information

>PRK10996 thioredoxin 2; Provisional	Back alignment and domain information

>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains	Back alignment and domain information

>PLN00410 U5 snRNP protein, DIM1 family; Provisional	Back alignment and domain information

>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain	Back alignment and domain information

>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein	Back alignment and domain information

>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus	Back alignment and domain information

>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes	Back alignment and domain information

>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1	Back alignment and domain information

>PF07470 Glyco_hydro_88: Glycosyl Hydrolase Family 88; InterPro: IPR010905 Unsaturated glucuronyl hydrolase catalyses the hydrolytic release of unsaturated glucuronic acids from oligosaccharides produced by the reactions of polysaccharide lyases []	Back alignment and domain information

>COG2942 N-acyl-D-glucosamine 2-epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR01126 pdi_dom protein disulfide-isomerase domain	Back alignment and domain information

>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif	Back alignment and domain information

>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related)	Back alignment and domain information

>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases	Back alignment and domain information

>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains	Back alignment and domain information

>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain	Back alignment and domain information

>PHA02278 thioredoxin-like protein	Back alignment and domain information

>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants	Back alignment and domain information

>TIGR01068 thioredoxin thioredoxin	Back alignment and domain information

>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention	Back alignment and domain information

>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains	Back alignment and domain information

>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library	Back alignment and domain information

>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox	Back alignment and domain information

>PTZ00051 thioredoxin; Provisional	Back alignment and domain information

>PRK09381 trxA thioredoxin; Provisional	Back alignment and domain information

>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains	Back alignment and domain information

>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein	Back alignment and domain information

>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44	Back alignment and domain information

>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms	Back alignment and domain information

>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1	Back alignment and domain information

>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains	Back alignment and domain information

>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5	Back alignment and domain information

>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily	Back alignment and domain information

>PTZ00443 Thioredoxin domain-containing protein; Provisional	Back alignment and domain information

>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX	Back alignment and domain information

>cd04791 LanC_SerThrkinase Lanthionine synthetase C-like domain associated with serine threonine kinases	Back alignment and domain information

>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain)	Back alignment and domain information

>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding	Back alignment and domain information

>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif	Back alignment and domain information

>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1	Back alignment and domain information

>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle	Back alignment and domain information

>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif	Back alignment and domain information

>PRK15412 thiol:disulfide interchange protein DsbE; Provisional	Back alignment and domain information

>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors	Back alignment and domain information

>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif	Back alignment and domain information

>PF07944 DUF1680: Putative glycosyl hydrolase of unknown function (DUF1680); InterPro: IPR012878 The members of this family are sequences derived from hypothetical bacterial and eukaryotic proteins of unknown function	Back alignment and domain information

>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative	Back alignment and domain information

>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein	Back alignment and domain information

>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional	Back alignment and domain information

>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A	Back alignment and domain information

>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif	Back alignment and domain information

>PTZ00102 disulphide isomerase; Provisional	Back alignment and domain information

>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source	Back alignment and domain information

>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins	Back alignment and domain information

>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX	Back alignment and domain information

>PTZ00102 disulphide isomerase; Provisional	Back alignment and domain information

>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions	Back alignment and domain information

>COG4225 Predicted unsaturated glucuronyl hydrolase involved in regulation of bacterial surface properties, and related proteins [General function prediction only]	Back alignment and domain information

>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO	Back alignment and domain information

>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic	Back alignment and domain information

>PHA02125 thioredoxin-like protein	Back alignment and domain information

>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1	Back alignment and domain information

>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB	Back alignment and domain information

>PLN02309 5'-adenylylsulfate reductase	Back alignment and domain information

>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent	Back alignment and domain information

>PRK03147 thiol-disulfide oxidoreductase; Provisional	Back alignment and domain information

>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants	Back alignment and domain information

>PF06662 C5-epim_C: D-glucuronyl C5-epimerase C-terminus; InterPro: IPR010598 This entry consists of known or predicted D-glucuronyl C5-epimerases which share a common C-terminal region	Back alignment and domain information

>PF07470 Glyco_hydro_88: Glycosyl Hydrolase Family 88; InterPro: IPR010905 Unsaturated glucuronyl hydrolase catalyses the hydrolytic release of unsaturated glucuronic acids from oligosaccharides produced by the reactions of polysaccharide lyases []	Back alignment and domain information

>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions	Back alignment and domain information

>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02740 TraF-like TraF-like protein	Back alignment and domain information

>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2	Back alignment and domain information

>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626	Back alignment and domain information

>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)	Back alignment and domain information

>cd04793 LanC LanC is the cyclase enzyme of the lanthionine synthetase	Back alignment and domain information

>TIGR02187 GlrX_arch Glutaredoxin-like domain protein	Back alignment and domain information

>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>cd04792 LanM-like LanM-like proteins	Back alignment and domain information

>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides	Back alignment and domain information

>cd04434 LanC_like LanC-like proteins	Back alignment and domain information

>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain	Back alignment and domain information

>PF07944 DUF1680: Putative glycosyl hydrolase of unknown function (DUF1680); InterPro: IPR012878 The members of this family are sequences derived from hypothetical bacterial and eukaryotic proteins of unknown function	Back alignment and domain information

>TIGR02187 GlrX_arch Glutaredoxin-like domain protein	Back alignment and domain information

>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins	Back alignment and domain information

>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic	Back alignment and domain information

>COG3533 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF06662 C5-epim_C: D-glucuronyl C5-epimerase C-terminus; InterPro: IPR010598 This entry consists of known or predicted D-glucuronyl C5-epimerases which share a common C-terminal region	Back alignment and domain information

>COG4225 Predicted unsaturated glucuronyl hydrolase involved in regulation of bacterial surface properties, and related proteins [General function prediction only]	Back alignment and domain information

>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs	Back alignment and domain information

>cd02990 UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1) subfamily; FAF1 contains a UAS domain of unknown function N-terminal to a ubiquitin-associated UBX domain	Back alignment and domain information

>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells	Back alignment and domain information

>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only]	Back alignment and domain information

>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold	Back alignment and domain information

>PLN02399 phospholipid hydroperoxide glutathione peroxidase	Back alignment and domain information

>PTZ00062 glutaredoxin; Provisional	Back alignment and domain information

>PRK13728 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>cd04794 euk_LANCL eukaryotic Lanthionine synthetase C-like protein	Back alignment and domain information

>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides	Back alignment and domain information

>COG3533 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PLN03009 cellulase	Back alignment and domain information

>PF00759 Glyco_hydro_9: Glycosyl hydrolase family 9; InterPro: IPR001701 O-Glycosyl hydrolases 3	Back alignment and domain information

>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed	Back alignment and domain information

>PTZ00470 glycoside hydrolase family 47 protein; Provisional	Back alignment and domain information

>PLN02340 endoglucanase	Back alignment and domain information

>cd04792 LanM-like LanM-like proteins	Back alignment and domain information

>PLN02345 endoglucanase	Back alignment and domain information

>cd02889 SQCY Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold	Back alignment and domain information

>PTZ00056 glutathione peroxidase; Provisional	Back alignment and domain information

>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4403 LcnDR2 Lantibiotic modifying enzyme [Defense mechanisms]	Back alignment and domain information

>PLN02171 endoglucanase	Back alignment and domain information

>KOG2787 consensus Lanthionine synthetase C-like protein 1 [Defense mechanisms]	Back alignment and domain information

>PF06917 Pectate_lyase_2: Periplasmic pectate lyase; InterPro: IPR010702 This family consists of several Enterobacterial periplasmic pectate lyase proteins	Back alignment and domain information

>PLN02266 endoglucanase	Back alignment and domain information

>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only]	Back alignment and domain information

>PLN02308 endoglucanase	Back alignment and domain information

>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis	Back alignment and domain information

>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02180 GRX_euk Glutaredoxin	Back alignment and domain information

>PLN02613 endoglucanase	Back alignment and domain information

>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells	Back alignment and domain information

>PLN02909 Endoglucanase	Back alignment and domain information

>cd04434 LanC_like LanC-like proteins	Back alignment and domain information

>TIGR02540 gpx7 putative glutathione peroxidase Gpx7	Back alignment and domain information

>PLN02412 probable glutathione peroxidase	Back alignment and domain information

>PLN02420 endoglucanase	Back alignment and domain information

>PTZ00470 glycoside hydrolase family 47 protein; Provisional	Back alignment and domain information

>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold	Back alignment and domain information

>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family	Back alignment and domain information

>PLN00119 endoglucanase	Back alignment and domain information

>PF01532 Glyco_hydro_47: Glycosyl hydrolase family 47; InterPro: IPR001382 O-Glycosyl hydrolases 3	Back alignment and domain information

>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A	Back alignment and domain information

>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional	Back alignment and domain information

>TIGR03137 AhpC peroxiredoxin	Back alignment and domain information

>PF01532 Glyco_hydro_47: Glycosyl hydrolase family 47; InterPro: IPR001382 O-Glycosyl hydrolases 3	Back alignment and domain information

>PF05147 LANC_like: Lanthionine synthetase C-like protein; InterPro: IPR007822 The LanC-like protein superfamily encompasses a highly divergent group of peptide-modifying enzymes, including the eukaryotic and bacterial lanthionine synthetase C-like proteins (LanC) [, , ]; subtilin biosynthesis protein SpaC from Bacillus subtilis [, ]; epidermin biosynthesis protein EpiC from Staphylococcus epidermidis []; nisin biosynthesis protein NisC from Lactococcus lactis [, , ]; GCR2 from Arabidopsis thaliana []; and many others

Back alignment and domain information

>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only]	Back alignment and domain information

>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate	Back alignment and domain information

>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile	Back alignment and domain information

>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx)	Back alignment and domain information

>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional	Back alignment and domain information

>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>cd04794 euk_LANCL eukaryotic Lanthionine synthetase C-like protein	Back alignment and domain information

>PTZ00256 glutathione peroxidase; Provisional	Back alignment and domain information

>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion]	Back alignment and domain information

>cd02892 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold	Back alignment and domain information

>TIGR02200 GlrX_actino Glutaredoxin-like protein	Back alignment and domain information

>PLN02175 endoglucanase	Back alignment and domain information

>KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd04793 LanC LanC is the cyclase enzyme of the lanthionine synthetase	Back alignment and domain information

>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified	Back alignment and domain information

>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01577 oligosac_amyl oligosaccharide amylase	Back alignment and domain information

>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE	Back alignment and domain information

>PRK15000 peroxidase; Provisional	Back alignment and domain information

>TIGR02189 GlrX-like_plant Glutaredoxin-like family	Back alignment and domain information

>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides	Back alignment and domain information

>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like	Back alignment and domain information

>PRK13190 putative peroxiredoxin; Provisional	Back alignment and domain information

>TIGR02190 GlrX-dom Glutaredoxin-family domain	Back alignment and domain information

>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional	Back alignment and domain information

>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>PRK11200 grxA glutaredoxin 1; Provisional	Back alignment and domain information

>PRK11509 hydrogenase-1 operon protein HyaE; Provisional	Back alignment and domain information

>PTZ00253 tryparedoxin peroxidase; Provisional	Back alignment and domain information

>PF06202 GDE_C: Amylo-alpha-1,6-glucosidase ; InterPro: IPR010401 This family includes human glycogen branching enzyme P35573 from SWISSPROT	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>PF06917 Pectate_lyase_2: Periplasmic pectate lyase; InterPro: IPR010702 This family consists of several Enterobacterial periplasmic pectate lyase proteins	Back alignment and domain information

>PHA03050 glutaredoxin; Provisional	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>TIGR00365 monothiol glutaredoxin, Grx4 family	Back alignment and domain information

>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors	Back alignment and domain information

>PTZ00137 2-Cys peroxiredoxin; Provisional	Back alignment and domain information

>cd02892 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold	Back alignment and domain information

>COG4833 Predicted glycosyl hydrolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions	Back alignment and domain information

>PRK13599 putative peroxiredoxin; Provisional	Back alignment and domain information

>PRK10638 glutaredoxin 3; Provisional	Back alignment and domain information

>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs	Back alignment and domain information

>PRK10877 protein disulfide isomerase II DsbC; Provisional	Back alignment and domain information

>TIGR01577 oligosac_amyl oligosaccharide amylase	Back alignment and domain information

>PF13728 TraF: F plasmid transfer operon protein	Back alignment and domain information

>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins	Back alignment and domain information

>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion]	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>KOG3414 consensus Component of the U4/U6	Back alignment and domain information

>PRK13191 putative peroxiredoxin; Provisional	Back alignment and domain information

>COG4403 LcnDR2 Lantibiotic modifying enzyme [Defense mechanisms]	Back alignment and domain information

>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH	Back alignment and domain information

>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>TIGR01507 hopene_cyclase squalene-hopene cyclase	Back alignment and domain information

>TIGR02183 GRXA Glutaredoxin, GrxA family	Back alignment and domain information

>KOG2204 consensus Mannosyl-oligosaccharide alpha-1,2-mannosidase and related glycosyl hydrolases [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine	Back alignment and domain information

>PRK10606 btuE putative glutathione peroxidase; Provisional	Back alignment and domain information

>TIGR02181 GRX_bact Glutaredoxin, GrxC family	Back alignment and domain information

>PLN02993 lupeol synthase	Back alignment and domain information

>cd02896 complement_C3_C4_C5 Proteins similar to C3, C4 and C5 of vertebrate complement	Back alignment and domain information

>KOG2431 consensus 1, 2-alpha-mannosidase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK10329 glutaredoxin-like protein; Provisional	Back alignment and domain information

Back alignment and domain information

>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B	Back alignment and domain information

>PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms	Back alignment and domain information

>TIGR01507 hopene_cyclase squalene-hopene cyclase	Back alignment and domain information

>TIGR03463 osq_cycl 2,3-oxidosqualene cyclase	Back alignment and domain information

>KOG2431 consensus 1, 2-alpha-mannosidase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF05592 Bac_rhamnosid: Bacterial alpha-L-rhamnosidase; InterPro: IPR008902 This entry consists of bacterial rhamnosidase A and B enzymes	Back alignment and domain information

>TIGR02474 pec_lyase pectate lyase, PelA/Pel-15E family	Back alignment and domain information

>cd02889 SQCY Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold	Back alignment and domain information

>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13189 peroxiredoxin; Provisional	Back alignment and domain information

>PRK11097 endo-1,4-D-glucanase; Provisional	Back alignment and domain information

>TIGR01561 gde_arch glycogen debranching enzyme, archaeal type, putative	Back alignment and domain information

>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF	Back alignment and domain information

>PLN03012 Camelliol C synthase	Back alignment and domain information

>PRK13703 conjugal pilus assembly protein TraF; Provisional	Back alignment and domain information

>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional	Back alignment and domain information

>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria	Back alignment and domain information

>KOG2787 consensus Lanthionine synthetase C-like protein 1 [Defense mechanisms]	Back alignment and domain information

>KOG2429 consensus Glycosyl hydrolase, family 47 [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK10137 alpha-glucosidase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		846
3ira_A		173	The Crystal Structure Of One Domain Of The Conserve		2e-44

>pdb|3IRA|A Chain A, The Crystal Structure Of One Domain Of The Conserved Protein From Methanosarcina Mazei Go1 Length = 173

Back alignment and structure

Iteration: 1

Score = 177 bits (449), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 78/154 (50%), Positives = 104/154 (67%) Query: 103 NRLAAEHSPYLLQHAHNPVDXXXXXXXXXXXXRKRDVPIFLSIGYSTCHWCHVMEVESFE 162 NRL E SPYLLQHA+NPVD RK + P+FLSIGYSTCHWCH+M ESFE Sbjct: 4 NRLIKEKSPYLLQHAYNPVDWYPWGEEAFEKARKENKPVFLSIGYSTCHWCHMMAHESFE 63 Query: 163 DEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTY 222 DE VA L+N+ FVSIKVDREERPD+D +YMT Q + G GGWPL++ ++P KP GTY Sbjct: 64 DEEVAGLMNEAFVSIKVDREERPDIDNIYMTVCQIILGRGGWPLNIIMTPGKKPFFAGTY 123 Query: 223 FPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSG 256 P ++ + G ++ ++K+ W+++ + + S Sbjct: 124 IPKNTRFNQIGMLELVPRIKEIWEQQHEEVLDSA 157

PyMOL of 3ira

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		846
3ira_A		173	Conserved protein; methanosarcina mazei,structural	1e-105
2ju5_A		154	Thioredoxin disulfide isomerase; protein, oxidored	7e-47
3ph9_A		151	Anterior gradient protein 3 homolog; thioredoxin f	1e-34
1sen_A		164	Thioredoxin-like protein P19; endoplasmic reticulu	3e-33
3f9u_A		172	Putative exported cytochrome C biogenesis-related;	4e-30
3fk8_A		133	Disulphide isomerase; APC61824.1, xylella fastidio	2e-28
2gz6_A		388	N-acetyl-D-glucosamine 2-epimerase; anabaena SP. C	2e-20
2lst_A		130	Thioredoxin; structural genomics, NEW YORK structu	1e-18
3gt5_A		402	N-acetylglucosamine 2-epimerase; structural genomi	1e-13
2dlx_A		153	UBX domain-containing protein 7; UAS domain, prote	2e-12
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	9e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-08
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-05
2fwh_A		134	Thiol:disulfide interchange protein DSBD; thioredo	3e-08
1fp3_A		402	N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barr	3e-07
2kuc_A		130	Putative disulphide-isomerase; structural genomics	2e-06

>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Length = 173	Back alignment and structure

 Score =  321 bits (825), Expect = e-105
 Identities = 88/170 (51%), Positives = 119/170 (70%)

Query: 102 TNRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESF 161
            NRL  E SPYLLQHA+NPVDW+ WGEEAF +ARK + P+FLSIGYSTCHWCH+M  ESF
Sbjct: 3   PNRLIKEKSPYLLQHAYNPVDWYPWGEEAFEKARKENKPVFLSIGYSTCHWCHMMAHESF 62

Query: 162 EDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGT 221
           EDE VA L+N+ FVSIKVDREERPD+D +YMT  Q + G GGWPL++ ++P  KP   GT
Sbjct: 63  EDEEVAGLMNEAFVSIKVDREERPDIDNIYMTVCQIILGRGGWPLNIIMTPGKKPFFAGT 122

Query: 222 YFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSASA 271
           Y P   ++ + G   ++ ++K+ W+++ + +  S       + E +  S+
Sbjct: 123 YIPKNTRFNQIGMLELVPRIKEIWEQQHEEVLDSAEKITSTIQEMIKESS 172

PyMOL of 3ira

>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Length = 154	Back alignment and structure

>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} Length = 151	Back alignment and structure

>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Length = 164	Back alignment and structure

>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Length = 172	Back alignment and structure

>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Length = 133	Back alignment and structure

>2gz6_A N-acetyl-D-glucosamine 2-epimerase; anabaena SP. CH1, isomer; 2.00A {Anabaena SP} Length = 388	Back alignment and structure

>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Length = 130	Back alignment and structure

>3gt5_A N-acetylglucosamine 2-epimerase; structural genomics, isomerase, PSI-2; 1.70A {Xylella fastidiosa} Length = 402	Back alignment and structure

>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Length = 153	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Length = 134	Back alignment and structure

>1fp3_A N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barrel, isomer; 2.00A {Sus scrofa} SCOP: a.102.1.3 Length = 402	Back alignment and structure

>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Length = 130	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		846
3ira_A		173	Conserved protein; methanosarcina mazei,structural	100.0
2gz6_A		388	N-acetyl-D-glucosamine 2-epimerase; anabaena SP. C	100.0
1fp3_A		402	N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barr	100.0
2zbl_A		421	Putative isomerase; N-acyl-D-glucosamine 2-epimera	99.97
3gt5_A		402	N-acetylglucosamine 2-epimerase; structural genomi	99.94
1fp3_A		402	N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barr	99.92
2dlx_A		153	UBX domain-containing protein 7; UAS domain, prote	99.89
2zbl_A		421	Putative isomerase; N-acyl-D-glucosamine 2-epimera	99.89
2gz6_A		388	N-acetyl-D-glucosamine 2-epimerase; anabaena SP. C	99.86
2zzr_A		397	Unsaturated glucuronyl hydrolase; alpha barrel; 1.	99.85
2ahf_A		377	Unsaturated glucuronyl hydrolase; alpha6/alpha6 ba	99.8
3gt5_A		402	N-acetylglucosamine 2-epimerase; structural genomi	99.8
3ph9_A		151	Anterior gradient protein 3 homolog; thioredoxin f	99.79
3k7x_A		349	LIN0763 protein; Q92DQ0, LKR23, NESG, structural g	99.73
3f9u_A		172	Putative exported cytochrome C biogenesis-related;	99.71
2ju5_A		154	Thioredoxin disulfide isomerase; protein, oxidored	99.69
3fk8_A		133	Disulphide isomerase; APC61824.1, xylella fastidio	99.51
3h7l_A		586	Endoglucanase; dehydrogenase, PSI-2, NYSGXRC, stru	99.46
2lst_A		130	Thioredoxin; structural genomics, NEW YORK structu	99.16
3k7x_A		349	LIN0763 protein; Q92DQ0, LKR23, NESG, structural g	99.41
2kuc_A		130	Putative disulphide-isomerase; structural genomics	99.4
2ahf_A		377	Unsaturated glucuronyl hydrolase; alpha6/alpha6 ba	99.32
2fwh_A		134	Thiol:disulfide interchange protein DSBD; thioredo	99.31
2zzr_A		397	Unsaturated glucuronyl hydrolase; alpha barrel; 1.	99.3
3pmm_A		382	Putative cytoplasmic protein; structural genomics,	99.27
2ec4_A		178	FAS-associated factor 1; UAS domain, protein FAF1,	99.19
3k11_A		445	Putative glycosyl hydrolase; structural genomics,	99.17
1sen_A		164	Thioredoxin-like protein P19; endoplasmic reticulu	99.16
3dml_A		116	Putative uncharacterized protein; thioredoxin, oxi	99.13
1ep7_A		112	Thioredoxin CH1, H-type; electron transport; 2.10A	99.13
1nc5_A		373	Hypothetical protein YTER; structural genomics, he	99.09
3pmm_A		382	Putative cytoplasmic protein; structural genomics,	99.09
1ti3_A		113	Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul	99.08
1nc5_A		373	Hypothetical protein YTER; structural genomics, he	99.07
2l57_A		126	Uncharacterized protein; structural genomics, unkn	99.06
3hxs_A		141	Thioredoxin, TRXP; electron transport; 2.00A {Bact	99.06
3gnj_A		111	Thioredoxin domain protein; APC92103, STR genomics	99.05
3f3q_A		109	Thioredoxin-1; His TAG, electron transport, cytopl	99.05
3zzx_A		105	Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va	99.05
2l5l_A		136	Thioredoxin; structural genomics, electron transpo	99.04
1nsw_A		105	Thioredoxin, TRX; thermostability, electron transp	99.04
1xfl_A		124	Thioredoxin H1; AT3G51030, structural genomics, pr	99.03
3tco_A		109	Thioredoxin (TRXA-1); disulfide oxidoreductase, ox	99.02
3qfa_C		116	Thioredoxin; protein-protein complex, rossmann fol	99.02
1dby_A		107	Chloroplast thioredoxin M CH2; thioredoxin CH2, ch	99.02
2vm1_A		118	Thioredoxin, thioredoxin H isoform 1.; oxidoreduct	99.01
1syr_A		112	Thioredoxin; SGPP, structural genomics, PSI, prote	99.0
2trx_A		108	Thioredoxin; electron transport; 1.68A {Escherichi	98.99
3d22_A		139	TRXH4, thioredoxin H-type; electron transport, cyt	98.99
2voc_A		112	Thioredoxin; electron transport, homodimer, disulf	98.99
1w4v_A		119	Thioredoxin, mitochondrial; antioxidant enzyme, mi	98.99
2dml_A		130	Protein disulfide-isomerase A6; thioredoxin domain	98.98
2vlu_A		122	Thioredoxin, thioredoxin H isoform 2.; oxidoreduct	98.97
3k11_A		445	Putative glycosyl hydrolase; structural genomics,	98.96
3ul3_B		128	Thioredoxin, thioredoxin-2; PTEX, oxidoreductase;	98.96
1wmj_A		130	Thioredoxin H-type; structural genomics, program f	98.95
2yzu_A		109	Thioredoxin; redox protein, electron transport, st	98.95
2i4a_A		107	Thioredoxin; acidophIle, disulfide exchange, oxido	98.95
2av4_A		160	Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI	98.94
1oaz_A		123	Thioredoxin 1; immune system, antibody/complex, an	98.94
3d6i_A		112	Monothiol glutaredoxin-3; thioredoxin-like, electr	98.94
3aps_A		122	DNAJ homolog subfamily C member 10; thioredoxin fo	98.93
3hz4_A		140	Thioredoxin; NYSGXRC, PSI-II, reduced form, protei	98.93
2f51_A		118	Thioredoxin; electron transport; 1.90A {Trichomona	98.93
1fb6_A		105	Thioredoxin M; electron transport; 2.10A {Spinacia	98.93
1t00_A		112	Thioredoxin, TRX; redox regulation, multifunction	98.92
1gh2_A		107	Thioredoxin-like protein; redox-active center, ele	98.92
2dj1_A		140	Protein disulfide-isomerase A4; protein ERP-72, ER	98.92
3m9j_A		105	Thioredoxin; oxidoreductase; 1.10A {Homo sapiens}	98.92
4euy_A		105	Uncharacterized protein; structural genomics, PSI-	98.91
3die_A		106	Thioredoxin, TRX; electron transport, SWAP domain,	98.91
3gix_A		149	Thioredoxin-like protein 4B; PRE-mRNA splicing, TX	98.9
1x5d_A		133	Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC	98.9
2j23_A		121	Thioredoxin; immune protein, autoreactivity, cross	98.9
2oe3_A		114	Thioredoxin-3; electron transport, alpha/beta sand	98.9
2o8v_B		128	Thioredoxin 1; disulfide crosslinked complex, oxid	98.89
2ppt_A		155	Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc	98.89
1xwb_A		106	Thioredoxin; dimerization, redox regulation, THI X	98.89
3p2a_A		148	Thioredoxin 2, putative thioredoxin-like protein;	98.89
1r26_A		125	Thioredoxin; redox-active disulfide, electron tran	98.88
2e0q_A		104	Thioredoxin; electron transport; 1.49A {Sulfolobus	98.88
2wz9_A		153	Glutaredoxin-3; protein binding; 1.55A {Homo sapie	98.87
1thx_A		115	Thioredoxin, thioredoxin 2; oxido-reductase, elect	98.87
2i1u_A		121	Thioredoxin, TRX, MPT46; redox protein, electron t	98.85
2vim_A		104	Thioredoxin, TRX; thioredoxin fold, oxidoreductase	98.85
2xc2_A		117	Thioredoxinn; oxidoreductase, protein disulfide re	98.84
1qgv_A		142	Spliceosomal protein U5-15KD; snRNP, thioredoxin,	98.81
1mek_A		120	Protein disulfide isomerase; electron transport, r	98.81
2dj3_A		133	Protein disulfide-isomerase A4; protein ERP-72, ER	98.8
3cxg_A		133	Putative thioredoxin; malaria, structural GEN oxid	98.79
2pu9_C		111	TRX-F, thioredoxin F-type, chloroplast; protein-pr	98.79
3apq_A		210	DNAJ homolog subfamily C member 10; thioredoxin fo	98.79
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	98.77
2l6c_A		110	Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu	98.75
3dxb_A		222	Thioredoxin N-terminally fused to PUF60(UHM); spli	98.73
1zma_A		118	Bacterocin transport accessory protein; alpha-beta	98.73
1faa_A		124	Thioredoxin F; electron transport; 1.85A {Spinacia	98.72
3uvt_A		111	Thioredoxin domain-containing protein 5; thioredox	98.7
3hcz_A		148	Possible thiol-disulfide isomerase; APC61559.2, cy	98.69
2yj7_A		106	LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti	98.14
2qsi_A		137	Putative hydrogenase expression/formation protein;	98.68
3h79_A		127	Thioredoxin-like protein; thioredoxin fold, cataly	98.68
1v98_A		140	Thioredoxin; oxidoreductase, structural genomics,	98.65
2qgv_A		140	Hydrogenase-1 operon protein HYAE; alpha-beta prot	98.65
2dj0_A		137	Thioredoxin-related transmembrane protein 2; AVLA2	98.65
2djj_A		121	PDI, protein disulfide-isomerase; thioredoxin fold	98.64
1x5e_A		126	Thioredoxin domain containing protein 1; TMX, TXND	98.63
1z6n_A		167	Hypothetical protein PA1234; alpha-beta-alpha sand	98.6
2b1k_A		168	Thiol:disulfide interchange protein DSBE; C-termin	98.6
2b5x_A		148	YKUV protein, TRXY; thioredoxin-like, oxidoreducta	98.6
3ewl_A		142	Uncharacterized conserved protein BF1870; alpha-be	98.58
4evm_A		138	Thioredoxin family protein; structural genomics, n	98.58
3idv_A		241	Protein disulfide-isomerase A4; thioredoxin-like f	98.57
1fo5_A		85	Thioredoxin; disulfide oxidoreductase, structural	98.57
3or5_A		165	Thiol:disulfide interchange protein, thioredoxin p	98.57
1lu4_A		136	Soluble secreted antigen MPT53; thioredoxin-like f	98.56
1wou_A		123	Thioredoxin -related protein, 14 kDa; electron tra	98.56
1nho_A		85	Probable thioredoxin; beta sheet, alpha helix, oxi	98.54
3raz_A		151	Thioredoxin-related protein; structural genomics,	98.54
2lja_A		152	Putative thiol-disulfide oxidoreductase; structura	98.53
3emx_A		135	Thioredoxin; structural genomics, oxidoreductase,	98.53
1zzo_A		136	RV1677; thioredoxin fold, structural genomics, PSI	98.53
3gl3_A		152	Putative thiol:disulfide interchange protein DSBE;	98.52
1a8l_A		226	Protein disulfide oxidoreductase; PDI, thioredoxin	98.49
2lrn_A		152	Thiol:disulfide interchange protein; structural ge	98.49
3erw_A		145	Sporulation thiol-disulfide oxidoreductase A; thio	98.49
2f9s_A		151	Thiol-disulfide oxidoreductase RESA; thioredoxin-l	98.48
3hdc_A		158	Thioredoxin family protein; ATCC53774, DSM 7210, ,	98.46
3kcm_A		154	Thioredoxin family protein; SGX, thioredoxin prote	98.45
3kh7_A		176	Thiol:disulfide interchange protein DSBE; TRX-like	98.45
3fkf_A		148	Thiol-disulfide oxidoreductase; structural genomic	98.45
2h30_A		164	Thioredoxin, peptide methionine sulfoxide reductas	98.42
1i5g_A		144	Tryparedoxin II; electron transport; HET: TS5; 1.4	98.41
1kng_A		156	Thiol:disulfide interchange protein CYCY; thioredo	98.4
3kp8_A		106	Vkorc1/thioredoxin domain protein; blood coagulati	98.38
3eur_A		142	Uncharacterized protein; PSI2,MCSG, conserved prot	98.38
3s9f_A		165	Tryparedoxin; thioredoxin fold, disulfide reductas	98.38
3ha9_A		165	Uncharacterized thioredoxin-like protein; PSI, MCS	98.37
3idv_A		241	Protein disulfide-isomerase A4; thioredoxin-like f	98.36
1o8x_A		146	Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot	98.36
2ls5_A		159	Uncharacterized protein; structural genomics, unkn	97.71
3q6o_A		244	Sulfhydryl oxidase 1; protein disulfide isomerase,	98.34
3lor_A		160	Thiol-disulfide isomerase and thioredoxins; PSI, M	98.34
1o73_A		144	Tryparedoxin; electron transport, trypanosomatid,	98.34
3eyt_A		158	Uncharacterized protein SPOA0173; thioredoxin-like	98.32
3ed3_A		298	Protein disulfide-isomerase MPD1; thioredoxin-like	98.31
2es7_A		142	Q8ZP25_salty, putative thiol-disulfide isomerase a	98.31
1ilo_A		77	Conserved hypothetical protein MTH895; beta-alpha-	98.31
2l5o_A		153	Putative thioredoxin; structural genomics, unknown	98.31
3h7l_A		586	Endoglucanase; dehydrogenase, PSI-2, NYSGXRC, stru	98.31
2lrt_A		152	Uncharacterized protein; structural genomics, thio	98.3
3lwa_A		183	Secreted thiol-disulfide isomerase; thioredoxin, P	98.29
2dbc_A		135	PDCL2, unnamed protein product; phosducin-like pro	98.29
1sji_A		350	Calsequestrin 2, calsequestrin, cardiac muscle iso	98.27
2ywm_A		229	Glutaredoxin-like protein; redox protein, structur	98.26
2r2j_A		382	Thioredoxin domain-containing protein 4; CRFS moti	98.26
2lus_A		143	Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci	97.55
3ia1_A		154	THIO-disulfide isomerase/thioredoxin; oxidoreducta	98.22
3iv4_A		112	Putative oxidoreductase; APC23140, meticillin-resi	98.2
3f8u_A		481	Protein disulfide-isomerase A3ERP57; endoplasmic r	98.19
2b5e_A		504	Protein disulfide-isomerase; 2.40A {Saccharomyces	98.17
3fw2_A		150	Thiol-disulfide oxidoreductase; structural genomic	98.15
4fo5_A		143	Thioredoxin-like protein; AHPC/TSA family protein,	98.15
2e7p_A		116	Glutaredoxin; thioredoxin fold, poplar, electron t	98.13
2cvb_A		188	Probable thiol-disulfide isomerase/thioredoxin; re	98.11
1jfu_A		186	Thiol:disulfide interchange protein TLPA; thioredo	98.09
3ga4_A		178	Dolichyl-diphosphooligosaccharide-protein glycosyl	98.07
3t58_A		519	Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.	98.03
1a0r_P		245	Phosducin, MEKA, PP33; transducin, beta-gamma, sig	98.02
2ywi_A		196	Hypothetical conserved protein; uncharacterized co	98.01
1ttz_A		87	Conserved hypothetical protein; structural genomic	98.01
3qcp_A		470	QSOX from trypanosoma brucei (tbqsox); ERV fold, t	98.01
3f8u_A		481	Protein disulfide-isomerase A3ERP57; endoplasmic r	97.98
2b5e_A		504	Protein disulfide-isomerase; 2.40A {Saccharomyces	97.98
3us3_A		367	Calsequestrin-1; calcium-binding protein; 1.74A {O	97.95
2hyx_A		352	Protein DIPZ; thioredoxin fold, jelly-roll, struct	97.94
3drn_A		161	Peroxiredoxin, bacterioferritin comigratory prote	97.94
2hls_A		243	Protein disulfide oxidoreductase; thioredoxin fold	97.93
2rli_A		171	SCO2 protein homolog, mitochondrial; copper protei	97.92
3u5r_E		218	Uncharacterized protein; structural genomics, PSI-	97.89
3e6u_A		411	LANC-like protein 1; alpha barrel, cytoplasm, sign	97.88
3apo_A		780	DNAJ homolog subfamily C member 10; PDI family, th	97.88
2ggt_A		164	SCO1 protein homolog, mitochondrial; copper chaper	97.85
2vup_A		190	Glutathione peroxidase-like protein; oxidoreductas	97.83
3uem_A		361	Protein disulfide-isomerase; thioredoxin-like doma	97.83
2p5q_A		170	Glutathione peroxidase 5; thioredoxin fold, oxidor	97.83
3apo_A		780	DNAJ homolog subfamily C member 10; PDI family, th	97.82
2trc_P		217	Phosducin, MEKA, PP33; transducin, beta-gamma, sig	97.81
2djk_A		133	PDI, protein disulfide-isomerase; thioredoxin fold	97.8
3cmi_A		171	Peroxiredoxin HYR1; thioredoxin-like fold, oxidore	97.75
3kij_A		180	Probable glutathione peroxidase 8; human PDI-perox	97.72
3gzk_A		537	Cellulase; fold from GH9 from CAZY database, glyco	97.7
2bmx_A		195	Alkyl hydroperoxidase C; peroxiredoxin, antioxidan	97.66
1xvw_A		160	Hypothetical protein RV2238C/MT2298; thioredoxin f	97.65
2v1m_A		169	Glutathione peroxidase; selenium, selenocysteine,	97.65
3evi_A		118	Phosducin-like protein 2; alpha beta, 3-layer(ABA)	97.64
2k8s_A		80	Thioredoxin; dimer, structural genomics, PSI-2, pr	97.62
1we0_A		187	Alkyl hydroperoxide reductase C; peroxiredoxin, AH	97.6
1ks8_A		433	Endo-B-1,4-glucanase; cellulase, endoglucanase, te	97.58
3dwv_A		187	Glutathione peroxidase-like protein; alpha beta, 3	97.57
2fgx_A		107	Putative thioredoxin; NET3, NESG, GFT-glutaredoxin	97.55
2c0g_A		248	ERP29 homolog, windbeutel protein; PDI-dbeta, PDI,	97.53
2ywm_A		229	Glutaredoxin-like protein; redox protein, structur	97.51
2jsy_A		167	Probable thiol peroxidase; solution structure, ant	97.51
1a8l_A		226	Protein disulfide oxidoreductase; PDI, thioredoxin	97.49
1zof_A		198	Alkyl hydroperoxide-reductase; decamer, toroide-sh	97.47
2p31_A		181	CL683, glutathione peroxidase 7; thioredoxin fold,	97.47
1wjk_A		100	C330018D20RIK protein; glutaredoxin, thioredoxin f	97.47
1xzo_A		174	BSSCO, hypothetical protein YPMQ; thioredoxin-like	97.46
2f8a_A		208	Glutathione peroxidase 1; thioredoxin fold, struct	97.44
1ia6_A		441	Cellulase CEL9M; cellullase, alpha barrel, hydrola	97.42
1xvq_A		175	Thiol peroxidase; thioredoxin fold, structural gen	97.41
1uul_A		202	Tryparedoxin peroxidase homologue; peroxiredoxin,	97.4
1qmv_A		197	Human thioredoxin peroxidase-B; peroxiredoxin, sul	97.37
3kp9_A		291	Vkorc1/thioredoxin domain protein; warfarin, disul	97.37
1clc_A		639	Endoglucanase CELD; EC: 3.2.1.4; cellulase, glycos	97.36
2k6v_A		172	Putative cytochrome C oxidase assembly protein; th	97.35
1zye_A		220	Thioredoxin-dependent peroxide reductase; catenane	97.33
2gs3_A		185	PHGPX, GPX-4, phospholipid hydroperoxide glutathio	97.31
2h01_A		192	2-Cys peroxiredoxin; thioredoxin peroxidase, struc	97.3
2obi_A		183	PHGPX, GPX-4, phospholipid hydroperoxide glutathio	97.28
3ztl_A		222	Thioredoxin peroxidase; oxidoreductase, reductase,	97.28
2qc7_A		240	ERP31, ERP28, endoplasmic reticulum protein ERP29;	97.28
1hyu_A		521	AHPF, alkyl hydroperoxide reductase subunit F; thi	97.26
3gkn_A		163	Bacterioferritin comigratory protein; BCP, PRX, at	97.24
4gqc_A		164	Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f	97.18
2ht9_A		146	Glutaredoxin-2; thioredoxin fold, iron-sulfur clus	97.17
2i81_A		213	2-Cys peroxiredoxin; structural genomics consortiu	97.15
4hde_A		170	SCO1/SENC family lipoprotein; structural genomics,	97.12
2v8i_A		543	Pectate lyase; periplasm, beta-elimination, pectin	97.1
1eej_A		216	Thiol:disulfide interchange protein; oxidoreductas	97.04
2cq9_A		130	GLRX2 protein, glutaredoxin 2; glutathione-S-trans	96.98
4g2e_A		157	Peroxiredoxin; redox protein, structural genomics,	96.92
2b7k_A		200	SCO1 protein; metallochaperone, cytochrome C oxida	96.92
3hd5_A		195	Thiol:disulfide interchange protein DSBA; protein	96.9
2hls_A		243	Protein disulfide oxidoreductase; thioredoxin fold	96.77
1kte_A		105	Thioltransferase; redox-active center, electron tr	96.73
3ixr_A		179	Bacterioferritin comigratory protein; alpha beta p	96.67
3gyk_A		175	27KDA outer membrane protein; APC61738.2, siliciba	96.67
3c1r_A		118	Glutaredoxin-1; oxidized form, oxidoreductase, cyt	96.65
1t3b_A		211	Thiol:disulfide interchange protein DSBC; oxidored	96.64
3h93_A		192	Thiol:disulfide interchange protein DSBA; disulfid	96.63
1psq_A		163	Probable thiol peroxidase; structural genomics, NY	96.62
3p7x_A		166	Probable thiol peroxidase; thioredoxin fold, oxido	96.6
2yik_A		611	Endoglucanase; hydrolase; 2.10A {Clostridium therm	96.59
3a2v_A		249	Probable peroxiredoxin; thioredoxin peroxidase, hy	96.58
3rhb_A		113	ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox	96.57
1ego_A		85	Glutaredoxin; electron transport; NMR {Escherichia	96.55
2c0d_A		221	Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th	96.53
1v58_A		241	Thiol:disulfide interchange protein DSBG; reduced	96.46
1tf4_A		605	T. fusca endo/EXO-cellulase E4 catalytic domain an	96.44
2hze_A		114	Glutaredoxin-1; thioredoxin fold, arsenic, dimethy	96.42
2xfg_A		466	Endoglucanase 1; hydrolase-sugar binding protein c	96.42
2g0d_A		409	Nisin biosynthesis protein NISC; alpha toroid, alp	96.41
1h75_A		81	Glutaredoxin-like protein NRDH; electron transport	96.41
3me7_A		170	Putative uncharacterized protein; electron transfe	96.34
2lqo_A		92	Putative glutaredoxin RV3198.1/MT3292; TRX fold, o	96.3
1g87_A		614	Endocellulase 9G; endoglucanase, cellulose binding	96.28
3msz_A		89	Glutaredoxin 1; alpha-beta sandwich, center for st	96.21
3nzn_A		103	Glutaredoxin; structural genomics, PSI2, MCSG, pro	96.19
3h8q_A		114	Thioredoxin reductase 3; oxidoreductase, structura	96.16
2yzh_A		171	Probable thiol peroxidase; redox protein, antioxid	96.04
1x9d_A		538	Endoplasmic reticulum mannosyl-oligosaccharide 1,	96.02
2yan_A		105	Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H	96.01
2i3y_A		215	Epididymal secretory glutathione peroxidase; thior	96.0
2ri9_A		475	Mannosyl-oligosaccharide alpha-1,2-mannosidase; al	95.99
1r7h_A		75	NRDH-redoxin; thioredoxin, glutaredoxin, redox pro	95.96
1nxc_A		478	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA;	95.95
3qpm_A		240	Peroxiredoxin; oxidoreductase, thioredoxin fold, p	95.92
2pn8_A		211	Peroxiredoxin-4; thioredoxin, oxidoreductase, stru	95.86
3keb_A		224	Probable thiol peroxidase; structural genomics, AP	95.84
1fov_A		82	Glutaredoxin 3, GRX3; active site disulfide, CIS P	95.8
2a4v_A		159	Peroxiredoxin DOT5; yeast nuclear thiol peroxidase	95.76
3uem_A		361	Protein disulfide-isomerase; thioredoxin-like doma	95.75
2r37_A		207	Glutathione peroxidase 3; plasma, structural genom	95.66
3ctg_A		129	Glutaredoxin-2; reduced form, electron transport,	95.62
1hcu_A		503	Alpha-1,2-mannosidase; glycosylation, glycosyl hyd	95.61
3hz8_A		193	Thiol:disulfide interchange protein DSBA; thiol-ox	95.55
1n8j_A		186	AHPC, alkyl hydroperoxide reductase C22 protein; p	95.53
3e6u_A		411	LANC-like protein 1; alpha barrel, cytoplasm, sign	95.46
1nxc_A		478	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA;	95.45
2rem_A		193	Disulfide oxidoreductase; disulfide oxidoreductase	95.34
1ia6_A		441	Cellulase CEL9M; cellullase, alpha barrel, hydrola	95.28
3tjj_A		254	Peroxiredoxin-4; thioredoxin fold, sulfenylation,	95.25
2klx_A		89	Glutaredoxin; thioredoxin type domain, ssgcid, ele	95.22
3ic4_A		92	Glutaredoxin (GRX-1); structural genomics, PSI, MC	95.16
1dl2_A		511	Class I alpha-1,2-mannosidase; alpha-alpha helix b	95.12
3zrd_A		200	Thiol peroxidase; oxidoreductase, 2Cys peroxiredox	95.12
1wik_A		109	Thioredoxin-like protein 2; picot homology 2 domai	95.11
3qmx_A		99	Glutaredoxin A, glutaredoxin 3; electron transport	95.05
4eo3_A		322	Bacterioferritin comigratory protein/NADH dehydro;	94.93
2znm_A		195	Thiol:disulfide interchange protein DSBA; thioredo	94.86
1dl2_A		511	Class I alpha-1,2-mannosidase; alpha-alpha helix b	94.84
3l4n_A		127	Monothiol glutaredoxin-6; C-terminal domain of GRX	94.68
1hcu_A		503	Alpha-1,2-mannosidase; glycosylation, glycosyl hyd	94.67
2khp_A		92	Glutaredoxin; thioredoxin type domain, ssgcid, ele	94.61
2ri9_A		475	Mannosyl-oligosaccharide alpha-1,2-mannosidase; al	94.46
1x9d_A		538	Endoplasmic reticulum mannosyl-oligosaccharide 1,	94.14
1nm3_A		241	Protein HI0572; hybrid, peroxiredoxin, glutaredoxi	94.11
2v2g_A		233	Peroxiredoxin 6; oxidoreductase, antioxidant enzym	93.77
2wfc_A		167	Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan	93.51
1un2_A		197	DSBA, thiol-disulfide interchange protein; disulfi	93.42
2v8i_A		543	Pectate lyase; periplasm, beta-elimination, pectin	93.3
1tp9_A		162	Peroxiredoxin, PRX D (type II); oligomer, thioredo	92.86
1ks8_A		433	Endo-B-1,4-glucanase; cellulase, endoglucanase, te	92.7
1w6k_A		732	Lanosterol synthase; cyclase, cholesterol, monotop	92.19
1prx_A		224	HORF6; peroxiredoxin, hydrogen peroxide, redox reg	92.18
2wci_A		135	Glutaredoxin-4; redox-active center, iron-sulfur c	92.15
3uma_A		184	Hypothetical peroxiredoxin protein; nysgrc, PSI bi	92.15
3gv1_A		147	Disulfide interchange protein; neisseria gonorrhoe	91.97
3zyw_A		111	Glutaredoxin-3; metal binding protein; 1.84A {Homo	91.76
1q98_A		165	Thiol peroxidase, TPX; structural genomics, NYSGXR	91.57
1xcc_A		220	1-Cys peroxiredoxin; unknown function, structural	91.57
1z6m_A		175	Conserved hypothetical protein; structural genomic	91.55
3ipz_A		109	Monothiol glutaredoxin-S14, chloroplastic; electro	91.38
3mng_A		173	Peroxiredoxin-5, mitochondrial; peroxidase, PRXV,	90.99
3gx8_A		121	Monothiol glutaredoxin-5, mitochondrial; TRX fold,	90.7
1wzz_A		334	Probable endoglucanase; glycoside hydrolase family	90.31
2g0d_A		409	Nisin biosynthesis protein NISC; alpha toroid, alp	89.91
3sbc_A		216	Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c	89.87
2wem_A		118	Glutaredoxin-related protein 5; chromosome 14 open	89.85
1aba_A		87	Glutaredoxin; electron transport; HET: MES; 1.45A	89.69
1ut9_A		609	Cellulose 1,4-beta-cellobiosidase; hydrolase, glyc	89.43
1nm3_A		241	Protein HI0572; hybrid, peroxiredoxin, glutaredoxi	87.96
1t1v_A		93	SH3BGRL3, SH3 domain-binding glutamic acid-rich pr	87.77
3l9v_A		189	Putative thiol-disulfide isomerase or thioredoxin;	86.84
2pwj_A		171	Mitochondrial peroxiredoxin; alpha and beta protei	86.81
3tue_A		219	Tryparedoxin peroxidase; thioredoxin fold, peroxir	86.59
3gzk_A		537	Cellulase; fold from GH9 from CAZY database, glyco	86.56
1clc_A		639	Endoglucanase CELD; EC: 3.2.1.4; cellulase, glycos	85.12
2ct6_A		111	SH3 domain-binding glutamic acid-rich-like protein	84.83
1ut9_A		609	Cellulose 1,4-beta-cellobiosidase; hydrolase, glyc	83.37
2sqc_A		631	Squalene-hopene cyclase; isomerase, triterpene cyc	83.13
3feu_A		185	Putative lipoprotein; alpha-beta structure, struct	82.53
2xfg_A		466	Endoglucanase 1; hydrolase-sugar binding protein c	82.33

>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei}	Back alignment and structure

Probab=100.00  E-value=3e-45  Score=367.53  Aligned_cols=168  Identities=52%  Similarity=1.035  Sum_probs=163.4

Q ss_pred             cccccccCCChhhhhccCCCccCccchHHHHHHHHhcCCCEEEEEeccCChhhhhhhhcccCCHHHHHHHhcCeEEEEEc
Q 003115          101 HTNRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVD  180 (846)
Q Consensus       101 ~~NrL~~e~SpYL~~ha~~~v~W~~~~~eAl~~Ak~e~KpI~l~~g~~wC~wC~~me~etf~d~eVa~~ln~~FV~vkvD  180 (846)
                      ++|||++|+||||||||+|||+|++|+++++++|+++||||||+|+|+||+|||+|+.++|++++|++.+|++||.||||
T Consensus         2 ~~n~l~~~~spyl~~ha~~~v~W~~~~~ea~~~A~~~~KpVlvdF~A~WC~~Ck~m~~~~f~~~~va~~l~~~fv~ikVD   81 (173)
T 3ira_A            2 EPNRLIKEKSPYLLQHAYNPVDWYPWGEEAFEKARKENKPVFLSIGYSTCHWCHMMAHESFEDEEVAGLMNEAFVSIKVD   81 (173)
T ss_dssp             CCCGGGGCCCHHHHTTTTSSSCCBCSSHHHHHHHHHHTCCEEEEEECTTCHHHHHHHHHTTTCHHHHHHHHHHCEEEEEE
T ss_pred             CCcccccCCCHHHHhccCCCCCCCCcCHHHHHHHHHhCCCEEEecccchhHhhccccccccCCHHHHHHHHhcCceeeeC
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCccHHHHHHHHHHHhcCCCCCCcEEEECCCCceeccccccCCCCCCCcccHHHHHHHHHHHHHHcHHHHHHHHHHHH
Q 003115          181 REERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAI  260 (846)
Q Consensus       181 ~ee~p~~~~~y~~~~~~~~g~~G~P~~v~l~pdg~~~~~~tY~p~~~~~~~~~f~~~L~~i~~~~~~~~~~~~~~a~~~~  260 (846)
                      ++++|++++.||.++|.++|++|||++||++|+|++++++||+|+++.+++++|.++|+++.+.|+++|++|++.|.+|.
T Consensus        82 ~de~~~l~~~y~~~~q~~~gv~g~Pt~v~l~~dG~~v~~~ty~p~~~~~~~~~f~~~L~~v~~~~~~~~~~~~~~~~~~~  161 (173)
T 3ira_A           82 REERPDIDNIYMTVCQIILGRGGWPLNIIMTPGKKPFFAGTYIPKNTRFNQIGMLELVPRIKEIWEQQHEEVLDSAEKIT  161 (173)
T ss_dssp             TTTCHHHHHHHHHHHHHHHSCCCSSEEEEECTTSCEEEEESSCCSSCBTTBCCHHHHHHHHHHHHHHSHHHHHHHHHHTC
T ss_pred             CcccCcHHHHHHHHHHHHcCCCCCcceeeECCCCCceeeeeeCCCCcCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhh
Q 003115          261 EQLSEALS  268 (846)
Q Consensus       261 ~~l~~~~~  268 (846)
                      ++|++...
T Consensus       162 ~~~~~~~~  169 (173)
T 3ira_A          162 STIQEMIK  169 (173)
T ss_dssp             SHHHHHHH
T ss_pred             HHHHHhhc
Confidence            99987543

PyMOL of 3ira

>2gz6_A N-acetyl-D-glucosamine 2-epimerase; anabaena SP. CH1, isomer; 2.00A {Anabaena SP}	Back alignment and structure

>1fp3_A N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barrel, isomer; 2.00A {Sus scrofa} SCOP: a.102.1.3	Back alignment and structure

>2zbl_A Putative isomerase; N-acyl-D-glucosamine 2-epimerase protein family; HET: BMA; 1.60A {Salmonella typhimurium} PDB: 2afa_A 2rgk_A*	Back alignment and structure

>3gt5_A N-acetylglucosamine 2-epimerase; structural genomics, isomerase, PSI-2; 1.70A {Xylella fastidiosa}	Back alignment and structure

>1fp3_A N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barrel, isomer; 2.00A {Sus scrofa} SCOP: a.102.1.3	Back alignment and structure

>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24	Back alignment and structure

>2zbl_A Putative isomerase; N-acyl-D-glucosamine 2-epimerase protein family; HET: BMA; 1.60A {Salmonella typhimurium} PDB: 2afa_A 2rgk_A*	Back alignment and structure

>2gz6_A N-acetyl-D-glucosamine 2-epimerase; anabaena SP. CH1, isomer; 2.00A {Anabaena SP}	Back alignment and structure

>2zzr_A Unsaturated glucuronyl hydrolase; alpha barrel; 1.75A {Streptococcus agalactiae} PDB: 3anj_A 3ank_A* 3ani_A*	Back alignment and structure

>2ahf_A Unsaturated glucuronyl hydrolase; alpha6/alpha6 barrel, glycoside hydrolase family 88; 1.52A {Bacillus SP} PDB: 2ahg_A* 2fv0_A* 2fv1_A* 2d5j_A 1vd5_A 2fuz_A	Back alignment and structure

>3gt5_A N-acetylglucosamine 2-epimerase; structural genomics, isomerase, PSI-2; 1.70A {Xylella fastidiosa}	Back alignment and structure

>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A	Back alignment and structure

>3k7x_A LIN0763 protein; Q92DQ0, LKR23, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.89A {Listeria innocua}	Back alignment and structure

>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343}	Back alignment and structure

>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae}	Back alignment and structure

>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa}	Back alignment and structure

>3h7l_A Endoglucanase; dehydrogenase, PSI-2, NYSGXRC, structural GEN protein structure initiative; 2.30A {Vibrio parahaemolyticus}	Back alignment and structure

>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus}	Back alignment and structure

>3k7x_A LIN0763 protein; Q92DQ0, LKR23, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.89A {Listeria innocua}	Back alignment and structure

>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron}	Back alignment and structure

>2ahf_A Unsaturated glucuronyl hydrolase; alpha6/alpha6 barrel, glycoside hydrolase family 88; 1.52A {Bacillus SP} PDB: 2ahg_A* 2fv0_A* 2fv1_A* 2d5j_A 1vd5_A 2fuz_A	Back alignment and structure

>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A	Back alignment and structure

>2zzr_A Unsaturated glucuronyl hydrolase; alpha barrel; 1.75A {Streptococcus agalactiae} PDB: 3anj_A 3ank_A* 3ani_A*	Back alignment and structure

>3pmm_A Putative cytoplasmic protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.90A {Klebsiella pneumoniae subsp} PDB: 3qwt_A	Back alignment and structure

>2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3k11_A Putative glycosyl hydrolase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MSE MES; 1.80A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A	Back alignment and structure

>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A*	Back alignment and structure

>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A	Back alignment and structure

>1nc5_A Hypothetical protein YTER; structural genomics, helix barrel, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: a.102.1.6 PDB: 2d8l_A* 2gh4_A*	Back alignment and structure

>3pmm_A Putative cytoplasmic protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.90A {Klebsiella pneumoniae subsp} PDB: 3qwt_A	Back alignment and structure

>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1	Back alignment and structure

>1nc5_A Hypothetical protein YTER; structural genomics, helix barrel, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: a.102.1.6 PDB: 2d8l_A* 2gh4_A*	Back alignment and structure

>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens}	Back alignment and structure

>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A	Back alignment and structure

>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0	Back alignment and structure

>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B	Back alignment and structure

>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei}	Back alignment and structure

>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus}	Back alignment and structure

>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A	Back alignment and structure

>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1	Back alignment and structure

>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0	Back alignment and structure

>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C*	Back alignment and structure

>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1	Back alignment and structure

>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A	Back alignment and structure

>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1	Back alignment and structure

>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ...	Back alignment and structure

>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A	Back alignment and structure

>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A	Back alignment and structure

>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A	Back alignment and structure

>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A*	Back alignment and structure

>3k11_A Putative glycosyl hydrolase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MSE MES; 1.80A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum}	Back alignment and structure

>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa}	Back alignment and structure

>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A	Back alignment and structure

>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti}	Back alignment and structure

>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii}	Back alignment and structure

>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1	Back alignment and structure

>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae}	Back alignment and structure

>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus}	Back alignment and structure

>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei}	Back alignment and structure

>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis}	Back alignment and structure

>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C	Back alignment and structure

>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor}	Back alignment and structure

>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1	Back alignment and structure

>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ...	Back alignment and structure

>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus}	Back alignment and structure

>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A	Back alignment and structure

>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A	Back alignment and structure

>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis}	Back alignment and structure

>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A	Back alignment and structure

>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli}	Back alignment and structure

>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus}	Back alignment and structure

>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A	Back alignment and structure

>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis}	Back alignment and structure

>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1	Back alignment and structure

>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A	Back alignment and structure

>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A	Back alignment and structure

>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1	Back alignment and structure

>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A	Back alignment and structure

>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica}	Back alignment and structure

>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A	Back alignment and structure

>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A	Back alignment and structure

>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2	Back alignment and structure

>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum}	Back alignment and structure

>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A	Back alignment and structure

>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus}	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A	Back alignment and structure

>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157}	Back alignment and structure

>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1	Back alignment and structure

>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1	Back alignment and structure

>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A	Back alignment and structure

>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii}	Back alignment and structure

>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct}	Back alignment and structure

>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris}	Back alignment and structure

>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0	Back alignment and structure

>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus}	Back alignment and structure

>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A	Back alignment and structure

>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A	Back alignment and structure

>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A	Back alignment and structure

>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A	Back alignment and structure

>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A	Back alignment and structure

>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis}	Back alignment and structure

>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae}	Back alignment and structure

>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A	Back alignment and structure

>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1	Back alignment and structure

>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0	Back alignment and structure

>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10	Back alignment and structure

>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A	Back alignment and structure

>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1	Back alignment and structure

>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B}	Back alignment and structure

>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus}	Back alignment and structure

>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix}	Back alignment and structure

>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A	Back alignment and structure

>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls}	Back alignment and structure

>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A	Back alignment and structure

>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP}	Back alignment and structure

>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0	Back alignment and structure

>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A	Back alignment and structure

>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15}	Back alignment and structure

>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15}	Back alignment and structure

>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A	Back alignment and structure

>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis}	Back alignment and structure

>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A	Back alignment and structure

>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A	Back alignment and structure

>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10	Back alignment and structure

>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP}	Back alignment and structure

>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis}	Back alignment and structure

>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major}	Back alignment and structure

>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix}	Back alignment and structure

>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A	Back alignment and structure

>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A	Back alignment and structure

>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron}	Back alignment and structure

>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens}	Back alignment and structure

>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum}	Back alignment and structure

>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10	Back alignment and structure

>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi}	Back alignment and structure

>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A	Back alignment and structure

>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1	Back alignment and structure

>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>3h7l_A Endoglucanase; dehydrogenase, PSI-2, NYSGXRC, structural GEN protein structure initiative; 2.30A {Vibrio parahaemolyticus}	Back alignment and structure

>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus}	Back alignment and structure

>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum}	Back alignment and structure

>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A	Back alignment and structure

>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A	Back alignment and structure

>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens}	Back alignment and structure

>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda}	Back alignment and structure

>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus}	Back alignment and structure

>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp}	Back alignment and structure

>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A	Back alignment and structure

>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A	Back alignment and structure

>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis}	Back alignment and structure

>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A	Back alignment and structure

>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A	Back alignment and structure

>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10	Back alignment and structure

>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A*	Back alignment and structure

>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A*	Back alignment and structure

>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C	Back alignment and structure

>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus}	Back alignment and structure

>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A	Back alignment and structure

>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A*	Back alignment and structure

>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A	Back alignment and structure

>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A	Back alignment and structure

>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A	Back alignment and structure

>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis}	Back alignment and structure

>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0	Back alignment and structure

>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix}	Back alignment and structure

>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens}	Back alignment and structure

>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti}	Back alignment and structure

>3e6u_A LANC-like protein 1; alpha barrel, cytoplasm, signaling protein; 2.60A {Homo sapiens} PDB: 3e73_A*	Back alignment and structure

>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus}	Back alignment and structure

>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A	Back alignment and structure

>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei}	Back alignment and structure

>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A	Back alignment and structure

>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A	Back alignment and structure

>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus}	Back alignment and structure

>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6	Back alignment and structure

>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A	Back alignment and structure

>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae}	Back alignment and structure

>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A	Back alignment and structure

>3gzk_A Cellulase; fold from GH9 from CAZY database, glycosidase, hydrolase; 1.80A {Alicyclobacillus acidocaldarius subsp} PDB: 3ez8_A 3h2w_A* 3h3k_A* 3rx5_A* 3rx7_A* 3rx8_A*	Back alignment and structure

>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10	Back alignment and structure

>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A	Back alignment and structure

>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A	Back alignment and structure

>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens}	Back alignment and structure

>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea}	Back alignment and structure

>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10	Back alignment and structure

>1ks8_A Endo-B-1,4-glucanase; cellulase, endoglucanase, termite, glycosyl hydrolase, family 9, (alpha/alpha)6; 1.40A {Nasutitermes takasagoensis} SCOP: a.102.1.2 PDB: 1ksc_A 1ksd_A	Back alignment and structure

>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A	Back alignment and structure

>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea}	Back alignment and structure

>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A	Back alignment and structure

>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A	Back alignment and structure

>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A	Back alignment and structure

>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A	Back alignment and structure

>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10	Back alignment and structure

>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens}	Back alignment and structure

>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1	Back alignment and structure

>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A	Back alignment and structure

>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A	Back alignment and structure

>1ia6_A Cellulase CEL9M; cellullase, alpha barrel, hydrolase; 1.80A {Clostridium cellulolyticum} SCOP: a.102.1.2 PDB: 1ia7_A*	Back alignment and structure

>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A	Back alignment and structure

>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10	Back alignment and structure

>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP}	Back alignment and structure

>1clc_A Endoglucanase CELD; EC: 3.2.1.4; cellulase, glycosyl hydrolase; 1.90A {Clostridium thermocellum} SCOP: a.102.1.2 b.1.18.2	Back alignment and structure

>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus}	Back alignment and structure

>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10	Back alignment and structure

>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens}	Back alignment and structure

>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10	Back alignment and structure

>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens}	Back alignment and structure

>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D	Back alignment and structure

>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A	Back alignment and structure

>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A	Back alignment and structure

>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A	Back alignment and structure

>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A	Back alignment and structure

>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A*	Back alignment and structure

>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A	Back alignment and structure

>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis}	Back alignment and structure

>2v8i_A Pectate lyase; periplasm, beta-elimination, pectin degradation; 1.50A {Yersinia enterocolitica} PDB: 2v8k_A* 2v8j_A	Back alignment and structure

>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A	Back alignment and structure

>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A	Back alignment and structure

>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A	Back alignment and structure

>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis}	Back alignment and structure

>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix}	Back alignment and structure

>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A*	Back alignment and structure

>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa}	Back alignment and structure

>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi}	Back alignment and structure

>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A*	Back alignment and structure

>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1	Back alignment and structure

>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0	Back alignment and structure

>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10	Back alignment and structure

>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0	Back alignment and structure

>2yik_A Endoglucanase; hydrolase; 2.10A {Clostridium thermocellum}	Back alignment and structure

>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A	Back alignment and structure

>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A*	Back alignment and structure

>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A	Back alignment and structure

>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum}	Back alignment and structure

>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A	Back alignment and structure

>1tf4_A T. fusca endo/EXO-cellulase E4 catalytic domain and cellulose-binding domain; glycosyl hydrolase, cellulose degradation; 1.90A {Thermobifida fusca} SCOP: a.102.1.2 b.2.2.2 PDB: 1js4_A 3tf4_A* 4tf4_A*	Back alignment and structure

>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B	Back alignment and structure

>2xfg_A Endoglucanase 1; hydrolase-sugar binding protein complex, family-9 glycoside hydrolase, hydrolase, sugar binding protein; 1.68A {Clostridium thermocellum}	Back alignment and structure

>2g0d_A Nisin biosynthesis protein NISC; alpha toroid, alpha barrel, biosynthetic protein; 2.21A {Lactococcus lactis subsp} SCOP: a.102.6.1 PDB: 2g02_A	Back alignment and structure

>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1	Back alignment and structure

>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A	Back alignment and structure

>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis}	Back alignment and structure

>1g87_A Endocellulase 9G; endoglucanase, cellulose binding domain, (ALPH 6-helix barrel, beta barrel, hydrolase; 1.60A {Clostridium cellulolyticum} SCOP: a.102.1.2 b.2.2.2 PDB: 1ga2_A* 1k72_A* 1kfg_A*	Back alignment and structure

>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A*	Back alignment and structure

>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei}	Back alignment and structure

>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0	Back alignment and structure

>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus}	Back alignment and structure

>1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A	Back alignment and structure

>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens}	Back alignment and structure

>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens}	Back alignment and structure

>2ri9_A Mannosyl-oligosaccharide alpha-1,2-mannosidase; alternative conformations, modulation of activity, glycoprot glycosidase, hydrolase; HET: NAG NDG MAN MMA; 1.95A {Penicillium citrinum} SCOP: a.102.2.1 PDB: 2ri8_A* 1kkt_A* 1kre_A* 1krf_A*	Back alignment and structure

>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1	Back alignment and structure

>1nxc_A Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA; glycosidase, structural genomics, PSI, protein initiative; HET: NAG BMA MAN; 1.51A {Mus musculus} SCOP: a.102.2.1	Back alignment and structure

>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea}	Back alignment and structure

>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens}	Back alignment and structure

>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum}	Back alignment and structure

>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A*	Back alignment and structure

>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10	Back alignment and structure

>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A	Back alignment and structure

>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens}	Back alignment and structure

>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A*	Back alignment and structure

>1hcu_A Alpha-1,2-mannosidase; glycosylation, glycosyl hydrolase; HET: NAG; 2.37A {Trichoderma reesei} SCOP: a.102.2.1	Back alignment and structure

>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A	Back alignment and structure

>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A	Back alignment and structure

>3e6u_A LANC-like protein 1; alpha barrel, cytoplasm, signaling protein; 2.60A {Homo sapiens} PDB: 3e73_A*	Back alignment and structure

>1nxc_A Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA; glycosidase, structural genomics, PSI, protein initiative; HET: NAG BMA MAN; 1.51A {Mus musculus} SCOP: a.102.2.1	Back alignment and structure

>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa}	Back alignment and structure

>1ia6_A Cellulase CEL9M; cellullase, alpha barrel, hydrolase; 1.80A {Clostridium cellulolyticum} SCOP: a.102.1.2 PDB: 1ia7_A*	Back alignment and structure

>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C	Back alignment and structure

>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae}	Back alignment and structure

>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus}	Back alignment and structure

>1dl2_A Class I alpha-1,2-mannosidase; alpha-alpha helix barrel, hydrolase; HET: NAG NDG BMA MAN; 1.54A {Saccharomyces cerevisiae} SCOP: a.102.2.1 PDB: 1g6i_A*	Back alignment and structure

>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A	Back alignment and structure

>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1	Back alignment and structure

>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0	Back alignment and structure

>4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima}	Back alignment and structure

>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A	Back alignment and structure

>1dl2_A Class I alpha-1,2-mannosidase; alpha-alpha helix barrel, hydrolase; HET: NAG NDG BMA MAN; 1.54A {Saccharomyces cerevisiae} SCOP: a.102.2.1 PDB: 1g6i_A*	Back alignment and structure

>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae}	Back alignment and structure

>1hcu_A Alpha-1,2-mannosidase; glycosylation, glycosyl hydrolase; HET: NAG; 2.37A {Trichoderma reesei} SCOP: a.102.2.1	Back alignment and structure

>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis}	Back alignment and structure

>2ri9_A Mannosyl-oligosaccharide alpha-1,2-mannosidase; alternative conformations, modulation of activity, glycoprot glycosidase, hydrolase; HET: NAG NDG MAN MMA; 1.95A {Penicillium citrinum} SCOP: a.102.2.1 PDB: 2ri8_A* 1kkt_A* 1kre_A* 1krf_A*	Back alignment and structure

>1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A	Back alignment and structure

>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10	Back alignment and structure

>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A	Back alignment and structure

>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina}	Back alignment and structure

>1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13	Back alignment and structure

>2v8i_A Pectate lyase; periplasm, beta-elimination, pectin degradation; 1.50A {Yersinia enterocolitica} PDB: 2v8k_A* 2v8j_A	Back alignment and structure

>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10	Back alignment and structure

>1ks8_A Endo-B-1,4-glucanase; cellulase, endoglucanase, termite, glycosyl hydrolase, family 9, (alpha/alpha)6; 1.40A {Nasutitermes takasagoensis} SCOP: a.102.1.2 PDB: 1ksc_A 1ksd_A	Back alignment and structure

>1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A*	Back alignment and structure

>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10	Back alignment and structure

>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A	Back alignment and structure

>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti}	Back alignment and structure

>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae}	Back alignment and structure

>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens}	Back alignment and structure

>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10	Back alignment and structure

>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A	Back alignment and structure

>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13	Back alignment and structure

>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A	Back alignment and structure

>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A	Back alignment and structure

>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae}	Back alignment and structure

>1wzz_A Probable endoglucanase; glycoside hydrolase family 8 (GH-8), (alpha/alpha)6 barrel, structural genomics; 1.65A {Gluconacetobacter xylinus} SCOP: a.102.1.2	Back alignment and structure

>2g0d_A Nisin biosynthesis protein NISC; alpha toroid, alpha barrel, biosynthetic protein; 2.21A {Lactococcus lactis subsp} SCOP: a.102.6.1 PDB: 2g02_A	Back alignment and structure

>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A	Back alignment and structure

>1ut9_A Cellulose 1,4-beta-cellobiosidase; hydrolase, glycoside hydrolase, family 9, cellobiohydrolase; 2.1A {Clostridium thermocellum} SCOP: a.102.1.2 b.1.18.2 PDB: 1rq5_A*	Back alignment and structure

>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10	Back alignment and structure

>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A	Back alignment and structure

>3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0	Back alignment and structure

>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum}	Back alignment and structure

>3tue_A Tryparedoxin peroxidase; thioredoxin fold, peroxiredoxin, oxidoreductase; 3.00A {Leishmania major} PDB: 1e2y_A	Back alignment and structure

>3gzk_A Cellulase; fold from GH9 from CAZY database, glycosidase, hydrolase; 1.80A {Alicyclobacillus acidocaldarius subsp} PDB: 3ez8_A 3h2w_A* 3h3k_A* 3rx5_A* 3rx7_A* 3rx8_A*	Back alignment and structure

>1clc_A Endoglucanase CELD; EC: 3.2.1.4; cellulase, glycosyl hydrolase; 1.90A {Clostridium thermocellum} SCOP: a.102.1.2 b.1.18.2	Back alignment and structure

>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1ut9_A Cellulose 1,4-beta-cellobiosidase; hydrolase, glycoside hydrolase, family 9, cellobiohydrolase; 2.1A {Clostridium thermocellum} SCOP: a.102.1.2 b.1.18.2 PDB: 1rq5_A*	Back alignment and structure

>2sqc_A Squalene-hopene cyclase; isomerase, triterpene cyclase, monotopic membrane protein, QW-sequence, repeat; HET: C8E; 2.00A {Alicyclobacillus acidocaldarius} SCOP: a.102.4.2 a.102.4.2 PDB: 3sqc_A 1ump_A* 1h35_A* 1h36_A* 1h37_A* 1h39_A* 1h3a_A* 1h3b_A* 1h3c_A* 1o6h_A* 1o6q_A* 1gsz_A* 1o79_A* 1sqc_A* 1o6r_A*	Back alignment and structure

>3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0	Back alignment and structure

>2xfg_A Endoglucanase 1; hydrolase-sugar binding protein complex, family-9 glycoside hydrolase, hydrolase, sugar binding protein; 1.68A {Clostridium thermocellum}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		846
d1fp3a_		402	a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {P	4e-32
d1sena_		135	c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19	5e-21
d2afaa1		411	a.102.1.3 (A:4-415) Putative NAG isomerase YihS {S	1e-16
d2dlxa1		147	c.47.1.24 (A:1-147) UBX domain-containing protein	1e-12
d2c42a1		257	c.36.1.8 (A:2-258) Pyruvate-ferredoxin oxidoreduct	2e-04

>d1fp3a_ a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) [TaxId: 9823]} Length = 402	Back information, alignment and structure


class: All alpha proteins
fold: alpha/alpha toroid
superfamily: Six-hairpin glycosidases
family: N-acylglucosamine (NAG) epimerase
domain: N-acyl-D-glucosamine 2-epimerase
species: Pig (Sus scrofa) [TaxId: 9823]

 Score =  127 bits (319), Expect = 4e-32
 Identities = 44/403 (10%), Positives = 93/403 (23%), Gaps = 71/403 (17%)

Query: 292 LSKSYDSRFGGF-------GSAPKFPRPVEIQM-MLYHSKKLEDTGKSGEASEGQKMVLF 343
           L  S+D   GGF       G      + V +Q   ++   +L    +     E       
Sbjct: 27  LEHSHDREHGGFFTCLGRDGRVYDDLKYVWLQGRQVWMYCRLYRKLERFHRPELLDAAKA 86

Query: 344 TLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSY 403
             + + +             + +         ++ ++ +        + + +T +  Y  
Sbjct: 87  GGEFLLRHARVAPPEKKCA-FVLTRDGRPVKVQRSIFSECFYTMAMNELWRVTAEARYQS 145

Query: 404 ICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAIL 463
              D++D +   +      +   +   +          E          + + LGE    
Sbjct: 146 EAVDMMDQIVHWVREDPSGLGRPQLPGA-------VASESMAVPMMLLCLVEQLGEEDEE 198

Query: 464 FKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRR 523
               Y     G+    R+                                          
Sbjct: 199 LAGRY--AQLGHWCARRILQHVQRDGQ-------------------------------AV 225

Query: 524 KLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYME 583
                           +     + L    F              +        D K    
Sbjct: 226 LENVSEDGEELSGCLGRHQNPGHALEAGWF--------------LLRHSSRSGDAKLRAH 271

Query: 584 VAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDD-------YAFLISGLLDLYEFG 636
           V ++      R  +D   H     F++     P  L+        ++  +   L  Y   
Sbjct: 272 VIDTFLLLPFRSGWDAD-HGGLFYFQDADGLCPTQLEWAMKLWWPHSEAMIAFLMGYSES 330

Query: 637 SGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVK 679
                L    ++       F D E G +F     +  V L +K
Sbjct: 331 GDPALLRLFYQVAEYTFRQFRDPEYGEWFGYLNREGKVALTIK 373

PyMOL of d1fp3a_

>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Length = 135	Back information, alignment and structure

>d2afaa1 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]} Length = 411	Back information, alignment and structure

>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 147	Back information, alignment and structure

>d2c42a1 c.36.1.8 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]} Length = 257	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		846
d1fp3a_		402	N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa)	100.0
d2afaa1		411	Putative NAG isomerase YihS {Salmonella typhimuriu	99.94
d2dlxa1		147	UBX domain-containing protein 7 {Human (Homo sapie	99.82
d1sena_		135	Thioredoxin-like protein p19, TLP19 {Human (Homo s	99.8
d1fp3a_		402	N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa)	99.76
d2fwha1		117	Thiol:disulfide interchange protein DsbD, C-termin	99.61
d2afaa1		411	Putative NAG isomerase YihS {Salmonella typhimuriu	99.49
d1ep7a_		112	Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305	99.24
d1xfla_		114	Thioredoxin {Thale cress (Arabidopsis thaliana) [T	99.18
d2d5ja1		377	Unsaturated glucuronyl hydrolase {Bacillus sp. GL1	99.17
d1dbya_		107	Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305	99.13
d1ti3a_		113	Thioredoxin {European aspen (Populus tremula), thi	99.12
d1qgva_		137	spliceosomal protein U5-15Kd {Human (Homo sapiens)	99.11
d1nw2a_		105	Thioredoxin {Alicyclobacillus acidocaldarius, form	99.08
d2trxa_		108	Thioredoxin {Escherichia coli [TaxId: 562]}	99.08
d1thxa_		108	Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]}	99.02
d1fb6a_		104	Thioredoxin {Spinach (Spinacia oleracea), thioredo	98.98
d2ifqa1		105	Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}	98.97
d1xwaa_		111	Thioredoxin {Fruit fly (Drosophila melanogaster) [	98.95
d1a8la2		107	Protein disulfide isomerase, PDI {Archaeon Pyrococ	98.88
d1syra_		103	Thioredoxin {Malarial parasite (Plasmodium falcipa	98.85
d1r26a_		113	Thioredoxin {Trypanosoma brucei [TaxId: 5691]}	98.81
d1z5ye1		136	Thioredoxin-like protein CcmG (CycY, DsbE) {Escher	98.8
d1nc5a_		363	Hypothetical protein YteR {Bacillus subtilis [TaxI	98.79
d1meka_		120	Protein disulfide isomerase, PDI {Human (Homo sapi	98.73
d1gh2a_		107	Thioredoxin-like protein, N-terminal domain {Human	98.7
d1fo5a_		85	MJ0307, thioredoxin/glutaredoxin-like protein {Arc	98.68
d1f9ma_		112	Thioredoxin {Spinach (Spinacia oleracea), thioredo	98.67
d2d5ja1		377	Unsaturated glucuronyl hydrolase {Bacillus sp. GL1	98.66
d2b5ea4		119	Protein disulfide isomerase, PDI {Baker's yeast (S	98.64
d1zmaa1		115	Bacterocin transport accessory protein Bta {Strept	98.57
d1woua_		119	Putative 42-9-9 protein (thioredoxin containing pr	98.47
d2es7a1		119	Hydrogenase-1 operon protein HyaE {Salmonella typh	98.42
d1hyua4		96	Alkyl hydroperoxide reductase subunit F (AhpF), N-	98.41
d2hfda1		132	Hydrogenase-1 operon protein HyaE {Escherichia col	98.41
d1nhoa_		85	MTH807, thioredoxin/glutaredoxin-like protein {Arc	98.31
d1zzoa1		134	Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI	98.3
d1knga_		144	Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr	98.29
d1lu4a_		134	Soluble secreted antigen MPT53 {Mycobacterium tube	98.29
d1o73a_		144	Tryparedoxin I {Trypanosoma brucei brucei [TaxId:	98.19
d2fy6a1		143	Peptide methionine sulfoxide reductase MsrA/MsrB,	98.19
d1i5ga_		144	Tryparedoxin II {Crithidia fasciculata [TaxId: 565	98.18
d1st9a_		137	Thiol-disulfide oxidoreductase ResA {Bacillus subt	98.13
d1o8xa_		144	Tryparedoxin I {Crithidia fasciculata [TaxId: 5656	98.1
d2b5xa1		143	thiol:disulfide oxidoreductase YkuV {Bacillus subt	98.09
d1jfua_		176	Membrane-anchored thioredoxin-like protein TlpA, s	98.06
d2djja1		116	Protein disulfide isomerase, PDI {Fungi (Humicola	98.05
d1a8ya1		124	Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax	98.01
d1nc5a_		363	Hypothetical protein YteR {Bacillus subtilis [TaxI	97.93
d2c0ga2		122	Windbeutel, N-terminal domain {Fruit fly (Drosophi	97.86
d2b5ea1		140	Protein disulfide isomerase, PDI {Baker's yeast (S	97.84
d2cvba1		187	Probable thiol-disulfide isomerase/thioredoxin TTH	97.82
d1ia6a_		431	Nonprocessive cellulase Cel9M {Clostridium cellulo	97.73
d1ks8a_		433	Endo-b-1,4-glucanase {Termite (Nasutitermes takasa	97.55
d1wjka_		100	Thioredoxin-like structure containing protein C330	97.52
d1g87a1		454	Endo/exocellulase:cellobiose E-4, N-terminal domai	97.47
d1clca1		441	CelD cellulase, C-terminal domain {Clostridium the	97.25
d1z6na1		166	Hypothetical protein PA1234 {Pseudomonas aeruginos	97.18
d2cx4a1		160	Bacterioferritin comigratory protein {Archaeon Aer	97.1
d1ut9a1		511	Cellulose 1,4-beta-cellobiosidase CbhA {Clostridiu	96.83
d1tf4a1		460	Endo/exocellulase:cellobiose E-4, N-terminal domai	96.75
d1g7ea_		122	Endoplasmic reticulum protein ERP29, N-terminal do	96.68
d1nxca_		467	Class I alpha-1;2-mannosidase, catalytic domain {M	96.41
d2bmxa1		169	Alkyl hydroperoxide reductase AhpC {Mycobacterium	96.19
d1x9da1		453	Class I alpha-1;2-mannosidase, catalytic domain {H	96.01
d1eeja1		156	Disulfide bond isomerase, DsbC, C-terminal domain	96.01
d1xzoa1		172	Thioredoxin-like protein Sco1 (YpmQ), soluble doma	96.01
d2trcp_		217	Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]}	95.95
d1dl2a_		511	Class I alpha-1;2-mannosidase, catalytic domain {B	95.91
d1t3ba1		150	Disulfide bond isomerase, DsbC, C-terminal domain	95.9
d1hcua_		488	Class I alpha-1;2-mannosidase, catalytic domain {T	95.72
d1nxca_		467	Class I alpha-1;2-mannosidase, catalytic domain {M	95.7
d1x9da1		453	Class I alpha-1;2-mannosidase, catalytic domain {H	95.69
d1dl2a_		511	Class I alpha-1;2-mannosidase, catalytic domain {B	95.31
d2ri9a1		475	Class I alpha-1;2-mannosidase, catalytic domain {F	95.22
d1e2ya_		167	Tryparedoxin peroxidase (thioredoxin peroxidase ho	95.19
d2b7ka1		169	Thioredoxin-like protein Sco1 (YpmQ), soluble doma	95.07
d2g0da1		409	Nisin biosynthesis protein NisC {Lactococcus lacti	95.0
d2ri9a1		475	Class I alpha-1;2-mannosidase, catalytic domain {F	94.61
d2a4va1		156	Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c	94.61
d1zyea1		158	Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [	94.38
d1r7ha_		74	Glutaredoxin-like NRDH-redoxin {Corynebacterium am	94.35
d1uula_		194	Tryparedoxin peroxidase (thioredoxin peroxidase ho	94.27
d2zcta1		237	Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]}	94.23
d1ks8a_		433	Endo-b-1,4-glucanase {Termite (Nasutitermes takasa	94.11
d1ut9a1		511	Cellulose 1,4-beta-cellobiosidase CbhA {Clostridiu	94.04
d1we0a1		166	Alkyl hydroperoxide reductase AhpC {Amphibacillus	93.7
d1h75a_		76	Glutaredoxin-like NRDH-redoxin {Escherichia coli [	93.69
d1hcua_		488	Class I alpha-1;2-mannosidase, catalytic domain {T	93.12
d1ia6a_		431	Nonprocessive cellulase Cel9M {Clostridium cellulo	93.02
d1wp0a1		160	Thioredoxin-like protein Sco1 (YpmQ), soluble doma	92.94
d1xvqa_		166	Thiol peroxidase Tpx {Mycobacterium tuberculosis [	92.94
d1psqa_		163	Probable thiol peroxidase PsaD {Streptococcus pneu	92.74
d1fova_		82	Glutaredoxin (Grx, thioltransferase) {Escherichia	92.11
d1w6ka1		448	Lanosterol synthase {Human (Homo sapiens) [TaxId:	92.06
d1xvwa1		153	Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri	91.91
d1zofa1		170	Thioredoxin reductase TsaA {Helicobacter pylori [T	91.46
d1nm3a1		74	C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus	91.2
d1q98a_		164	Thiol peroxidase Tpx {Haemophilus influenzae [TaxI	90.83
d1qmva_		197	Thioredoxin peroxidase 2 (thioredoxin peroxidase B	90.66
d1ttza_		75	Hypothetical protein XCC2852 {Xanthomonas campestr	90.55
d2f8aa1		184	Glutathione peroxidase {Human (Homo sapiens) [TaxI	89.56
d1n8ja_		186	Alkyl hydroperoxide reductase AhpC {Salmonella typ	88.82
d1qxha_		164	Thiol peroxidase Tpx {Escherichia coli [TaxId: 562	88.76
d1ktea_		105	Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr	88.02
d1clca1		441	CelD cellulase, C-terminal domain {Clostridium the	87.98
d1wzza1		319	Probable endoglucanase CmcAX {Acetobacter xylinus	87.92
d1v58a1		169	Thiol:disulfide interchange protein DsbG, C-termin	86.86
d2sqca1		352	Squalene-hopene cyclase {Alicyclobacillus acidocal	86.77
d1prxa_		220	1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId:	85.86
d2h01a1		170	Thioredoxin peroxidase 2 (thioredoxin peroxidase B	84.82
d1g87a1		454	Endo/exocellulase:cellobiose E-4, N-terminal domai	83.11

>d1fp3a_ a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

class: All alpha proteins
fold: alpha/alpha toroid
superfamily: Six-hairpin glycosidases
family: N-acylglucosamine (NAG) epimerase
domain: N-acyl-D-glucosamine 2-epimerase
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=100.00  E-value=1.2e-35  Score=331.21  Aligned_cols=341  Identities=12%  Similarity=-0.004  Sum_probs=253.1

Q ss_pred             HHHHHHHH-hhccccCCCC----------CCCCCCCChh--HHHHHHHhhhhccccCCCCCcHHHHHHHHHHHHHHHhCC
Q 003115          286 RLCAEQLS-KSYDSRFGGF----------GSAPKFPRPV--EIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGG  352 (846)
Q Consensus       286 ~~~~~~l~-~~~D~~~GGf----------g~apKFP~~~--~l~~ll~~~~~~~~~~~~~~~~~~~~~~~~TL~~m~~GG  352 (846)
                      ++++-.+. ..+|+++|||          ...||+....  .+-.+...+....    ..++++.+++|.++++-|.++|
T Consensus        20 ~~ilpfW~~~~~D~~~GGf~~~ld~dg~~~~~~k~~~~~~R~l~~fs~a~~~~~----~~~~~~~~~~a~~g~~~L~~~~   95 (402)
T d1fp3a_          20 DRVMAFWLEHSHDREHGGFFTCLGRDGRVYDDLKYVWLQGRQVWMYCRLYRKLE----RFHRPELLDAAKAGGEFLLRHA   95 (402)
T ss_dssp             HHHHHHHHHHSBCTTTSSBCCCBCTTSCBSCCCEEHHHHHHHHHHHHHHHHHCG----GGCCHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHhcCcCcCCCCeeeeECCCCCcCCCCceeeeeHHHHHHHHHHHHHhc----ccCCHHHHHHHHHHHHHHHHhC
Confidence            45555554 4799999999          2356665432  1111112222211    1235789999999999999999


Q ss_pred             CcccCCCcEEEEEcCCCCCCCCCchhHHHHHHHHHHHHHHHHccCChHHHHHHHHHHHHHHHhccCCCCceeeeccCCCc
Q 003115          353 IHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSA  432 (846)
Q Consensus       353 i~D~vgGGF~RYsvD~~W~vPHFEKMLyDNA~Ll~~ya~Ay~~t~~~~y~~~A~~t~~fl~r~m~~~~Ggfysa~DADs~  432 (846)
                      ++|+.+|||| |++|.+|.+||++||+||||.++.+|+++|++||++.|+++|.+|++||.++|++++||||++.|+|+.
T Consensus        96 ~~d~~~Gg~~-~~vd~dG~~~~~~k~~Yd~Af~l~a~a~~~~~tg~~~~~~~a~~~~~~i~~~~~~~~~g~~~~~~~~~~  174 (402)
T d1fp3a_          96 RVAPPEKKCA-FVLTRDGRPVKVQRSIFSECFYTMAMNELWRVTAEARYQSEAVDMMDQIVHWVREDPSGLGRPQLPGAV  174 (402)
T ss_dssp             BSSTTSCCBC-SEECTTSCEEECCSSSHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHTCGGGGCCCCCTTSC
T ss_pred             CccCCCCCEE-EEECCCCCcCcccccccccHHHHHHHHHHHhccCCHHHHHHHHHHHHHHHHHhhcccCCCCccccCCCc
Confidence            9999999998 999999999999999999999999999999999999999999999999999999999999999999984


Q ss_pred             cccccccccCCceEEecHHHHHHHhhhhHHHHH----HHhcccCCCCcCCCCCCCCCCCCCCcceeeccCCchHHHHHcC
Q 003115          433 ETEGATRKKEGAFYVWTSKEVEDILGEHAILFK----EHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLG  508 (846)
Q Consensus       433 ~~~~~~~~~EGayY~wt~~Ei~~~L~~~~~~~~----~~f~i~~~Gn~e~~~~~d~~g~feg~nvL~~~~~~~~~a~~~g  508 (846)
                             +.+|.+|.|...|+..+|++......    +..........+   ..++    ++..++              
T Consensus       175 -------~~~g~~~~m~l~ea~~~l~~~~~~~~~~~~~~~~~~~~~~~~---~~~~----~~~~~~--------------  226 (402)
T d1fp3a_         175 -------ASESMAVPMMLLCLVEQLGEEDEELAGRYAQLGHWCARRILQ---HVQR----DGQAVL--------------  226 (402)
T ss_dssp             -------CEEETHHHHHHHHHHHHHHTTCHHHHHHTHHHHHHHHHHHHT---TEET----TTTEEC--------------
T ss_pred             -------cccccchHHHHHHHHHHHccccchhHHHHHHHHHHHHHHHHh---hccc----cchhHH--------------
Confidence                   58899999999999999874211100    000000000000   0000    001010              


Q ss_pred             CCHHHHHHHHHHHHHHHHhhhcCCCCCCCCchhhhchHHHHHHHHH-HHHHHhhhhhhhhcccCCCCCCChHHHHHHHHH
Q 003115          509 MPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFA-RASKILKSEAESAMFNFPVVGSDRKEYMEVAES  587 (846)
Q Consensus       509 ~~~~~l~~~l~~~r~~L~~~R~~R~~P~~DdKilt~WNglmI~ALa-~A~~v~~d~~~~~~~~~~~~~~~~~~yLe~A~~  587 (846)
                                      ..-.++.++.|..|+|+++.||+++++.|+ ++++++++                +.+++.|.+
T Consensus       227 ----------------e~~~~~~~~~~~~~~~~i~pGh~~e~~wLll~a~~~~~~----------------~~~~~~a~~  274 (402)
T d1fp3a_         227 ----------------ENVSEDGEELSGCLGRHQNPGHALEAGWFLLRHSSRSGD----------------AKLRAHVID  274 (402)
T ss_dssp             ----------------SEEETTSCBCCHHHHHEECHHHHHHHHHHHHHHHHHTTC----------------HHHHHHHHH
T ss_pred             ----------------hhhccccCcccCcccCcCCcchhhHHHHHHHHHHHHcCC----------------chHHHHHHH
Confidence                            011234567788899999999999988776 79999987                788888766


Q ss_pred             H-HHHHHHhccccCCCeEEEEe-cCCCCCC-----CCCcchHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHccccC
Q 003115          588 A-ASFIRRHLYDEQTHRLQHSF-RNGPSKA-----PGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDRE  660 (846)
Q Consensus       588 ~-a~~l~~~l~d~~~G~l~~~~-~dg~~~~-----~~~leDyA~~i~aLl~LYe~Tgd~~yL~~A~~L~~~~~~~F~D~~  660 (846)
                      . ..++.++.||+++|++++.. .+|.+..     .+.+++||++|.|++.+|++|||+.|+++|.++++.+.++|+|++
T Consensus       275 ~~~~~~~~~g~d~~~ggl~~~~~~~g~~~~~~~~~~k~~W~qaE~i~a~l~ly~~tgd~~~l~~a~~l~~~~~~~f~D~~  354 (402)
T d1fp3a_         275 TFLLLPFRSGWDADHGGLFYFQDADGLCPTQLEWAMKLWWPHSEAMIAFLMGYSESGDPALLRLFYQVAEYTFRQFRDPE  354 (402)
T ss_dssp             HHTHHHHHHHBCTTTCSBCSCEETTSCCCSSTTTTCEEHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHTBCTT
T ss_pred             HHHHHHHHhCccCCCCeEEEEecCCCCccccccchHHHHHHHHHHHHHHHHHHHccCCHHHHHHHHHHHHHHHHhCCCCC
Confidence            5 56678889998888887764 4554322     367788999999999999999999999999999999999999999


Q ss_pred             CCcccccCCCCCcccccccCCCCCCCCChHHH
Q 003115          661 GGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSV  692 (846)
Q Consensus       661 ~Ggyf~t~~~~~~l~~R~k~~~D~a~PS~Nsv  692 (846)
                      +|+||+.-+.++.++...|.. =...|.++..
T Consensus       355 ~G~W~~~~~~~g~~~~~~k~~-p~~~~YH~~r  385 (402)
T d1fp3a_         355 YGEWFGYLNREGKVALTIKGG-PFKGCFHVPR  385 (402)
T ss_dssp             TSSBCCEECTTSCEEECCSSC-SSCCSSHHHH
T ss_pred             CCeeEeeECCCCCCCccCCCC-CCCCcchHHH
Confidence            999999776666555443321 1245666654

PyMOL of d1fp3a_

>d2afaa1 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fp3a_ a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2afaa1 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]}	Back information, alignment and structure

>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2d5ja1 a.102.1.7 (A:1-377) Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [TaxId: 84635]}	Back information, alignment and structure

>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]}	Back information, alignment and structure

>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]}	Back information, alignment and structure

>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]}	Back information, alignment and structure

>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]}	Back information, alignment and structure

>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]}	Back information, alignment and structure

>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]}	Back information, alignment and structure

>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nc5a_ a.102.1.6 (A:) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]}	Back information, alignment and structure

>d2d5ja1 a.102.1.7 (A:1-377) Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [TaxId: 84635]}	Back information, alignment and structure

>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]}	Back information, alignment and structure

>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]}	Back information, alignment and structure

>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]}	Back information, alignment and structure

>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]}	Back information, alignment and structure

>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]}	Back information, alignment and structure

>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d1nc5a_ a.102.1.6 (A:) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ia6a_ a.102.1.2 (A:) Nonprocessive cellulase Cel9M {Clostridium cellulolyticum [TaxId: 1521]}	Back information, alignment and structure

>d1ks8a_ a.102.1.2 (A:) Endo-b-1,4-glucanase {Termite (Nasutitermes takasagoensis) [TaxId: 62960]}	Back information, alignment and structure

>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1g87a1 a.102.1.2 (A:3-456) Endo/exocellulase:cellobiose E-4, N-terminal domain {Clostridium cellulolyticum, atcc 35319 [TaxId: 1521]}	Back information, alignment and structure

>d1clca1 a.102.1.2 (A:135-575) CelD cellulase, C-terminal domain {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1ut9a1 a.102.1.2 (A:306-816) Cellulose 1,4-beta-cellobiosidase CbhA {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1tf4a1 a.102.1.2 (A:1-460) Endo/exocellulase:cellobiose E-4, N-terminal domain {Thermomonospora fusca [TaxId: 2021]}	Back information, alignment and structure

>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1nxca_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1x9da1 a.102.2.1 (A:245-697) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dl2a_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1hcua_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Trichoderma reesei [TaxId: 51453]}	Back information, alignment and structure

>d1nxca_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x9da1 a.102.2.1 (A:245-697) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dl2a_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ri9a1 a.102.2.1 (A:1036-1510) Class I alpha-1;2-mannosidase, catalytic domain {Fungus (Penicillium citrinum) [TaxId: 5077]}	Back information, alignment and structure

>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2g0da1 a.102.6.1 (A:7-415) Nisin biosynthesis protein NisC {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d2ri9a1 a.102.2.1 (A:1036-1510) Class I alpha-1;2-mannosidase, catalytic domain {Fungus (Penicillium citrinum) [TaxId: 5077]}	Back information, alignment and structure

>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]}	Back information, alignment and structure

>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1ks8a_ a.102.1.2 (A:) Endo-b-1,4-glucanase {Termite (Nasutitermes takasagoensis) [TaxId: 62960]}	Back information, alignment and structure

>d1ut9a1 a.102.1.2 (A:306-816) Cellulose 1,4-beta-cellobiosidase CbhA {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]}	Back information, alignment and structure

>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hcua_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Trichoderma reesei [TaxId: 51453]}	Back information, alignment and structure

>d1ia6a_ a.102.1.2 (A:) Nonprocessive cellulase Cel9M {Clostridium cellulolyticum [TaxId: 1521]}	Back information, alignment and structure

>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]}	Back information, alignment and structure

>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]}	Back information, alignment and structure

>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1clca1 a.102.1.2 (A:135-575) CelD cellulase, C-terminal domain {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1wzza1 a.102.1.2 (A:23-341) Probable endoglucanase CmcAX {Acetobacter xylinus [TaxId: 28448]}	Back information, alignment and structure

>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]}	Back information, alignment and structure

>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]}	Back information, alignment and structure

>d1g87a1 a.102.1.2 (A:3-456) Endo/exocellulase:cellobiose E-4, N-terminal domain {Clostridium cellulolyticum, atcc 35319 [TaxId: 1521]}	Back information, alignment and structure