Citrus Sinensis ID: 003175

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840--
MAESTPKRSYQSPRKQSNLHQLPSLISLTPKTPQTSNAPTTLRRSARRSSLAKDLASPEKPFCSTEKPIKDSSKRPNLAGNGEILSNKTPQRKPKVGLHSEELVISPMSPELSEGKKRKRKDYSEERSGDAVVTRSKVKTRSCKVENLKKRRVYYKKVVYDDGEFEVGDDVYVKRREDASSDEEDPEVEECRICFRAGRSVMLECDDCLGGFHLKCLKPPLKEVPEGEWVCEFCEARKLGKKIELPKPPEGKKRVRTMREKLLSSDLWAANIQSMWKEVDGNYWCRVFWYMIPEETAAGRQPHNLRRELYRTNDFANIEMESIIRHCSVMSPKDFVKANDQGDDIFLCEYEYDIHWHSFKRIADIDKEEEVEDADSDEDWKSSKAADSDTDEDMEFEDEDGKHLHTGPSPAHELAANSQRGRFFGLQKIGRKRIPEHVRCHKQTELERAKATLLLATLPKFLPCRNKEMEDITAFIKGATCDDQCLGRCLYIHGVPGTGKTMSVLAVMRSLRSEVESGSIRPYCFVEVNGLKLASPENIYRVIYEALSGHRVSWKKALHSLNERFLDGKKIGKEDDRPCILLIDELDLLVTRNQSVLYNILDWPTKPNSKLIVIGIANTMDLPEKLLPRISSRMGVQRLCFGPYNHQQLQEIISSRLKGIEAFEKQAIEFASRKVAAISGDARRALEICRRAAEIADYRIKKQTSNKNSASVGKSLVGMADVEAAIQEMFQAPHIQVMKSCSKLSKIFLTAMVYELYKTGMGETNFEKLAMTVSSLCTSNGEIFPSWDALLRVGCKLGECRIILCEPGSRHRLQKLQLNFPSDDVAFALKDSKDLPWLAKYL
cccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccHHHHHccccccccccEEEEcccEEEcccccEEEcccccccccccccHHHcHHHHcccccEEEEcccccccccccccccccccccccccccccHHHcccccccccccccccccHHHHHHHHHHccHHHHHHHHcccccccccEEEEEEEEccHHHHHcccccccccccccccccHHHcHHHHHccccccccHHHHHHHccccccEEEEEEcccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccEEEEEEcccccccccHHHHHHHHccccccccEEEEEEEEccccccccccHHcccccccEEEEEccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcHHHHHHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccEEEEcccccccccEEEEEccHHHHHHHHHccccHHHHHHHc
ccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccEEEcccEEEEccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccEEEEcccEEEEEccccccccccccccHcEEEcccccEEEEEcHHHcccccHHccccccccccccccccHHHHHHHcccEEEcccccccccEEccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEccHHHHccccccccccEEEEcccccccHHHHHHHccccccHHHHHHcccccccEEEEEEEEcccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEccEcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccEEEEEEcHHHHHHcccccEEEEEcccccccccEEEEEEEEcccccHHHHcHHHHHHcccEEEEcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHccHHHHHHHcccHHHHHHHHHHHHHHHHccccEEcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccEEEEEccccccEEEEEEEccHHHHHHHHHccccHHHHHHHc
maestpkrsyqsprkqsnlhqlpslisltpktpqtsnapttlrrSARRSSLAkdlaspekpfcstekpikdsskrpnlagngeilsnktpqrkpkvglhseelvispmspelsegkkrkrkdyseersgdavvtrskvktrsckvenlkkrRVYYKKVvyddgefevgddvyvkrredassdeedpeveECRICFRAGRsvmlecddclggfhlkclkpplkevpegewvCEFCEARKlgkkielpkppegkkRVRTMREKLLSSDLWAANIQSMWKEVDGNYWCRVFWYmipeetaagrqphnlrrelyrtndfanIEMESIIRHcsvmspkdfvkandqgddiflceyeydihwhsfkriadidkeeevedadsdedwksskaadsdtdedmefededgkhlhtgpspahelaansqrgrffglqkigrkripehvrcHKQTELERAKATLLLAtlpkflpcrnkemEDITAFIKgatcddqclgrclyihgvpgtgkTMSVLAVMRSLRSevesgsirpycfvevnglklaspenIYRVIYEALSGHRVSWKKALHSLNERFldgkkigkeddrpcilliDELDLLVTRNQSVLYNildwptkpnskLIVIGIAntmdlpekllprissrmgvqrlcfgpynhQQLQEIISSRLKGIEAFEKQAIEFASRKVAAISGDARRALEICRRAAEIADYRIkkqtsnknsasvGKSLVGMADVEAAIQEMFQAPHIQVMKSCSKLSKIFLTAMVYELYKTGMGETNFEKLAMTVSSLctsngeifpsWDALLRVGCKLgecriilcepgsrhrlqklqlnfpsdDVAFALkdskdlpwlakyl
maestpkrsyqsprkqsnlhqlpslisltpktpqtsnapttlrrsarrsslakdlaspekpfcstekpikdsskrpnlagngeilsnktpqrkpkvglhseelvispmspelsegkkrkrkdyseersgdavvtrskvktrsckvenlkkrrvyykkvvyddgefevgddvyVKRRedassdeedpeveeCRICFRAGRSVMLECDDCLGGFHLKCLKPPLKEVPEGEWVCEFCEArklgkkielpkppegkkrvRTMREKLLSSDLWAANIQSMWKEVDGNYWCRVFWYMIPEetaagrqphnlrRELYRTNDFANIEMESIIRHCSVMSPKDFVKANDQGDDIFLCEYEYDIHWHSFKRIADIDKEEevedadsdedwksskaadsdtdeDMEFEDEDGKHLHTGPSPAHELAANSQRGRFFGLQKIGRKRIPEHVRCHKQTELERAKATLLLATLPKFLPCRNKEMEDITAFIKGATCDDQCLGRCLYIHGVPGTGKTMSVLAVMRSLRsevesgsirpYCFVEVnglklaspENIYRVIYEALSGHRVSWKKALHSLNERfldgkkigkeddrPCILLIDELDLLVTRNQSVLynildwptkpnsKLIVIGIANTMDLPEKLLPRISSRMGVQRLCFGPYNHQQLQEIISSRLKGIEAFEKQAIEFASRKVAAISGDARRALEICRRAAEIadyrikkqtsnknsasvgkSLVGMADVEAAIQEMFQAPHIQVMKSCSKLSKIFLTAMVYELYKTGMGETNFEKLAMTVSSLCTSNGEIFPSWDALLRVGCKLGECRIILCEPGSRHRLQKLQLNFPSDDVafalkdskdlpwlakyl
MAESTPKRSYQSPRKQSNLHQLPSLISLTPKTPQTSNAPTTlrrsarrsslakdlasPEKPFCSTEKPIKDSSKRPNLAGNGEILSNKTPQRKPKVGLHSEELVISPMSPELSEGKKRKRKDYSEERSGDAVVTRSKVKTRSCKVENLkkrrvyykkvvyDDGEFEVGDDVYVKRREDASSDEEDPEVEECRICFRAGRSVMLECDDCLGGFHLKCLKPPLKEVPEGEWVCEFCEARKLGKKIELPKPPEGKKRVRTMREKLLSSDLWAANIQSMWKEVDGNYWCRVFWYMIPEETAAGRQPHNLRRELYRTNDFANIEMESIIRHCSVMSPKDFVKANDQGDDIFLCEYEYDIHWHSFKRIADIdkeeevedadsdedWKSSKAAdsdtdedmefededGKHLHTGPSPAHELAANSQRGRFFGLQKIGRKRIPEHVRCHKQtelerakatlllatlpkflpCRNKEMEDITAFIKGATCDDQCLGRCLYIHGVPGTGKTMSVLAVMRSLRSEVESGSIRPYCFVEVNGLKLASPENIYRVIYEALSGHRVSWKKALHSLNERFLDGKKIGKEDDRPCILLIDELDLLVTRNQSVLYNILDWPTKPNSKLIVIGIANTMDLPEKLLPRISSRMGVQRLCFGPYNHQQLQEIISSRLKGIEAFEKQAIEFASRKVAAISGDARRALEICRRAAEIADYRIKKQTSNKNSASVGKSLVGMADVEAAIQEMFQAPHIQVMKSCSKLSKIFLTAMVYELYKTGMGETNFEKLAMTVSSLCTSNGEIFPSWDALLRVGCKLGECRIILCEPGSRHRLQKLQLNFPSDDVAFALKDSKDLPWLAKYL
*********************************************************************************************************************************************SCKVENLKKRRVYYKKVVYDDGEFEVGDDVYV****************ECRICFRAGRSVMLECDDCLGGFHLKCLKPPLKEVPEGEWVCEFCEARKLGK********************LLSSDLWAANIQSMWKEVDGNYWCRVFWYMIPEETAAGRQPHNLRRELYRTNDFANIEMESIIRHCSVMSPKDFVKANDQGDDIFLCEYEYDIHWHSFKRIADI********************************************************RFFGLQKIGRKRIPEHVRCHKQTELERAKATLLLATLPKFLPCRNKEMEDITAFIKGATCDDQCLGRCLYIHGVPGTGKTMSVLAVMRSLRSEVESGSIRPYCFVEVNGLKLASPENIYRVIYEALSGHRVSWKKALHSLNERFLDGKKIGKEDDRPCILLIDELDLLVTRNQSVLYNILDWPTKPNSKLIVIGIANTMDLPEKLLPRISSRMGVQRLCFGPYNHQQLQEIISSRLKGIEAFEKQAIEFASRKVAAISGDARRALEICRRAAEIADYRI**************SLVGMADVEAAIQEMFQAPHIQVMKSCSKLSKIFLTAMVYELYKTGMGETNFEKLAMTVSSLCTSNGEIFPSWDALLRVGCKLGECRIILCEPGSRHRLQKLQLNFPSDDVAFALKDSKDLPWL****
********************************************************************************************************************************************************************************************EECRICFRAGRSVMLECDDCLGGFHLKCLKPPLKEVPEGEWVCEF*************************REKLLSSDLWAANIQSMWKEVDGNYWCRVFWY**************LRRELYRTNDFANIEMESIIRHC*****************IFLCEYEYDIHWHSFK*******************************************************************************CHKQTELERAKATLLLATLPKFLPCRNKEMEDITAFIKGATCDDQCLGRCLYIHGVPGTGKTMSVLAVMRSLRSEV*SGSIRPYCFVEVNGLKLASPENIYRVIYEALSG**********SLNERFLDGKKIGKEDDRPCILLIDELDLLVTRNQSVLYNILDWPTKPNSKLIVIGIANTMDLPEKLLPRISSRMGVQRLCFGPYNHQQLQEIISSRLKGIEAFEKQAIEFASRKVAAISGDARRALEICRRAAEIA********************VGMADVEAAIQEMFQAPHIQ*MKSCSKLSKIFLTAMVYELYKTGMGETNFEKLAMTVSSLCTSNGEIFPSWDALLRVGCKLGECRIIL**********KLQLNFPSDDVAFALKDSKDLPWLAKYL
*****************NLHQLPSLISLTPK*******************************************RPNLAGNGEILSNKTPQRKPKVGLHSEELVISPMSP******************************RSCKVENLKKRRVYYKKVVYDDGEFEVGDDVYVKR**************ECRICFRAGRSVMLECDDCLGGFHLKCLKPPLKEVPEGEWVCEFCEARKLGKKIELPKPPEGKKRVRTMREKLLSSDLWAANIQSMWKEVDGNYWCRVFWYMIPEETAAGRQPHNLRRELYRTNDFANIEMESIIRHCSVMSPKDFVKANDQGDDIFLCEYEYDIHWHSFKRIADIDK************************************LHTGPSPAHELAANSQRGRFFGLQKIGRKRIPEHVRCHKQTELERAKATLLLATLPKFLPCRNKEMEDITAFIKGATCDDQCLGRCLYIHGVPGTGKTMSVLAVMRSLRSEVESGSIRPYCFVEVNGLKLASPENIYRVIYEALSGHRVSWKKALHSLNERFLDGKKIGKEDDRPCILLIDELDLLVTRNQSVLYNILDWPTKPNSKLIVIGIANTMDLPEKLLPRISSRMGVQRLCFGPYNHQQLQEIISSRLKGIEAFEKQAIEFASRKVAAISGDARRALEICRRAAEIADYRIKK**********GKSLVGMADVEAAIQEMFQAPHIQVMKSCSKLSKIFLTAMVYELYKTGMGETNFEKLAMTVSSLCTSNGEIFPSWDALLRVGCKLGECRIILCEPGSRHRLQKLQLNFPSDDVAFALKDSKDLPWLAKYL
**********************************************************************************************KVGLHSEELVISPMS***************************************KKRRVYYKKVVYDDGEFEVGDDVYVKRRED**S**EDPEVEECRICFRAGRSVMLECDDCLGGFHLKCLKPPLKEVPEGEWVCEFCEARKLGKKIELPKPPEGKKRVRTMREKLLSSDLWAANIQSMWKEVDGNYWCRVFWYMIPEETAAGRQPHNLRRELYRTNDFANIEMESIIRHCSVMSPKDFVKANDQGDDIFLCEYEYDIHWHSFKRIADI*****************************************************************RKRIPEHVRCHKQTELERAKATLLLATLPKFLPCRNKEMEDITAFIKGATCDDQCLGRCLYIHGVPGTGKTMSVLAVMRSLRSEVESGSIRPYCFVEVNGLKLASPENIYRVIYEALSGHRVSWKKALHSLNERFLDGKKIGKEDDRPCILLIDELDLLVTRNQSVLYNILDWPTKPNSKLIVIGIANTMDLPEKLLPRISSRMGVQRLCFGPYNHQQLQEIISSRLKGIEAFEKQAIEFASRKVAAISGDARRALEICRRAAEIADYRIK**************LVGMADVEAAIQEMFQAPHIQVMKSCSKLSKIFLTAMVYELYKTGMGETNFEKLAMTVSSLCTSNGEIFPSWDALLRVGCKLGECRIILCEPGSRHRLQKLQLNFPSDDVAFALKDSKDLPWLAKYL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAESTPKRSYQSPRKQSNLHQLPSLISLTPKTPQTSNAPTTLRRSARRSSLAKDLASPEKPFCSTEKPIKDSSKRPNLAGNGEILSNKTPQRKPKVGLHSEELVISPMSPELSEGKKRKRKDYSEERSGDAVVTRSKVKTRSCKVENLKKRRVYYKKVVYDDGEFEVGDDVYVKRREDASSDEEDPEVEECRICFRAGRSVMLECDDCLGGFHLKCLKPPLKEVPEGEWVCEFCEARKLGKKIELPKPPEGKKRVRTMREKLLSSDLWAANIQSMWKEVDGNYWCRVFWYMIPEETAAGRQPHNLRRELYRTNDFANIEMESIIRHCSVMSPKDFVKANDQGDDIFLCEYEYDIHWHSFKRIADIDKEEEVEDADSDEDWKSSKAADSDTDEDMEFEDEDGKHLHTGPSPAHELAANSQRGRFFGLQKIGRKRIPEHVRCHKQTELERAKATLLLATLPKFLPCRNKEMEDITAFIKGATCDDQCLGRCLYIHGVPGTGKTMSVLAVMRSLRSEVESGSIRPYCFVEVNGLKLASPENIYRVIYEALSGHRVSWKKALHSLNERFLDGKKIGKEDDRPCILLIDELDLLVTRNQSVLYNILDWPTKPNSKLIVIGIANTMDLPEKLLPRISSRMGVQRLCFGPYNHQQLQEIISSRLKGIEAFEKQAIEFASRKVAAISGDARRALEICRRAAEIADYRIKKQTSNKNSASVGKSLVGMADVEAAIQEMFQAPHIQVMKSCSKLSKIFLTAMVYELYKTGMGETNFEKLAMTVSSLCTSNGEIFPSWDALLRVGCKLGECRIILCEPGSRHRLQKLQLNFPSDDVAFALKDSKDLPWLAKYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query842 2.2.26 [Sep-21-2011]
O16810924 Origin recognition comple yes no 0.435 0.397 0.424 1e-87
Q58DC8863 Origin recognition comple yes no 0.441 0.431 0.408 3e-77
Q9JI69850 Origin recognition comple yes no 0.441 0.437 0.413 5e-77
Q13415861 Origin recognition comple yes no 0.441 0.432 0.405 2e-76
Q9Z1N2840 Origin recognition comple yes no 0.444 0.445 0.413 3e-75
Q80Z32848 Origin recognition comple yes no 0.441 0.438 0.403 5e-75
P54789707 Origin recognition comple yes no 0.440 0.524 0.375 4e-67
Q54RM2631 Origin recognition comple yes no 0.458 0.611 0.332 4e-60
Q6BSE2810 Origin recognition comple yes no 0.370 0.385 0.378 5e-55
O74270805 Origin recognition comple N/A no 0.385 0.403 0.350 1e-51
>sp|O16810|ORC1_DROME Origin recognition complex subunit 1 OS=Drosophila melanogaster GN=Orc1 PE=1 SV=2 Back     alignment and function desciption
 Score =  325 bits (833), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 166/391 (42%), Positives = 252/391 (64%), Gaps = 24/391 (6%)

Query: 443 QTELERAKATLLLATLPKFLPCRNKEMEDITAFIKGATCDDQCLGRCLYIHGVPGTGKTM 502
           ++EL+ A+  L ++ +PK LPCR +E E+I AF++G    DQC G C+Y+ GVPGTGKT 
Sbjct: 549 KSELQLAREQLHVSVVPKSLPCREREFENIYAFLEGK-IQDQC-GGCMYVSGVPGTGKTA 606

Query: 503 SVLAVMRSLRSEVESGSIRPYCFVEVNGLKLASPENIYRVIYEALSGHRVSWKKALHSLN 562
           +V  V+R+L+   +   +  + ++E+NG++L  P   Y  IY+ L+G  VSW++A   L 
Sbjct: 607 TVTGVIRTLQRMAKQNELPAFEYLEINGMRLTEPRQAYVQIYKQLTGKTVSWEQAHALLE 666

Query: 563 ERFLDG--KKIGKEDDRPCILLIDELDLLVTRNQSVLYNILDWPTKPNSKLIVIGIANTM 620
           +RF     +++        +LL+DELD+L  R Q V+YN+LDWPTK  +KL+V+ IANTM
Sbjct: 667 KRFTTPAPRRVT------TVLLVDELDILCNRRQDVVYNLLDWPTKSAAKLVVVTIANTM 720

Query: 621 DLPEKLL-PRISSRMGVQRLCFGPYNHQQLQEIISSRLKGIEAFEKQAIEFASRKVAAIS 679
           DLPE+LL  +++SR+G+ RL F PY+H+QLQEI+++RL G E F+ +A++  +RKVAA+S
Sbjct: 721 DLPERLLMGKVTSRLGLTRLTFQPYSHKQLQEIVTARLGGSETFKGEAVQLVARKVAAVS 780

Query: 680 GDARRALEICRRAAEIADYRIKKQTSNKNSASVGKSLVGMADVEAAIQEMFQAPHIQVMK 739
           GDARRAL+ICRRA EIAD           +A+V    V M  V+ A+ EM  +  +Q ++
Sbjct: 781 GDARRALDICRRATEIAD-----------TAAV--KCVTMLHVQQALAEMIASAKVQAIR 827

Query: 740 SCSKLSKIFLTAMVYELYKTGMGETNFEKLAMTVSSLCTSNGEIFPSWDALLRVGCKLGE 799
           +CS++ +IFL A+  E+ +TG+ ET F  +   V ++    G  FP     LR+  KLG 
Sbjct: 828 NCSRMEQIFLQAIAAEVTRTGVEETTFMGVYQQVETIAAFMGVTFPPPGRALRLCSKLGA 887

Query: 800 CRIILCEPGSRHRLQKLQLNFPSDDVAFALK 830
            R+I+ E       QK+ LN  +DD+ +AL+
Sbjct: 888 ERLIISEHSRNDLFQKILLNVSADDIHYALR 918
Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication.
Drosophila melanogaster (taxid: 7227)
>sp|Q58DC8|ORC1_BOVIN Origin recognition complex subunit 1 OS=Bos taurus GN=ORC1 PE=2 SV=2 Back     alignment and function description
>sp|Q9JI69|ORC1_CRIGR Origin recognition complex subunit 1 OS=Cricetulus griseus GN=ORC1 PE=2 SV=1 Back     alignment and function description
>sp|Q13415|ORC1_HUMAN Origin recognition complex subunit 1 OS=Homo sapiens GN=ORC1 PE=1 SV=2 Back     alignment and function description
>sp|Q9Z1N2|ORC1_MOUSE Origin recognition complex subunit 1 OS=Mus musculus GN=Orc1 PE=1 SV=2 Back     alignment and function description
>sp|Q80Z32|ORC1_RAT Origin recognition complex subunit 1 OS=Rattus norvegicus GN=Orc1 PE=2 SV=1 Back     alignment and function description
>sp|P54789|ORC1_SCHPO Origin recognition complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orc1 PE=1 SV=1 Back     alignment and function description
>sp|Q54RM2|ORC1_DICDI Origin recognition complex subunit 1 OS=Dictyostelium discoideum GN=orcA PE=3 SV=1 Back     alignment and function description
>sp|Q6BSE2|ORC1_DEBHA Origin recognition complex subunit 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ORC1 PE=3 SV=2 Back     alignment and function description
>sp|O74270|ORC1_CANAX Origin recognition complex subunit 1 OS=Candida albicans GN=ORC1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query842
224106169814 predicted protein [Populus trichocarpa] 0.958 0.991 0.741 0.0
255544856844 origin recognition complex subunit, puta 0.980 0.978 0.740 0.0
356550317851 PREDICTED: uncharacterized protein LOC10 0.979 0.969 0.691 0.0
356557695850 PREDICTED: origin recognition complex su 0.975 0.965 0.685 0.0
356550319838 PREDICTED: uncharacterized protein LOC10 0.965 0.970 0.684 0.0
359478739806 PREDICTED: origin recognition complex su 0.950 0.992 0.716 0.0
297746330 979 unnamed protein product [Vitis vinifera] 0.933 0.802 0.705 0.0
297813809816 ATORC1B/ORC1B/UNE13 [Arabidopsis lyrata 0.956 0.986 0.647 0.0
18414287809 origin recognition complex subunit 1 [Ar 0.941 0.980 0.636 0.0
15235420813 origin of replication complex 1B [Arabid 0.954 0.988 0.641 0.0
>gi|224106169|ref|XP_002314069.1| predicted protein [Populus trichocarpa] gi|222850477|gb|EEE88024.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1249 bits (3232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/842 (74%), Positives = 715/842 (84%), Gaps = 35/842 (4%)

Query: 5   TPKRSYQSPRKQSNLHQL-PSLISLTPKTPQTSNAPTTLRRSARRSSLAKDLASPEKPFC 63
           TPK+S QSP K+       PS +S TP+TP+T + P   RR + R SL   + +P++P  
Sbjct: 4   TPKKSIQSPSKKLKKQATSPSSVSATPQTPRTLDPP---RRFSPRLSL--KVNAPQEPIS 58

Query: 64  STEKPIKDSSKRP--NLAGNGEILSNKTPQRKPKVGLHSEELVISPMSPELSEGKKRKRK 121
             EKP KDS K P   L  NG    +KTP+ K +V     E   SP+SP+ SE KKR+R 
Sbjct: 59  PIEKPTKDSLKTPPNKLKDNG---CSKTPKSKSEVLEVGVEF--SPVSPDQSETKKRRRA 113

Query: 122 DYSEERSGDAVVTRSKVKTRSCKVENLKKRRVYYKKVVYDDGEFEVGDDVYVKRREDASS 181
             +++ SG                    K+RVYYKKVVYD+GEFEVGDDVYVKRREDASS
Sbjct: 114 K-TDKMSG--------------------KKRVYYKKVVYDEGEFEVGDDVYVKRREDASS 152

Query: 182 DEEDPEVEECRICFRAGRSVMLECDDCLGGFHLKCLKPPLKEVPEGEWVCEFCEARKLGK 241
           D+E PE+EECR+CF+AG++VM+ECDDCLGGFHLKCLKPPLK VPEGEW+C FCEARKLGK
Sbjct: 153 DDEVPELEECRVCFKAGKAVMIECDDCLGGFHLKCLKPPLKIVPEGEWICGFCEARKLGK 212

Query: 242 KIELPKPPEGKKRVRTMREKLLSSDLWAANIQSMWKEVDGNYWCRVFWYMIPEETAAGRQ 301
           +++LP+PP GKK  RT+R+KLLSSDLWAA+I+S+WKE DG+YW R  WY IPEET+AGRQ
Sbjct: 213 EVQLPRPPPGKKLARTLRDKLLSSDLWAAHIESIWKEADGSYWFRGRWYTIPEETSAGRQ 272

Query: 302 PHNLRRELYRTNDFANIEMESIIRHCSVMSPKDFVKANDQGDDIFLCEYEYDIHWHSFKR 361
           PHNLRRELY+TNDFA IEMESIIRHC V++PK++ KA+D+GDDIF+CEYEYDIHWHSFKR
Sbjct: 273 PHNLRRELYQTNDFAEIEMESIIRHCFVLNPKEYAKAHDEGDDIFMCEYEYDIHWHSFKR 332

Query: 362 IADIDK-EEEVEDADSDEDWKSSKAADSDTDEDMEFEDEDGKHLHTGPSPAHELAANSQR 420
           +ADID  +EE E++D+DEDWKSSK A+SDTDED+E+E+E   +L +  S AHELAANS++
Sbjct: 333 LADIDNGDEEGENSDTDEDWKSSKDAESDTDEDVEYEEEKVINLQSRASSAHELAANSRK 392

Query: 421 GRFFGLQKIGRKRIPEHVRCHKQTELERAKATLLLATLPKFLPCRNKEMEDITAFIKGAT 480
           G+FFGLQKIG KRIPEHVRCHKQTELE+AKA L+LA LPK LPCRNKEME+I+AF+KGA 
Sbjct: 393 GKFFGLQKIGTKRIPEHVRCHKQTELEKAKAALVLAKLPKSLPCRNKEMEEISAFVKGAI 452

Query: 481 CDDQCLGRCLYIHGVPGTGKTMSVLAVMRSLRSEVESGSIRPYCFVEVNGLKLASPENIY 540
           CD+QCLGRCLY+HGVPGTGKTMSVLAVMR+L+SEV++GSIRPYCFV+VNGLKLASPENIY
Sbjct: 453 CDNQCLGRCLYVHGVPGTGKTMSVLAVMRNLKSEVDAGSIRPYCFVDVNGLKLASPENIY 512

Query: 541 RVIYEALSGHRVSWKKALHSLNERFLDGKKIGKEDDRPCILLIDELDLLVTRNQSVLYNI 600
           R IYEAL+GHRVSWKKALH LNERF DGK+ GKEDDRPCILLIDELDLLVTRNQSVLYNI
Sbjct: 513 RAIYEALTGHRVSWKKALHLLNERFSDGKRTGKEDDRPCILLIDELDLLVTRNQSVLYNI 572

Query: 601 LDWPTKPNSKLIVIGIANTMDLPEKLLPRISSRMGVQRLCFGPYNHQQLQEIISSRLKGI 660
           LDWPTKP+SKLIVIGIANTMDLPEKLLPRISSRMG+QRLCFGPYN+QQLQEIISSRLKGI
Sbjct: 573 LDWPTKPHSKLIVIGIANTMDLPEKLLPRISSRMGIQRLCFGPYNYQQLQEIISSRLKGI 632

Query: 661 EAFEKQAIEFASRKVAAISGDARRALEICRRAAEIADYRIKKQTSNKNSASVGKSLVGMA 720
            AFEKQAIEFASRKVAAISGDARRALEICRRAAEIADY+IKK +SN N A  GK LVGM+
Sbjct: 633 NAFEKQAIEFASRKVAAISGDARRALEICRRAAEIADYQIKKLSSNHNPAPEGKGLVGMS 692

Query: 721 DVEAAIQEMFQAPHIQVMKSCSKLSKIFLTAMVYELYKTGMGETNFEKLAMTVSSLCTSN 780
            VEAAIQEMFQAPHIQVM+SCSKLSKIFL AMVYELYKTGM ET+FEKLAMTVS +CTSN
Sbjct: 693 AVEAAIQEMFQAPHIQVMRSCSKLSKIFLAAMVYELYKTGMAETSFEKLAMTVSCICTSN 752

Query: 781 GEIFPSWDALLRVGCKLGECRIILCEPGSRHRLQKLQLNFPSDDVAFALKDSKDLPWLAK 840
            E FP WD LL++GC LGE RIILCEPG+RH LQKLQLNFPSDDVAFALKDSK++PWLAK
Sbjct: 753 AEAFPGWDILLKLGCMLGESRIILCEPGARHSLQKLQLNFPSDDVAFALKDSKEIPWLAK 812

Query: 841 YL 842
           YL
Sbjct: 813 YL 814

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255544856|ref|XP_002513489.1| origin recognition complex subunit, putative [Ricinus communis] gi|223547397|gb|EEF48892.1| origin recognition complex subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356550317|ref|XP_003543534.1| PREDICTED: uncharacterized protein LOC100798547 isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356557695|ref|XP_003547149.1| PREDICTED: origin recognition complex subunit 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356550319|ref|XP_003543535.1| PREDICTED: uncharacterized protein LOC100798547 isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|359478739|ref|XP_002282859.2| PREDICTED: origin recognition complex subunit 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297746330|emb|CBI16386.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297813809|ref|XP_002874788.1| ATORC1B/ORC1B/UNE13 [Arabidopsis lyrata subsp. lyrata] gi|297320625|gb|EFH51047.1| ATORC1B/ORC1B/UNE13 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18414287|ref|NP_567440.1| origin recognition complex subunit 1 [Arabidopsis thaliana] gi|38567372|emb|CAD13174.1| origin recognition complex 1a protein [Arabidopsis thaliana] gi|332658078|gb|AEE83478.1| origin recognition complex subunit 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15235420|ref|NP_192999.1| origin of replication complex 1B [Arabidopsis thaliana] gi|5823573|emb|CAB53755.1| origin recognition complex subunit 1-like protein [Arabidopsis thaliana] gi|7267964|emb|CAB78305.1| origin recognition complex subunit 1-like protein [Arabidopsis thaliana] gi|38567376|emb|CAD20132.1| origin recognition complex 1b protein [Arabidopsis thaliana] gi|332657758|gb|AEE83158.1| origin of replication complex 1B [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query842
TAIR|locus:2135575813 ORC1B "origin of replication c 0.913 0.945 0.627 4.2e-269
TAIR|locus:2130090809 ORC1A "origin recognition comp 0.950 0.988 0.607 6.3e-266
FB|FBgn0022772924 Orc1 "Origin recognition compl 0.410 0.374 0.432 3.6e-76
UNIPROTKB|Q9JI69850 ORC1 "Origin recognition compl 0.420 0.416 0.414 4.1e-75
UNIPROTKB|Q13415861 ORC1 "Origin recognition compl 0.420 0.411 0.406 4.1e-75
ZFIN|ZDB-GENE-030131-6960912 orc1 "origin recognition compl 0.418 0.385 0.417 6.2e-75
UNIPROTKB|Q5ZMC5858 ORC1 "Uncharacterized protein" 0.418 0.410 0.421 6.7e-75
UNIPROTKB|E2QU75863 ORC1 "Uncharacterized protein" 0.420 0.410 0.406 3.7e-74
UNIPROTKB|Q58DC8863 ORC1 "Origin recognition compl 0.420 0.410 0.409 5.9e-74
RGD|631435848 Orc1 "origin recognition compl 0.420 0.417 0.406 1.2e-73
TAIR|locus:2135575 ORC1B "origin of replication complex 1B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2588 (916.1 bits), Expect = 4.2e-269, P = 4.2e-269
 Identities = 499/795 (62%), Positives = 595/795 (74%)

Query:    58 PEKPFCSTEKPIKDSSKRPNLA---GNGEILSNKTPQRKPKVGLHS-EELVISPMSP--E 111
             P+ P   T  P++ S++  +     GN  I     P   P  G++   +   +P  P  +
Sbjct:    35 PQTP--ETHTPLRRSARHVSRKIDLGNDPI---DAPGNDPIEGMNLIRKRERAPRKPTTD 89

Query:   112 LSEGKKRKRKDYSEERSGDAVVTRSKVKTRSCKVENLXXXXXXXXXXXXDDGEFEVGDDV 171
             +   K +K +   +++  D+    S +++ + K +              D+ EFE+GDDV
Sbjct:    90 VVPSKSKKTETPKKKKKIDSFTPVSPIRSETIK-KTKKKKRVYYNKVEFDETEFEIGDDV 148

Query:   172 YVKRREDASSDEE-DPEVEECRICFRAGRSVMLECDDCLGGFHLKCLKPPLKEVPEGEWV 230
             YVKRRED++SDEE DPE+E+C+ICF++  ++M+ECDDCLGGFHLKCLKPPLKEVPEG+W+
Sbjct:   149 YVKRREDSNSDEEEDPEIEDCQICFKSDTNIMIECDDCLGGFHLKCLKPPLKEVPEGDWI 208

Query:   231 CEFCEARKLGKK--IELPKPPEGKKRVRTMREKLLSSDLWAANIQSMWKEVD-GNYWCRV 287
             C+FCE +K G+   ++LPKPPEGKK  RTMREKLLS DLWAA I  +WKEVD G YW R 
Sbjct:   209 CQFCEVKKSGQSQTLDLPKPPEGKKLARTMREKLLSGDLWAARIDKLWKEVDDGVYWIRA 268

Query:   288 FWYMIPEETAAGRQPHNLRRELYRTNDFANIEMESIIRHCSVMSPKDFVKANDQGDDIFL 347
              WYMIPEET +GRQPHNL+RELY TNDFA+IEME I+RHCSV  PK+F KA++ GDD+FL
Sbjct:   269 RWYMIPEETVSGRQPHNLKRELYLTNDFADIEMECILRHCSVKCPKEFSKASNDGDDVFL 328

Query:   348 CEYEYDIHWHSFKRIADIXXXXXXXXXXXXXXWKSSKAAXXXXXXXXXXXXXXGKHLHTG 407
             CEYEYD+HW SFKR+A++              W   K                      G
Sbjct:   329 CEYEYDVHWRSFKRLAELADGDSDSDQE----WNGRKEEEVDDSDEEMELDDEVLKSKRG 384

Query:   408 PSPAHELAANSQRGRFFGLQKIGRKRIPEHVRCHKQXXXXXXXXXXXXXXXXXXXXCRNK 467
                +    ANS++GRFFG++K+G K IPEHVRCHKQ                    CR+K
Sbjct:   385 GLTSARGGANSRKGRFFGVEKVGMKLIPEHVRCHKQSELEKAKATLLLATRPKSLPCRSK 444

Query:   468 EMEDITAFIKGATCDDQCLGRCLYIHGVPGTGKTMSVLAVMRSLRSEVESGSIRPYCFVE 527
             EME+IT+FIKG+  DDQCLGRC+YIHGVPGTGKT+SVL+VM++L++EVE GS+ PYCFVE
Sbjct:   445 EMEEITSFIKGSISDDQCLGRCMYIHGVPGTGKTISVLSVMKNLKAEVEEGSVSPYCFVE 504

Query:   528 VNGLKLASPENIYRVIYEALSGHRVSWKKALHSLNERFLDGKKIGKEDDRPCILLIDELD 587
             +NGLKLASPENIY VIYEALSGHRV WKKAL  LNERF +GK+IGKED++PCILLIDELD
Sbjct:   505 INGLKLASPENIYSVIYEALSGHRVGWKKALQCLNERFAEGKRIGKEDEKPCILLIDELD 564

Query:   588 LLVTRNQSVLYNILDWPTKPNSKLIVIGIANTMDLPEKLLPRISSRMGVQRLCFGPYNHQ 647
             LLVTRNQSVLYNILDWPTKPNSKL+V+GIANTMDLPEKLLPRISSRMG+QRLCFGPYNH 
Sbjct:   565 LLVTRNQSVLYNILDWPTKPNSKLVVLGIANTMDLPEKLLPRISSRMGIQRLCFGPYNHT 624

Query:   648 QLQEIISSRLKGIEAFEKQAIEFASRKVAAISGDARRALEICRRAAEIADYRIKKQTSNK 707
             QLQEIIS+RL GI+AFEK AIEFASRKVAAISGDARRALEICRRAAE+AD+R+    S K
Sbjct:   625 QLQEIISTRLNGIDAFEKTAIEFASRKVAAISGDARRALEICRRAAEVADHRLNTNKSAK 684

Query:   708 NSASVGKSLVGMADVEAAIQEMFQAPHIQVMKSCSKLSKIFLTAMVYELYKTGMGETNFE 767
             N       LV MADVEAAIQEMFQAPHIQVMKS SKLSKIFLTAMV+ELYKTGM ET F+
Sbjct:   685 NQ------LVIMADVEAAIQEMFQAPHIQVMKSVSKLSKIFLTAMVHELYKTGMAETTFD 738

Query:   768 KLAMTVSSLCTSNGEIFPSWDALLRVGCKLGECRIILCEPGSRHRLQKLQLNFPSDDVAF 827
             ++A TVSS+C +NGE FP WD LL++GC LGECRIILCEPG +HRLQKLQLNFPSDDVAF
Sbjct:   739 RVATTVSSICLTNGEAFPGWDILLKIGCDLGECRIILCEPGEKHRLQKLQLNFPSDDVAF 798

Query:   828 ALKDSKDLPWLAKYL 842
             ALKD+KDLPWLA YL
Sbjct:   799 ALKDNKDLPWLANYL 813
GO:0000166 "nucleotide binding" evidence=IEA
GO:0000808 "origin recognition complex" evidence=IEA;ISS
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA;ISS
GO:0006260 "DNA replication" evidence=IEA;ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0009567 "double fertilization forming a zygote and endosperm" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IMP
GO:0010385 "double-stranded methylated DNA binding" evidence=IDA
TAIR|locus:2130090 ORC1A "origin recognition complex 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0022772 Orc1 "Origin recognition complex subunit 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9JI69 ORC1 "Origin recognition complex subunit 1" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
UNIPROTKB|Q13415 ORC1 "Origin recognition complex subunit 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6960 orc1 "origin recognition complex, subunit 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMC5 ORC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QU75 ORC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q58DC8 ORC1 "Origin recognition complex subunit 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|631435 Orc1 "origin recognition complex, subunit 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query842
cd04718148 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homol 5e-74
PTZ001121164 PTZ00112, PTZ00112, origin recognition complex 1 p 9e-51
COG1474366 COG1474, CDC6, Cdc6-related protein, AAA superfami 2e-43
TIGR02928365 TIGR02928, TIGR02928, orc1/cdc6 family replication 1e-25
PRK00411394 PRK00411, cdc6, cell division control protein 6; R 2e-23
cd04370123 cd04370, BAH, BAH, or Bromo Adjacent Homology doma 1e-22
pfam00004131 pfam00004, AAA, ATPase family associated with vari 3e-18
pfam01426120 pfam01426, BAH, BAH domain 8e-18
cd04717121 cd04717, BAH_polybromo, BAH, or Bromo Adjacent Hom 6e-13
smart00439121 smart00439, BAH, Bromo adjacent homology domain 6e-13
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-10
smart00382148 smart00382, AAA, ATPases associated with a variety 5e-09
cd04714121 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homolo 1e-08
pfam0062851 pfam00628, PHD, PHD-finger 1e-08
pfam13401124 pfam13401, AAA_22, AAA domain 9e-08
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 3e-07
smart0024947 smart00249, PHD, PHD zinc finger 1e-06
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 7e-04
cd04720179 cd04720, BAH_Orc1p_Yeast, BAH, or Bromo Adjacent H 0.001
pfam09848348 pfam09848, DUF2075, Uncharacterized conserved prot 0.002
>gnl|CDD|240069 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information 
 Score =  237 bits (607), Expect = 5e-74
 Identities = 95/153 (62%), Positives = 112/153 (73%), Gaps = 5/153 (3%)

Query: 211 GFHLKCLKPPLKEVPEGEWVCEFCEARKLGKKIELPKPPEGKKRVRTMREKLLSSDLWAA 270
           GFHL CL+PPLKEVPEG+W+C FCE  K G+      PP      R+  EKLLS DLW A
Sbjct: 1   GFHLCCLRPPLKEVPEGDWICPFCEVEKSGQSAMPQLPPTS----RSACEKLLSGDLWLA 56

Query: 271 NIQSMWKEVDGNYWCRVFWYMIPEETAAGRQPHNLRRELYRTNDFANIEMESIIRHCSVM 330
            I+ +W+E  G YW    WY +PEET  GRQPHNLRRELY TNDFA+IEME I+RHCSV 
Sbjct: 57  RIEKLWEEN-GTYWYAARWYTLPEETHMGRQPHNLRRELYLTNDFADIEMECILRHCSVK 115

Query: 331 SPKDFVKANDQGDDIFLCEYEYDIHWHSFKRIA 363
            PK+F  A++ GDD+FLCEYEYD+HW SFKR+A
Sbjct: 116 CPKEFRDASNDGDDVFLCEYEYDVHWQSFKRLA 148

BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions. Length = 148
>gnl|CDD|240274 PTZ00112, PTZ00112, origin recognition complex 1 protein; Provisional Back     alignment and domain information
>gnl|CDD|224391 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234063 TIGR02928, TIGR02928, orc1/cdc6 family replication initiation protein Back     alignment and domain information
>gnl|CDD|234751 PRK00411, cdc6, cell division control protein 6; Reviewed Back     alignment and domain information
>gnl|CDD|239835 cd04370, BAH, BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|216495 pfam01426, BAH, BAH domain Back     alignment and domain information
>gnl|CDD|240068 cd04717, BAH_polybromo, BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 Back     alignment and domain information
>gnl|CDD|214664 smart00439, BAH, Bromo adjacent homology domain Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|240065 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|240071 cd04720, BAH_Orc1p_Yeast, BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p Back     alignment and domain information
>gnl|CDD|220440 pfam09848, DUF2075, Uncharacterized conserved protein (DUF2075) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 842
KOG1514767 consensus Origin recognition complex, subunit 1, a 100.0
PTZ001121164 origin recognition complex 1 protein; Provisional 100.0
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 100.0
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 100.0
PRK00411394 cdc6 cell division control protein 6; Reviewed 100.0
TIGR02928365 orc1/cdc6 family replication initiation protein. M 100.0
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 100.0
KOG2228408 consensus Origin recognition complex, subunit 4 [R 99.95
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.93
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 99.89
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.87
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.87
KOG0736953 consensus Peroxisome assembly factor 2 containing 99.87
cd04717121 BAH_polybromo BAH, or Bromo Adjacent Homology doma 99.86
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.85
cd04716122 BAH_plantDCM_I BAH, or Bromo Adjacent Homology dom 99.85
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.84
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.84
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.83
KOG0734752 consensus AAA+-type ATPase containing the peptidas 99.83
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.82
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.82
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.82
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.82
PRK03992389 proteasome-activating nucleotidase; Provisional 99.82
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.81
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.81
cd04714121 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, 99.81
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.81
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.8
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.8
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.79
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.79
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.79
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.79
CHL00195489 ycf46 Ycf46; Provisional 99.79
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.79
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.79
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.79
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.78
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.78
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.78
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.78
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.78
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.78
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.78
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.77
KOG2028554 consensus ATPase related to the helicase subunit o 99.77
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.77
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.77
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.77
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.77
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.76
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.75
CHL00176 638 ftsH cell division protein; Validated 99.75
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.75
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.75
PLN03025319 replication factor C subunit; Provisional 99.75
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.74
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.74
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.73
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.73
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.73
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.73
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.73
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.73
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.72
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.72
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.72
PRK00149450 dnaA chromosomal replication initiation protein; R 99.72
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.72
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.72
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.71
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.71
cd04721130 BAH_plant_1 BAH, or Bromo Adjacent Homology domain 99.71
PRK14087450 dnaA chromosomal replication initiation protein; P 99.71
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.71
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.7
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.7
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.7
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.7
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.69
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.69
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.69
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.69
PRK14088440 dnaA chromosomal replication initiation protein; P 99.69
PRK14086617 dnaA chromosomal replication initiation protein; P 99.69
PRK12402337 replication factor C small subunit 2; Reviewed 99.68
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.68
CHL00181287 cbbX CbbX; Provisional 99.68
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.68
PRK13341 725 recombination factor protein RarA/unknown domain f 99.68
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.68
CHL00206 2281 ycf2 Ycf2; Provisional 99.68
PRK00440319 rfc replication factor C small subunit; Reviewed 99.67
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.67
smart00439120 BAH Bromo adjacent homology domain. 99.67
cd04370123 BAH BAH, or Bromo Adjacent Homology domain (also c 99.66
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.66
PRK04195 482 replication factor C large subunit; Provisional 99.66
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 99.66
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.66
PRK13342413 recombination factor protein RarA; Reviewed 99.66
PRK06893229 DNA replication initiation factor; Validated 99.65
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.65
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.65
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.64
PRK12422445 chromosomal replication initiation protein; Provis 99.64
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.63
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.62
PRK08084235 DNA replication initiation factor; Provisional 99.62
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.62
COG0593408 DnaA ATPase involved in DNA replication initiation 99.62
PRK08727233 hypothetical protein; Validated 99.61
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.61
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.61
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 99.6
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.58
cd04713146 BAH_plant_3 BAH, or Bromo Adjacent Homology domain 99.58
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.57
PF01426119 BAH: BAH domain; InterPro: IPR001025 The BAH (brom 99.57
PRK05642234 DNA replication initiation factor; Validated 99.57
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.56
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 99.56
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.56
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.55
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.55
PF00004132 AAA: ATPase family associated with various cellula 99.55
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.54
PRK04132846 replication factor C small subunit; Provisional 99.52
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.51
PRK09112351 DNA polymerase III subunit delta'; Validated 99.51
CHL00095 821 clpC Clp protease ATP binding subunit 99.49
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.49
PRK06620214 hypothetical protein; Validated 99.48
PRK07940394 DNA polymerase III subunit delta'; Validated 99.48
PRK09087226 hypothetical protein; Validated 99.47
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.47
PHA02544316 44 clamp loader, small subunit; Provisional 99.47
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.46
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.45
KOG1827629 consensus Chromatin remodeling complex RSC, subuni 99.45
cd04715159 BAH_Orc1p_like BAH, or Bromo Adjacent Homology dom 99.45
cd04709164 BAH_MTA BAH, or Bromo Adjacent Homology domain, as 99.44
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 99.44
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.42
cd04712130 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, 99.42
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.41
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.41
KOG2543438 consensus Origin recognition complex, subunit 5 [R 99.38
PRK07471365 DNA polymerase III subunit delta'; Validated 99.38
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.38
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.38
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 99.36
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 99.36
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.36
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.36
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.35
cd04708202 BAH_plantDCM_II BAH, or Bromo Adjacent Homology do 99.35
PRK07399314 DNA polymerase III subunit delta'; Validated 99.34
PRK10865 857 protein disaggregation chaperone; Provisional 99.33
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.32
PRK05564313 DNA polymerase III subunit delta'; Validated 99.32
PRK05707328 DNA polymerase III subunit delta'; Validated 99.32
PRK13531 498 regulatory ATPase RavA; Provisional 99.31
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 99.3
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.29
cd04760124 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain 99.29
PRK08058329 DNA polymerase III subunit delta'; Validated 99.28
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.28
cd04711137 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domai 99.28
cd04720179 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology do 99.27
PRK07993334 DNA polymerase III subunit delta'; Validated 99.27
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 99.26
PRK06871325 DNA polymerase III subunit delta'; Validated 99.25
PRK08769319 DNA polymerase III subunit delta'; Validated 99.24
PRK10865857 protein disaggregation chaperone; Provisional 99.23
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 99.23
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.22
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.22
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.22
COG0470325 HolB ATPase involved in DNA replication [DNA repli 99.21
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.21
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.21
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 99.21
KOG1969 877 consensus DNA replication checkpoint protein CHL12 99.19
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.19
CHL00095821 clpC Clp protease ATP binding subunit 99.19
PRK06964342 DNA polymerase III subunit delta'; Validated 99.19
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 99.18
KOG0825 1134 consensus PHD Zn-finger protein [General function 99.18
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 99.18
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 99.18
KOG0736 953 consensus Peroxisome assembly factor 2 containing 99.17
PRK06090319 DNA polymerase III subunit delta'; Validated 99.16
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.16
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 99.14
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 99.13
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.13
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 99.12
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 99.11
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.11
cd04710135 BAH_fungalPHD BAH, or Bromo Adjacent Homology doma 99.11
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.1
PRK11608326 pspF phage shock protein operon transcriptional ac 99.1
COG2204464 AtoC Response regulator containing CheY-like recei 99.09
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.09
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.08
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.07
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 99.05
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 99.05
COG0714329 MoxR-like ATPases [General function prediction onl 99.03
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.03
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.02
PRK15424538 propionate catabolism operon regulatory protein Pr 99.0
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.99
COG1221403 PspF Transcriptional regulators containing an AAA- 98.98
KOG1244336 consensus Predicted transcription factor Requiem/N 98.98
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.98
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 98.97
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 98.97
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.97
PRK07276290 DNA polymerase III subunit delta'; Validated 98.96
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 98.96
smart00350509 MCM minichromosome maintenance proteins. 98.94
cd0876887 Cdc6_C Winged-helix domain of essential DNA replic 98.94
COG3829560 RocR Transcriptional regulator containing PAS, AAA 98.94
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 98.92
cd04719128 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology d 98.91
PRK07132299 DNA polymerase III subunit delta'; Validated 98.88
KOG1973274 consensus Chromatin remodeling protein, contains P 98.88
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.87
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 98.87
PRK15115444 response regulator GlrR; Provisional 98.86
PF0907985 Cdc6_C: CDC6, C terminal ; InterPro: IPR015163 The 98.86
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.84
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 98.84
PRK08116268 hypothetical protein; Validated 98.83
PRK13765 637 ATP-dependent protease Lon; Provisional 98.83
PRK05917290 DNA polymerase III subunit delta'; Validated 98.82
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.81
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.81
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 98.8
PRK05818261 DNA polymerase III subunit delta'; Validated 98.79
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.78
KOG0745564 consensus Putative ATP-dependent Clp-type protease 98.77
PRK08699325 DNA polymerase III subunit delta'; Validated 98.77
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.75
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 98.74
KOG4299613 consensus PHD Zn-finger protein [General function 98.73
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.73
PTZ00111915 DNA replication licensing factor MCM4; Provisional 98.73
PRK12377248 putative replication protein; Provisional 98.72
PHA02244383 ATPase-like protein 98.72
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.72
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 98.71
PRK06835329 DNA replication protein DnaC; Validated 98.7
PF14516331 AAA_35: AAA-like domain 98.7
PRK07952244 DNA replication protein DnaC; Validated 98.7
PF05729166 NACHT: NACHT domain 98.68
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.68
PRK09862506 putative ATP-dependent protease; Provisional 98.68
smart00382148 AAA ATPases associated with a variety of cellular 98.67
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 98.63
PF14629203 ORC4_C: Origin recognition complex (ORC) subunit 4 98.63
COG3283511 TyrR Transcriptional regulator of aromatic amino a 98.62
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.61
PRK06921266 hypothetical protein; Provisional 98.61
PF07726131 AAA_3: ATPase family associated with various cellu 98.56
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.54
KOG1886464 consensus BAH domain proteins [Transcription] 98.51
PRK08181269 transposase; Validated 98.49
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 98.45
PRK10365441 transcriptional regulatory protein ZraR; Provision 98.45
PF13173128 AAA_14: AAA domain 98.42
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.42
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 98.39
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.37
KOG1512381 consensus PHD Zn-finger protein [General function 98.36
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.35
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.33
KOG0482721 consensus DNA replication licensing factor, MCM7 c 98.31
PRK06581263 DNA polymerase III subunit delta'; Validated 98.3
COG1241682 MCM2 Predicted ATPase involved in replication cont 98.29
KOG1968 871 consensus Replication factor C, subunit RFC1 (larg 98.28
PTZ00202550 tuzin; Provisional 98.28
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 98.26
PRK08939306 primosomal protein DnaI; Reviewed 98.26
PRK06526254 transposase; Provisional 98.22
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 98.19
COG4650531 RtcR Sigma54-dependent transcription regulator con 98.16
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.15
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.12
KOG0480764 consensus DNA replication licensing factor, MCM6 c 98.11
PRK14700300 recombination factor protein RarA; Provisional 98.09
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.07
KOG0478804 consensus DNA replication licensing factor, MCM4 c 98.07
KOG0383696 consensus Predicted helicase [General function pre 98.02
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.0
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.98
PRK05574340 holA DNA polymerase III subunit delta; Reviewed 97.98
PRK09183259 transposase/IS protein; Provisional 97.97
PF10923416 DUF2791: P-loop Domain of unknown function (DUF279 97.96
COG3899 849 Predicted ATPase [General function prediction only 97.96
PHA00729226 NTP-binding motif containing protein 97.92
KOG0957707 consensus PHD finger protein [General function pre 97.91
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 97.87
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 97.87
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 97.84
PRK10536262 hypothetical protein; Provisional 97.82
PRK04841 903 transcriptional regulator MalT; Provisional 97.81
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 97.8
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 97.79
PRK00771437 signal recognition particle protein Srp54; Provisi 97.77
PRK06585343 holA DNA polymerase III subunit delta; Reviewed 97.76
PRK08485206 DNA polymerase III subunit delta'; Validated 97.76
PRK07452326 DNA polymerase III subunit delta; Validated 97.76
KOG0954893 consensus PHD finger protein [General function pre 97.75
KOG2170344 consensus ATPase of the AAA+ superfamily [General 97.74
TIGR01128302 holA DNA polymerase III, delta subunit. subunit ar 97.74
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.73
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 97.72
KOG0956 900 consensus PHD finger protein AF10 [General functio 97.67
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.67
PRK12608380 transcription termination factor Rho; Provisional 97.64
PRK09376416 rho transcription termination factor Rho; Provisio 97.63
KOG4443694 consensus Putative transcription factor HALR/MLL3, 97.62
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.61
TIGR00767415 rho transcription termination factor Rho. Members 97.59
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.59
cd01128249 rho_factor Transcription termination factor rho is 97.59
KOG0477854 consensus DNA replication licensing factor, MCM2 c 97.59
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.57
PHA02624647 large T antigen; Provisional 97.56
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 97.56
PHA02774613 E1; Provisional 97.56
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 97.54
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.53
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.53
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.52
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 97.44
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.42
PRK13695174 putative NTPase; Provisional 97.41
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 97.38
COG5141669 PHD zinc finger-containing protein [General functi 97.37
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.37
KOG0481729 consensus DNA replication licensing factor, MCM5 c 97.33
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.32
PRK05629318 hypothetical protein; Validated 97.32
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 97.32
cd00983325 recA RecA is a bacterial enzyme which has roles in 97.31
PRK04296190 thymidine kinase; Provisional 97.3
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.3
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.29
PTZ00494664 tuzin-like protein; Provisional 97.29
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.27
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 97.27
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.25
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.24
PF12780268 AAA_8: P-loop containing dynein motor region D4; I 97.24
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 97.23
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 97.23
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 97.22
TIGR01613304 primase_Cterm phage/plasmid primase, P4 family, C- 97.21
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.21
PRK15455 644 PrkA family serine protein kinase; Provisional 97.21
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.19
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.16
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.16
PRK11823446 DNA repair protein RadA; Provisional 97.16
COG1485367 Predicted ATPase [General function prediction only 97.16
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 97.11
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.11
PRK06067234 flagellar accessory protein FlaH; Validated 97.1
COG4088261 Predicted nucleotide kinase [Nucleotide transport 97.1
PRK09354349 recA recombinase A; Provisional 97.09
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 97.05
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 96.99
TIGR02688449 conserved hypothetical protein TIGR02688. Members 96.99
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.95
PRK14974336 cell division protein FtsY; Provisional 96.94
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 96.93
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.92
PRK08118167 topology modulation protein; Reviewed 96.92
COG4619223 ABC-type uncharacterized transport system, ATPase 96.91
PRK10867433 signal recognition particle protein; Provisional 96.91
PF07034330 ORC3_N: Origin recognition complex (ORC) subunit 3 96.89
PLN02674244 adenylate kinase 96.89
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.88
PRK07914320 hypothetical protein; Reviewed 96.87
KOG0479 818 consensus DNA replication licensing factor, MCM3 c 96.86
cd01393226 recA_like RecA is a bacterial enzyme which has rol 96.85
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.8
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 96.78
PF07088 484 GvpD: GvpD gas vesicle protein; InterPro: IPR00978 96.76
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 96.75
KOG2383467 consensus Predicted ATPase [General function predi 96.73
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 96.7
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 96.69
PRK04328249 hypothetical protein; Provisional 96.68
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.67
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.66
TIGR00959428 ffh signal recognition particle protein. This mode 96.66
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 96.66
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.65
COG2842297 Uncharacterized ATPase, putative transposase [Gene 96.64
cd01394218 radB RadB. The archaeal protein radB shares simila 96.64
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 96.63
PF05272198 VirE: Virulence-associated protein E; InterPro: IP 96.62
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 96.61
COG4178604 ABC-type uncharacterized transport system, permeas 96.6
KOG1808 1856 consensus AAA ATPase containing von Willebrand fac 96.6
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.59
PF1324576 AAA_19: Part of AAA domain 96.58
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 96.57
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 96.55
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 96.53
PRK05973237 replicative DNA helicase; Provisional 96.52
PRK07261171 topology modulation protein; Provisional 96.48
PRK14532188 adenylate kinase; Provisional 96.45
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 96.45
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 96.43
PRK13808333 adenylate kinase; Provisional 96.41
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 96.41
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.36
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 96.32
smart00487201 DEXDc DEAD-like helicases superfamily. 96.3
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 96.28
PRK14709469 hypothetical protein; Provisional 96.27
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 96.26
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 96.21
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.19
PRK102631355 DNA translocase FtsK; Provisional 96.19
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 96.18
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 96.15
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 96.12
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 96.12
PRK00131175 aroK shikimate kinase; Reviewed 96.11
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 96.11
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.1
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 96.09
COG1466334 HolA DNA polymerase III, delta subunit [DNA replic 96.08
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 96.08
PRK06696223 uridine kinase; Validated 96.07
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 96.04
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 96.02
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 96.02
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.01
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 95.99
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 95.97
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 95.95
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 95.94
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.93
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 95.92
PRK07078759 hypothetical protein; Validated 95.91
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.9
PRK09519 790 recA DNA recombination protein RecA; Reviewed 95.87
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 95.87
cd03115173 SRP The signal recognition particle (SRP) mediates 95.82
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.8
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.76
PRK03839180 putative kinase; Provisional 95.75
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 95.74
PF00154322 RecA: recA bacterial DNA recombination protein; In 95.73
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 95.71
PRK00625173 shikimate kinase; Provisional 95.7
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.7
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 95.69
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 95.69
COG1936180 Predicted nucleotide kinase (related to CMP and AM 95.67
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 95.65
PRK02496184 adk adenylate kinase; Provisional 95.64
PTZ00035337 Rad51 protein; Provisional 95.63
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 95.63
PRK06547172 hypothetical protein; Provisional 95.6
TIGR02236310 recomb_radA DNA repair and recombination protein R 95.59
PLN03186342 DNA repair protein RAD51 homolog; Provisional 95.58
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 95.54
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 95.54
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 95.53
TIGR00064272 ftsY signal recognition particle-docking protein F 95.53
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 95.53
COG2884223 FtsE Predicted ATPase involved in cell division [C 95.52
PRK13947171 shikimate kinase; Provisional 95.5
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 95.49
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 95.49
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 95.47
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 95.47
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 95.45
PLN02200234 adenylate kinase family protein 95.45
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 95.44
cd03246173 ABCC_Protease_Secretion This family represents the 95.44
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 95.43
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 95.42
PRK14530215 adenylate kinase; Provisional 95.4
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 95.39
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 95.39
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.37
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 95.37
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 95.37
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-65  Score=566.84  Aligned_cols=654  Identities=39%  Similarity=0.586  Sum_probs=524.0

Q ss_pred             cccccceeeeeeCCCccccCCccccccccCCCCCCc---cccccccceeecccccccccCccCCCccccccCCCCCCCCC
Q 003175          149 KKRRVYYKKVVYDDGEFEVGDDVYVKRREDASSDEE---DPEVEECRICFRAGRSVMLECDDCLGGFHLKCLKPPLKEVP  225 (842)
Q Consensus       149 p~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~C~~C~~~~~~~~l~Cd~C~~~~H~~C~~p~l~~~p  225 (842)
                      |.+|..+.+.......++.+++.|..+.........   ......|..|..+..+.+        .||+.|..+|+..++
T Consensus        99 ~~~~~~~~~l~~~~~~f~~~~~~ylt~~~~~~~~~~~~~v~~~~~es~w~~~~~~~~--------~~~~e~~~~k~v~i~  170 (767)
T KOG1514|consen   99 PDKRKLDVKLEFYEKKFEIGDNLYLTRELSEAKLESFIRVGQISDESQWNDSSIDKI--------RYICEPTAEKFVPIN  170 (767)
T ss_pred             cchhhccccceeccccccccchhhhhhhhhhhhhcccccccccccccccccccchhh--------eeecCCCCCCceecc
Confidence            445555666666667777777766554443332222   223345777776654333        899999999999999


Q ss_pred             CCCcccccccccccCcc--ccCCCCCCCCcccccccccccchhhhhhhhhceeeccCCceEEEEEeecCCcccccCCCCC
Q 003175          226 EGEWVCEFCEARKLGKK--IELPKPPEGKKRVRTMREKLLSSDLWAANIQSMWKEVDGNYWCRVFWYMIPEETAAGRQPH  303 (842)
Q Consensus       226 ~~~W~C~~C~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~I~~i~~~~~g~~~~~~~w~~~peEt~~~~~~~  303 (842)
                      .++|.|..|..+.....  ...+..|...+...+..+.......|...+...|..               -+|-++...+
T Consensus       171 ~~~~~~~~~e~~~s~~~e~~~~~~~p~~kk~~k~~~~~~~~d~~~~~~~~~~~r~---------------~d~t~~~ds~  235 (767)
T KOG1514|consen  171 IVRLICRVKEVEPSQSSEYLKSPSSPEKKKSAKTGKEKKSADDDVANGIDPSDRG---------------TDTTHPTDSS  235 (767)
T ss_pred             ceeEEEeecccCcccchhhhcCCCCccccccccccCcccCcchhhhcccchhccc---------------cccCCCCCch
Confidence            99999999987765543  355566666655555566555555544444444432               2334455566


Q ss_pred             cccccccccCCccccccchhccceeeeCcccccccccCCCCEEEEeeEEecCccceeecccCCccchhhccCchhhhhcc
Q 003175          304 NLRRELYRTNDFANIEMESIIRHCSVMSPKDFVKANDQGDDIFLCEYEYDIHWHSFKRIADIDKEEEVEDADSDEDWKSS  383 (842)
Q Consensus       304 ~~~~Evf~s~~~d~~~~~~I~~kc~V~~~~~y~~~~~~~~~~~~C~~~y~~~~~~fk~i~~~~~~~~~e~~~~~~~~~~~  383 (842)
                      ....+.+++..++.+.+++++.++.+-.++........+.+.|+|++.++..|-.+++++.-.+...++.  .++.++..
T Consensus       236 ~~~~~~~is~d~~p~~~e~~~~~~~~~~~kk~s~s~~~g~~~~~~~~~~ei~~~~~sR~a~~~~~~~~e~--~d~ed~~~  313 (767)
T KOG1514|consen  236 KIKQKRRISNDYEPIEEEEVLSEENGKEPKKTSVSRVDGRENFLKESNPEISKVSKSRGAEGADFFGDED--SDQEDNGN  313 (767)
T ss_pred             hhHHhhhhhccccchhhhhcccccccCCccccccccccCCcccccCCcccccccchhccccccccccccc--cchhhccC
Confidence            6778889999999999999999999888888887777889999999999999999999886654222222  33333322


Q ss_pred             ccCCCCCccccccccccCCCCCCCCCCcc--ccccCCc--cccccccccccccccCcccccCcc---cHHHHHHHhcccc
Q 003175          384 KAADSDTDEDMEFEDEDGKHLHTGPSPAH--ELAANSQ--RGRFFGLQKIGRKRIPEHVRCHKQ---TELERAKATLLLA  456 (842)
Q Consensus       384 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~--~~~~~~~~~~~~~~~p~~~~~~~~---~~~~~~~~~L~~~  456 (842)
                      ...+.++....+.... ..++++..+...  ...+++|  .++...++..+.......+..+++   ..++.+++.|+.+
T Consensus       314 ~~~~I~d~~~~~~e~~-tp~~~~r~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~r~~S~l~~ara~Lhls  392 (767)
T KOG1514|consen  314 GKPEIDDSDTKENEKQ-TPPFRTRRSSTKSYNRRASTPSRTGRSQPLQKTDLESRLDLVGLHQQRSASELSKARARLHLS  392 (767)
T ss_pred             CCcccCccchhhhccC-CCCccccccccccccccccCCccccccCcccccccccchhccchhhhhhhhHHHHHHHHhHHh
Confidence            1111111111111111 111222111111  1123344  233344455555555555666666   8999999999999


Q ss_pred             CCCCCCCCcHHHHHHHHHHHHHhhcCCcccCCeEEEEcCCCChHHHHHHHHHHHHHHHhhcCCCCCceEEEEecccCCCh
Q 003175          457 TLPKFLPCRNKEMEDITAFIKGATCDDQCLGRCLYIHGVPGTGKTMSVLAVMRSLRSEVESGSIRPYCFVEVNGLKLASP  536 (842)
Q Consensus       457 ~~p~~L~gRe~e~~~l~~~l~~~i~~~~~~~~~ili~GppGtGKT~l~~~v~~~l~~~~~~~~~~~~~~v~in~~~~~s~  536 (842)
                      .+|+.|+|||.|+.+|+.|++.++.. ...+.++||+|.||||||++|+.|++.|......+++|.|.|++|||+.+.++
T Consensus       393 ~vp~sLpcRe~E~~~I~~f~~~~i~~-~~~g~~mYIsGvPGtGKT~tV~~Vm~~Lq~~s~~~e~p~f~yveINgm~l~~~  471 (767)
T KOG1514|consen  393 AVPESLPCRENEFSEIEDFLRSFISD-QGLGSCMYISGVPGTGKTATVLEVMKELQTSSAQKELPKFDYVEINGLRLASP  471 (767)
T ss_pred             hccccccchhHHHHHHHHHHHhhcCC-CCCceeEEEecCCCCCceehHHHHHHHHHHHHhhcCCCCccEEEEcceeecCH
Confidence            99999999999999999999999988 33578999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhCCCCCHHHHHHHHHHHhhcccCCCCCCCCcEEEEEecCcccccCChHHHHHhhcCCCCCCCcEEEEEE
Q 003175          537 ENIYRVIYEALSGHRVSWKKALHSLNERFLDGKKIGKEDDRPCILLIDELDLLVTRNQSVLYNILDWPTKPNSKLIVIGI  616 (842)
Q Consensus       537 ~~~~~~i~~~l~g~~~~~~~~~~~L~~~f~~~~~~~~~~~~~~IlilDEid~L~~~~~~~L~~ll~~~~~~~~~vivI~~  616 (842)
                      .++|..||+.+.|+++++..+++.|..+|...    +....++||+|||+|.|.+++|++||++|+|+..++++++||++
T Consensus       472 ~~~Y~~I~~~lsg~~~~~~~al~~L~~~f~~~----k~~~~~~VvLiDElD~Lvtr~QdVlYn~fdWpt~~~sKLvvi~I  547 (767)
T KOG1514|consen  472 REIYEKIWEALSGERVTWDAALEALNFRFTVP----KPKRSTTVVLIDELDILVTRSQDVLYNIFDWPTLKNSKLVVIAI  547 (767)
T ss_pred             HHHHHHHHHhcccCcccHHHHHHHHHHhhccC----CCCCCCEEEEeccHHHHhcccHHHHHHHhcCCcCCCCceEEEEe
Confidence            99999999999999999999999999999833    34568899999999999999999999999999999999999999


Q ss_pred             eCCCCCccccch-hhhccCCceeEEecCCCHHHHHHHHHHHhcCcccCcHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHH
Q 003175          617 ANTMDLPEKLLP-RISSRMGVQRLCFGPYNHQQLQEIISSRLKGIEAFEKQAIEFASRKVAAISGDARRALEICRRAAEI  695 (842)
Q Consensus       617 tn~~dl~~~l~~-~l~sR~~~~~i~f~p~~~~e~~~Il~~~l~~~~~~~~~~l~~ia~~~~~~~Gd~R~al~ll~~A~~~  695 (842)
                      +|++|++++++. ++.||++.++|.|.||+++|+++|+..||.+...|++++++++++++++.+||+|+|+++|++|+++
T Consensus       548 aNTmdlPEr~l~nrvsSRlg~tRi~F~pYth~qLq~Ii~~RL~~~~~f~~~aielvarkVAavSGDaRraldic~RA~Ei  627 (767)
T KOG1514|consen  548 ANTMDLPERLLMNRVSSRLGLTRICFQPYTHEQLQEIISARLKGLDAFENKAIELVARKVAAVSGDARRALDICRRAAEI  627 (767)
T ss_pred             cccccCHHHHhccchhhhccceeeecCCCCHHHHHHHHHHhhcchhhcchhHHHHHHHHHHhccccHHHHHHHHHHHHHH
Confidence            999999999876 9999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhhccCCCcCCcCCCcccHHHHHHHHHHHhhChHHHHHhhCchHHHHHHHHHHHHHHHcCCcceeHHHHHHHHHH
Q 003175          696 ADYRIKKQTSNKNSASVGKSLVGMADVEAAIQEMFQAPHIQVMKSCSKLSKIFLTAMVYELYKTGMGETNFEKLAMTVSS  775 (842)
Q Consensus       696 A~~~~~~~~~~~~~~~~~~~~It~~dv~~A~~~~~~~~~~~~l~~ls~~~kliL~a~~~~~~~~g~~~~~~~~v~~~y~~  775 (842)
                      |+.+..+      ........|++.||.+|+++++.+.+...|++|+.++++||.|++.++.++|..+.+|.+||..+..
T Consensus       628 a~~~~~~------~k~~~~q~v~~~~v~~Ai~em~~~~~~~~i~glS~~~k~fl~ai~~e~~~~g~~e~~~~~v~~~~~~  701 (767)
T KOG1514|consen  628 AEERNVK------GKLAVSQLVGILHVMEAINEMLASPYIKALKGLSFLQKIFLTAIVAETEGTGLEEATLDEVYSEVVT  701 (767)
T ss_pred             hhhhccc------ccccccceeehHHHHHHHHHHhhhhHHHHhcchHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHH
Confidence            9877431      1223457899999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCCCCCHHHHHHHH--HHhcccceEEecCCCCCCceEEEEecCHHHHHHHHhcCCCCchhh
Q 003175          776 LCTSNGEIFPSWDALLRVG--CKLGECRIILCEPGSRHRLQKLQLNFPSDDVAFALKDSKDLPWLA  839 (842)
Q Consensus       776 ~~~~~~~~~~~~~~~~~~~--~~L~~~~li~~~~g~~~r~~~i~l~~~~~dv~~al~~~~~l~~l~  839 (842)
                      +|+.++...+..+....+|  +.|+..+|++...+...+.++|.|+++.+|+..||++|.+++|+.
T Consensus       702 i~~~~~~~~~~~~~~~~i~~~~~l~~e~l~l~~~~~~~r~~~v~L~~~~~ei~~A~~~d~e~~~~~  767 (767)
T KOG1514|consen  702 ICRKNGGPKPSSDIAKVICGVNDLGSERLVLVEPEENDRSLRVKLNIPSDEIKYALKDDEELANMA  767 (767)
T ss_pred             HHHhcCCCCccHHHHHHHHhhhhccccceEEEecCccchhhhhhcCCCHHHHHHHhhcchhhccCC
Confidence            9999998888888877777  889999999999889999999999999999999999999999874

>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04717 BAH_polybromo BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04716 BAH_plantDCM_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>cd04714 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04721 BAH_plant_1 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>smart00439 BAH Bromo adjacent homology domain Back     alignment and domain information
>cd04370 BAH BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>cd04713 BAH_plant_3 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PF01426 BAH: BAH domain; InterPro: IPR001025 The BAH (bromo-adjacent homology) family contains proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 from INTERPRO, the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>cd04715 BAH_Orc1p_like BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins Back     alignment and domain information
>cd04709 BAH_MTA BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd04712 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>cd04708 BAH_plantDCM_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04760 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd04711 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>cd04720 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04710 BAH_fungalPHD BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>cd08768 Cdc6_C Winged-helix domain of essential DNA replication protein Cell division control protein (Cdc6), which mediates DNA binding Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd04719 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PF09079 Cdc6_C: CDC6, C terminal ; InterPro: IPR015163 The C-terminal domain of CDC6 assumes a winged helix fold, with a five alpha-helical bundle (alpha15-alpha19) structure, backed on one side by three beta strands (beta6-beta8) Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14629 ORC4_C: Origin recognition complex (ORC) subunit 4 C-terminus Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>KOG1886 consensus BAH domain proteins [Transcription] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>PRK14700 recombination factor protein RarA; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK05574 holA DNA polymerase III subunit delta; Reviewed Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF10923 DUF2791: P-loop Domain of unknown function (DUF2791); InterPro: IPR021228 This is a family of proteins found in archaea and bacteria Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK06585 holA DNA polymerase III subunit delta; Reviewed Back     alignment and domain information
>PRK08485 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07452 DNA polymerase III subunit delta; Validated Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>TIGR01128 holA DNA polymerase III, delta subunit Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK05629 hypothetical protein; Validated Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PTZ00494 tuzin-like protein; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PF07034 ORC3_N: Origin recognition complex (ORC) subunit 3 N-terminus; InterPro: IPR020795 The Origin Recognition Complex (ORC) is a six-subunit ATP-dependent DNA-binding complex encoded in yeast by ORC1-6 [] Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK07914 hypothetical protein; Reviewed Back     alignment and domain information
>KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>KOG2383 consensus Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>COG2842 Uncharacterized ATPase, putative transposase [General function prediction only] Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14709 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK10263 DNA translocase FtsK; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>COG1466 HolA DNA polymerase III, delta subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK07078 hypothetical protein; Validated Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query842
2qby_A386 Crystal Structure Of A Heterodimer Of Cdc6ORC1 INIT 4e-15
2v1u_A387 Structure Of The Aeropyrum Pernix Orc1 Protein In C 5e-13
2qby_B384 Crystal Structure Of A Heterodimer Of Cdc6ORC1 INIT 3e-09
1mm2_A61 Solution Structure Of The 2nd Phd Domain From Mi2b 1e-06
2puy_A60 Crystal Structure Of The Bhc80 Phd Finger Length = 3e-06
2kwj_A114 Solution Structures Of The Double Phd Fingers Of Hu 4e-06
3v43_A112 Crystal Structure Of Moz Length = 112 7e-06
2ln0_A110 Structure Of Moz Length = 110 8e-06
1mm3_A61 Solution Structure Of The 2nd Phd Domain From Mi2b 1e-05
2ysm_A111 Solution Structure Of The First And Second Phd Doma 1e-05
1xwh_A66 Nmr Structure Of The First Phd Finger Of Autoimmune 1e-05
2yql_A56 Solution Structure Of The Phd Domain In Phd Finger 1e-05
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 1e-05
2kft_A56 Nmr Solution Structure Of The First Phd Finger Doma 2e-05
1w4s_A174 Crystal Structure Of The Proximal Bah Domain Of Pol 3e-05
1f62_A51 Wstf-Phd Length = 51 4e-05
1fp0_A88 Solution Structure Of The Phd Domain From The Kap-1 9e-05
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 2e-04
2ro1_A189 Nmr Solution Structures Of Human Kap1 Phd Finger-Br 3e-04
2l5u_A61 Structure Of The First Phd Finger (Phd1) From Chd4 7e-04
3ask_A226 Structure Of Uhrf1 In Complex With Histone Tail Len 8e-04
>pdb|2QBY|A Chain A, Crystal Structure Of A Heterodimer Of Cdc6ORC1 INITIATORS Bound To Origin Dna (From S. Solfataricus) Length = 386 Back     alignment and structure 
Iteration: 1

 Score = 80.5 bits (197), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 113/215 (52%), Gaps = 16/215 (7%)
Query: 490 LYIHGVPGTGKTMSVLAVMRSLRSEVESGSIRPYCFVEVNGLKLASPENIYRVIYEALSG 549
           ++I+G+ GTGKT    AV++ + S++    +  +  V +N  ++ +P   YRV+ + L  
Sbjct: 48  IFIYGLTGTGKT----AVVKFVLSKLHKKFLGKFKHVYINTRQIDTP---YRVLADLLES 100
Query: 550 HRVSWKKALHSLNERFLDGKKIGKEDDRPCILLIDELDLLVTR-NQSVLYNILDWPTKPN 608
             V       S+ E +    K  ++     ++++DE+D  V + N  +LY +    ++ N
Sbjct: 101 LDVKVPFTGLSIAELYRRLVKAVRDYGSQVVIVLDEIDAFVKKYNDDILYKLSRINSEVN 160
Query: 609 -SKLIVIGIANTMDLPEKLLPRISSRMGVQRLCFGPYNHQQLQEIISSRLKGIEAFE--- 664
            SK+  IGI N +   + L PR+ S +  + + F PYN ++L++I++ R +   AF+   
Sbjct: 161 KSKISFIGITNDVKFVDLLDPRVKSSLSEEEIIFPPYNAEELEDILTKRAQM--AFKPGV 218
Query: 665 --KQAIEFASRKVAAISGDARRALEICRRAAEIAD 697
                I+  +   A   GDARRAL++ R + EIA+
Sbjct: 219 LPDNVIKLCAALAAREHGDARRALDLLRVSGEIAE 253
>pdb|2V1U|A Chain A, Structure Of The Aeropyrum Pernix Orc1 Protein In Complex With Dna Length = 387 Back     alignment and structure
>pdb|2QBY|B Chain B, Crystal Structure Of A Heterodimer Of Cdc6ORC1 INITIATORS Bound To Origin Dna (From S. Solfataricus) Length = 384 Back     alignment and structure
>pdb|1MM2|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b Length = 61 Back     alignment and structure
>pdb|2PUY|A Chain A, Crystal Structure Of The Bhc80 Phd Finger Length = 60 Back     alignment and structure
>pdb|2KWJ|A Chain A, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3 Bound To A Histone Peptide Containing Acetylation At Lysine 14 Length = 114 Back     alignment and structure
>pdb|3V43|A Chain A, Crystal Structure Of Moz Length = 112 Back     alignment and structure
>pdb|2LN0|A Chain A, Structure Of Moz Length = 110 Back     alignment and structure
>pdb|1MM3|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b With C- Terminal Loop Replaced By Corresponding Loop From Wstf Length = 61 Back     alignment and structure
>pdb|2YSM|A Chain A, Solution Structure Of The First And Second Phd Domain From MyeloidLYMPHOID OR MIXED-Lineage Leukemia Protein 3 Homolog Length = 111 Back     alignment and structure
>pdb|1XWH|A Chain A, Nmr Structure Of The First Phd Finger Of Autoimmune Regulator Protein (Aire1): Insights Into Apeced Length = 66 Back     alignment and structure
>pdb|2YQL|A Chain A, Solution Structure Of The Phd Domain In Phd Finger Protein 21a Length = 56 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|2KFT|A Chain A, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 56 Back     alignment and structure
>pdb|1F62|A Chain A, Wstf-Phd Length = 51 Back     alignment and structure
>pdb|1FP0|A Chain A, Solution Structure Of The Phd Domain From The Kap-1 Corepressor Length = 88 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|2RO1|A Chain A, Nmr Solution Structures Of Human Kap1 Phd Finger-Bromodomain Length = 189 Back     alignment and structure
>pdb|2L5U|A Chain A, Structure Of The First Phd Finger (Phd1) From Chd4 (Mi2b) Length = 61 Back     alignment and structure
>pdb|3ASK|A Chain A, Structure Of Uhrf1 In Complex With Histone Tail Length = 226 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query842
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 1e-87
2v1u_A387 Cell division control protein 6 homolog; DNA repli 8e-81
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 4e-79
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 6e-73
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 2e-72
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 2e-54
1w4s_A174 Polybromo, polybromo 1 protein; BAH, bromo-associa 8e-24
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 2e-18
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 4e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 4e-17
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 4e-17
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 6e-17
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 1e-16
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 3e-16
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 7e-16
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 3e-14
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 4e-14
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 7e-14
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 3e-04
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 4e-13
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 6e-13
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 8e-13
2k16_A75 Transcription initiation factor TFIID subunit 3; p 2e-12
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 4e-12
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 1e-11
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 2e-11
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 1e-08
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 1e-10
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 3e-10
2yt5_A66 Metal-response element-binding transcription facto 3e-10
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 3e-10
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 5e-10
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 3e-09
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 4e-09
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 5e-09
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 6e-09
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 1e-08
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 2e-08
1weu_A91 Inhibitor of growth family, member 4; structural g 3e-08
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 1e-07
4dov_A163 ORC1, origin recognition complex subunit 1; DNA re 2e-07
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 4e-07
3av4_A1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 6e-07
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 2e-05
1x4i_A70 Inhibitor of growth protein 3; structural genomics 7e-07
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 2e-06
3o70_A68 PHD finger protein 13; PHF13, structural genomics 2e-06
3swr_A1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 4e-06
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 1e-05
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 4e-06
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 1e-05
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 1e-05
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 2e-05
1wem_A76 Death associated transcription factor 1; structura 3e-05
1we9_A64 PHD finger family protein; structural genomics, PH 4e-05
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 9e-05
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 9e-05
1wee_A72 PHD finger family protein; structural genomics, PH 1e-04
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 1e-04
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 2e-04
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 3e-04
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 4e-04
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 6e-04
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
 Score =  282 bits (723), Expect = 1e-87
 Identities = 78/397 (19%), Positives = 163/397 (41%), Gaps = 29/397 (7%)

Query: 443 QTELERAKATLLLATLPKFLPCRNKEMEDITAFIKGATCDDQCLGRCLYIHGVPGTGKTM 502
            + +   +  LL   +P  LP R  ++  I + +     +++     ++I+G+ GTGKT 
Sbjct: 3   MSSIFINREYLLPDYIPDELPHREDQIRKIASILAPLYREEK--PNNIFIYGLTGTGKTA 60

Query: 503 SVLAVMRSLRSEVESGSIRPYCFVEVNGLKLASPENIYRVIYEALSGHRVSWKKALHSLN 562
            V  V+  L  +        +  V +N  ++ +P  +   + E+L         ++  L 
Sbjct: 61  VVKFVLSKLHKKFLG----KFKHVYINTRQIDTPYRVLADLLESLDVKVPFTGLSIAELY 116

Query: 563 ERFLDGKKIGKEDDRPCILLIDELDLLVTRNQSVLYNILDWPTK-PNSKLIVIGIANTMD 621
            R +  K +     +  I+L +    +   N  +LY +    ++   SK+  IGI N + 
Sbjct: 117 RRLV--KAVRDYGSQVVIVLDEIDAFVKKYNDDILYKLSRINSEVNKSKISFIGITNDVK 174

Query: 622 LPEKLLPRISSRMGVQRLCFGPYNHQQLQEIISSRLKGI---EAFEKQAIEFASRKVAAI 678
             + L PR+ S +  + + F PYN ++L++I++ R +            I+  +   A  
Sbjct: 175 FVDLLDPRVKSSLSEEEIIFPPYNAEELEDILTKRAQMAFKPGVLPDNVIKLCAALAARE 234

Query: 679 SGDARRALEICRRAAEIADYRIKKQTSNKNSASVGKSLVGMADVEAAIQEMFQAPHIQVM 738
            GDARRAL++ R + EIA+                 + V    V  A +E+ +     ++
Sbjct: 235 HGDARRALDLLRVSGEIAERM-------------KDTKVKEEYVYMAKEEIERDRVRDII 281

Query: 739 KSCSKLSKIFLTAMVYELYKTGMGETNFEKLAMTVSSLCTSNGEIFPSWDALLRVGCKLG 798
            +    SK+ L A+V  +       +    +  T  ++C   G    +   +  +  +L 
Sbjct: 282 LTLPFHSKLVLMAVV-SISSEENVVSTTGAVYETYLNICKKLGVEAVTQRRVSDIINELD 340

Query: 799 ECRIILCE---PGSRHRLQKLQLNFPSDDVAFALKDS 832
              I+  +    G   + +++ L    + +  +L +S
Sbjct: 341 MVGILTAKVVNRGRYGKTKEIGLAVDKNIIVRSLIES 377
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Length = 387 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Length = 318 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Length = 412 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Length = 90 Back     alignment and structure
>4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Length = 163 Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 354 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Length = 189 Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query842
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 100.0
2v1u_A387 Cell division control protein 6 homolog; DNA repli 100.0
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 100.0
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 100.0
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 100.0
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.97
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.91
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.9
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.89
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.88
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.88
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.87
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.85
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.83
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.82
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.82
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.82
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.8
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 99.79
1w4s_A174 Polybromo, polybromo 1 protein; BAH, bromo-associa 99.79
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.78
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.78
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.78
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.78
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.77
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.77
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.77
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.76
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.76
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.76
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.75
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.75
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.75
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.74
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.74
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.74
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.73
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.73
3pvs_A447 Replication-associated recombination protein A; ma 99.72
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.71
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.71
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.71
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.7
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.7
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.69
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.69
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.69
3bos_A242 Putative DNA replication factor; P-loop containing 99.68
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.68
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.68
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.67
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.67
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 99.66
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.66
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.66
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.64
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.62
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.62
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.57
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.57
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.55
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.55
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.55
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.54
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.52
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.52
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.49
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.48
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.48
2gno_A305 DNA polymerase III, gamma subunit-related protein; 99.47
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.46
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.46
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.46
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.45
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.45
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 99.44
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.43
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.43
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.42
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.42
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.41
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.41
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.41
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.4
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.4
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.39
2fna_A357 Conserved hypothetical protein; structural genomic 99.38
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.38
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.35
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 99.32
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.32
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.31
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 99.3
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 99.3
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.3
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 99.26
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.26
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 99.25
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.24
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 99.24
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.23
2yt5_A66 Metal-response element-binding transcription facto 99.22
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.22
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.21
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.2
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 99.2
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 99.19
3co5_A143 Putative two-component system transcriptional RES 99.19
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 99.17
1weu_A91 Inhibitor of growth family, member 4; structural g 99.17
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 99.16
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 99.16
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 99.13
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.11
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 99.1
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.09
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 99.08
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 99.07
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.04
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.03
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.02
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 98.97
1x4i_A70 Inhibitor of growth protein 3; structural genomics 98.94
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.92
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.84
3o70_A68 PHD finger protein 13; PHF13, structural genomics 98.8
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.77
3swr_A1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 98.76
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.75
3f8t_A506 Predicted ATPase involved in replication control, 98.72
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.71
3av4_A1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 98.67
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 98.67
1wee_A72 PHD finger family protein; structural genomics, PH 98.67
1wem_A76 Death associated transcription factor 1; structura 98.65
4dov_A163 ORC1, origin recognition complex subunit 1; DNA re 98.65
1we9_A64 PHD finger family protein; structural genomics, PH 98.65
1wew_A78 DNA-binding family protein; structural genomics, P 98.64
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 98.63
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 98.59
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 98.59
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.59
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.56
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 98.45
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 98.45
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 98.41
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 98.39
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.35
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 98.34
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 98.33
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 98.33
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 98.27
2qgz_A308 Helicase loader, putative primosome component; str 98.23
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 98.23
1tue_A212 Replication protein E1; helicase, replication, E1E 98.22
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 98.15
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 98.12
3kv5_D488 JMJC domain-containing histone demethylation prote 97.96
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 97.83
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.83
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 97.78
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 97.78
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 97.74
1wil_A89 KIAA1045 protein; ring finger domain, structural g 97.68
3pur_A528 Lysine-specific demethylase 7 homolog; oxidoreduct 97.67
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.66
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 97.63
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.62
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 97.56
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.55
2fl7_A232 Regulatory protein SIR3; ORC, silencing, chromatin 97.44
1m4z_A238 Origin recognition complex subunit 1; DNA replicat 97.44
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.37
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.35
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.31
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.23
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.17
3kw6_A78 26S protease regulatory subunit 8; structural geno 97.16
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.15
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.14
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 97.14
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.09
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.07
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.05
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.97
2krk_A86 26S protease regulatory subunit 8; structural geno 96.96
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 96.94
3io5_A333 Recombination and repair protein; storage dimer, i 96.94
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 96.86
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 96.79
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 96.77
2z43_A324 DNA repair and recombination protein RADA; archaea 96.72
2r6a_A454 DNAB helicase, replicative helicase; replication, 96.71
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 96.71
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.69
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.68
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 96.66
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 96.66
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 96.63
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.6
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 96.57
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 96.56
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.55
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.55
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.55
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.45
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 96.44
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.43
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 96.42
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 96.41
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 96.41
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 96.23
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 96.2
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 96.15
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.13
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.06
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 96.03
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 95.87
3tlx_A243 Adenylate kinase 2; structural genomics, structura 95.87
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 95.8
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 95.71
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 95.68
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.66
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.65
3vaa_A199 Shikimate kinase, SK; structural genomics, center 95.63
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 95.61
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 95.59
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 95.55
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 95.53
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 95.53
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 95.51
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 95.47
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.46
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 95.45
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 95.42
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 95.39
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 95.38
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.38
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.31
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 95.27
3b6e_A216 Interferon-induced helicase C domain-containing P; 95.26
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 95.23
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 95.23
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 95.19
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 95.18
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 95.17
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 95.15
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.13
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 95.08
1via_A175 Shikimate kinase; structural genomics, transferase 95.07
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 95.01
3ice_A422 Transcription termination factor RHO; transcriptio 94.99
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 94.97
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 94.97
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.92
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 94.88
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 94.84
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 94.82
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 94.77
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.73
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.72
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 94.7
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 94.7
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 94.69
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 94.68
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.65
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.65
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 94.63
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 94.62
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 94.61
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.58
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 94.58
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 94.56
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.56
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 94.56
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 94.55
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 94.53
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 94.51
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 94.5
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.45
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 94.43
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 94.42
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 94.39
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.35
3bor_A237 Human initiation factor 4A-II; translation initiat 94.34
3t1o_A198 Gliding protein MGLA; G domain containing protein, 94.33
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 94.28
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 94.23
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 94.22
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 94.21
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 94.16
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 94.14
2vli_A183 Antibiotic resistance protein; transferase, tunica 94.08
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 94.08
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 94.08
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 94.06
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.06
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 94.05
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 94.05
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 93.96
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 93.96
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 93.95
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 93.95
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 93.95
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 93.89
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 93.88
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 93.88
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.87
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 93.85
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 93.81
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 93.8
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 93.77
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 93.73
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 93.7
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 93.69
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 93.67
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 93.64
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 93.63
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 93.61
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 93.6
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 93.6
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 93.59
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 93.55
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 93.53
2xxa_A433 Signal recognition particle protein; protein trans 93.51
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 93.49
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 93.47
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 93.45
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 93.44
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 93.41
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 93.35
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 93.35
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 93.27
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 93.27
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 93.25
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 93.24
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 93.19
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 93.15
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 93.14
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 93.12
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 93.0
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 92.9
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 92.89
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 92.88
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 92.87
3r20_A233 Cytidylate kinase; structural genomics, seattle st 92.78
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 92.75
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 92.74
2eyu_A261 Twitching motility protein PILT; pilus retraction 92.73
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 92.66
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 92.65
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 92.63
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 92.61
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 92.51
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 92.47
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 92.47
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 92.47
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 92.46
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 92.39
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 92.35
2ged_A193 SR-beta, signal recognition particle receptor beta 92.25
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 92.24
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 92.2
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 92.17
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 92.16
3lxw_A247 GTPase IMAP family member 1; immunity, structural 92.14
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 92.12
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 92.1
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 92.06
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 92.02
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 92.02
1xjc_A169 MOBB protein homolog; structural genomics, midwest 92.01
1p9r_A418 General secretion pathway protein E; bacterial typ 92.01
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 92.0
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 91.96
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 91.95
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 91.74
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 91.72
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 91.71
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 91.7
2og2_A359 Putative signal recognition particle receptor; nuc 91.7
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 91.58
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 91.58
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 91.49
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 91.47
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 91.47
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 91.43
1vma_A306 Cell division protein FTSY; TM0570, structural gen 91.39
2ewv_A372 Twitching motility protein PILT; pilus retraction 91.36
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 91.3
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 91.3
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 91.29
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 91.27
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 91.15
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 91.11
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 91.1
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 91.04
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 91.01
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 91.01
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 90.97
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 90.97
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 90.94
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 90.87
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 90.84
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 90.8
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 90.74
2oap_1511 GSPE-2, type II secretion system protein; hexameri 90.65
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 90.48
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 90.42
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 90.4
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 90.39
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 90.36
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 90.35
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 90.33
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 90.32
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 90.32
2hf9_A226 Probable hydrogenase nickel incorporation protein 90.25
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 90.21
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 90.13
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 90.05
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 90.0
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 89.98
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 89.97
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 89.93
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 89.81
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 89.73
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 89.73
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 89.71
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 89.67
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 89.67
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 89.65
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 89.63
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 89.47
1b0u_A262 Histidine permease; ABC transporter, transport pro 89.42
1sgw_A214 Putative ABC transporter; structural genomics, P p 89.39
3kta_A182 Chromosome segregation protein SMC; structural mai 89.35
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 89.3
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 89.25
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 89.25
3l0o_A427 Transcription termination factor RHO; helicase, RH 89.24
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 89.24
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 89.15
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 89.13
1g6h_A257 High-affinity branched-chain amino acid transport 89.11
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 89.1
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 89.1
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 89.08
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 89.06
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 89.0
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 88.98
2ghi_A260 Transport protein; multidrug resistance protein, M 88.98
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 88.95
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 88.92
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 88.89
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 88.88
1ji0_A240 ABC transporter; ATP binding protein, structural g 88.87
2ck3_A510 ATP synthase subunit alpha\, mitochondrial; hydrol 88.87
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 88.86
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 88.81
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 88.77
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 88.77
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 88.69
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 88.66
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 88.62
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 88.58
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 88.56
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 88.5
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 88.44
1yks_A440 Genome polyprotein [contains: flavivirin protease 88.42
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 88.36
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 88.34
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 88.34
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 88.21
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 88.18
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 88.16
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 88.15
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 88.1
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 88.03
2wji_A165 Ferrous iron transport protein B homolog; membrane 88.02
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 87.97
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 87.96
1nrj_B218 SR-beta, signal recognition particle receptor beta 87.96
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 87.95
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 87.94
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 87.94
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 87.93
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 87.9
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 87.89
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 87.86
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 87.82
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 87.81
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 87.74
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 87.72
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 87.71
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 87.71
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 87.7
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 87.67
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 87.66
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 87.61
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 87.57
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=5.1e-38  Score=337.15  Aligned_cols=272  Identities=20%  Similarity=0.293  Sum_probs=228.0

Q ss_pred             HHHhccccCCCCC-CCCcHHHHHHHHHHHHHhhcCCcccCCeEEEEcCCCChHHHHHHHHHHHHHHHhhcCCCCCceEEE
Q 003175          449 AKATLLLATLPKF-LPCRNKEMEDITAFIKGATCDDQCLGRCLYIHGVPGTGKTMSVLAVMRSLRSEVESGSIRPYCFVE  527 (842)
Q Consensus       449 ~~~~L~~~~~p~~-L~gRe~e~~~l~~~l~~~i~~~~~~~~~ili~GppGtGKT~l~~~v~~~l~~~~~~~~~~~~~~v~  527 (842)
                      .++.|+++|.|.. |+|||+|+++|..+|..++.++.  +.++||+||||||||++++.+++++......+.++.+.+++
T Consensus         8 ~~~~l~~~~~~~~~L~~Re~E~~~i~~~L~~~i~~~~--~~~lli~GpPGTGKT~~v~~v~~~L~~~~~~~~~~~~~~v~   85 (318)
T 3te6_A            8 LEESIRESLQKRELLKSQVEDFTRIFLPIYDSLMSSQ--NKLFYITNADDSTKFQLVNDVMDELITSSARKELPIFDYIH   85 (318)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTC--CCEEEEECCCSHHHHHHHHHHHHHHHHTTTTTSSCCEEEEE
T ss_pred             hhhhhhhccCCccccCCHHHHHHHHHHHHHHHhcCCC--CCeEEEECCCCCCHHHHHHHHHHHHHHHhhhccCCceEEEE
Confidence            3556777776666 99999999999999999999876  89999999999999999999999998776666667799999


Q ss_pred             EecccCCChHHHHHHHHHHHhCCCCCHHHHHHHHHHHhhcccCCCCCCCCcEEEEEecCcccccCChHHHHHhhcCCCCC
Q 003175          528 VNGLKLASPENIYRVIYEALSGHRVSWKKALHSLNERFLDGKKIGKEDDRPCILLIDELDLLVTRNQSVLYNILDWPTKP  607 (842)
Q Consensus       528 in~~~~~s~~~~~~~i~~~l~g~~~~~~~~~~~L~~~f~~~~~~~~~~~~~~IlilDEid~L~~~~~~~L~~ll~~~~~~  607 (842)
                      |||+.+.++..+|..|++++.|+..+.......|..+|....   ...+.++||||||+|.|.  .|++||++++|....
T Consensus        86 INc~~~~t~~~~~~~I~~~L~g~~~~~~~~~~~L~~~f~~~~---~~~~~~~ii~lDE~d~l~--~q~~L~~l~~~~~~~  160 (318)
T 3te6_A           86 IDALELAGMDALYEKIWFAISKENLCGDISLEALNFYITNVP---KAKKRKTLILIQNPENLL--SEKILQYFEKWISSK  160 (318)
T ss_dssp             EETTCCC--HHHHHHHHHHHSCCC--CCCCHHHHHHHHHHSC---GGGSCEEEEEEECCSSSC--CTHHHHHHHHHHHCS
T ss_pred             EeccccCCHHHHHHHHHHHhcCCCCCchHHHHHHHHHHHHhh---hccCCceEEEEecHHHhh--cchHHHHHHhccccc
Confidence            999999999999999999999876554445667777776531   123468999999999999  799999999998777


Q ss_pred             CCcEEEEEEeCCCCCccc-cchhhhccCCceeEEecCCCHHHHHHHHHHHhcCcc-------------------------
Q 003175          608 NSKLIVIGIANTMDLPEK-LLPRISSRMGVQRLCFGPYNHQQLQEIISSRLKGIE-------------------------  661 (842)
Q Consensus       608 ~~~vivI~~tn~~dl~~~-l~~~l~sR~~~~~i~f~p~~~~e~~~Il~~~l~~~~-------------------------  661 (842)
                      .++++||+++|++++++. +++++.|||..++|.|+||+.+|+.+||+.|+....                         
T Consensus       161 ~s~~~vI~i~n~~d~~~~~L~~~v~SR~~~~~i~F~pYt~~el~~Il~~Rl~~~~~~~f~~~~~~~~~~~~~~~~~~~~~  240 (318)
T 3te6_A          161 NSKLSIICVGGHNVTIREQINIMPSLKAHFTEIKLNKVDKNELQQMIITRLKSLLKPFHVKVNDKKEMTIYNNIREGQNQ  240 (318)
T ss_dssp             SCCEEEEEECCSSCCCHHHHHTCHHHHTTEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEECTTCCEEECCCC------
T ss_pred             CCcEEEEEEecCcccchhhcchhhhccCCceEEEeCCCCHHHHHHHHHHHHHhhhccccccccccccccccccccccccc
Confidence            889999999999999875 578999999878899999999999999999997531                         


Q ss_pred             -----------cCcHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHHhhhccCCCcCCcCCCcccHHHHHHHHHHHh
Q 003175          662 -----------AFEKQAIEFASRKVAAISGDARRALEICRRAAEIADYRIKKQTSNKNSASVGKSLVGMADVEAAIQEMF  730 (842)
Q Consensus       662 -----------~~~~~~l~~ia~~~~~~~Gd~R~al~ll~~A~~~A~~~~~~~~~~~~~~~~~~~~It~~dv~~A~~~~~  730 (842)
                                 .++++++++||++++..+||+|+||++|++|+++|+.+.......    ..+...||.+++.+++++++
T Consensus       241 ~~~~~~~~~~~~i~~~ai~~~A~~vA~~~GD~R~Al~ilr~A~~~ae~e~~~k~~~----~~~~~~i~~~~~~~~~~~~~  316 (318)
T 3te6_A          241 KIPDNVIVINHKINNKITQLIAKNVANVSGSTEKAFKICEAAVEISKKDFVRKGGL----QKGKLVVSQEMVPRYFSEAI  316 (318)
T ss_dssp             --CTTEEEECEECCHHHHHHHHHHHHHHHCSHHHHHHHHHHHHHHHHHHHHHHTTE----ETTEECCSEECCTHHHHHHH
T ss_pred             cccccccccccccCHHHHHHHHHHHHhhCChHHHHHHHHHHHHHHHHHHHHhccCC----CCCcEEeeHHHHHHHHHHHh
Confidence                       358999999999999999999999999999999999875433211    23557899999998888765


Q ss_pred             h
Q 003175          731 Q  731 (842)
Q Consensus       731 ~  731 (842)
                      +
T Consensus       317 ~  317 (318)
T 3te6_A          317 N  317 (318)
T ss_dssp             C
T ss_pred             c
Confidence            4
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2fl7_A Regulatory protein SIR3; ORC, silencing, chromatin, transcription; 1.85A {Saccharomyces cerevisiae} PDB: 2fvu_A 3tu4_K* Back     alignment and structure
>1m4z_A Origin recognition complex subunit 1; DNA replication, transcriptional silencing, chromatin, BAH D gene regulation; 2.20A {Saccharomyces cerevisiae} SCOP: b.34.12.1 PDB: 1zhi_A 1zbx_A Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 842
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 1e-24
d1m4za_217 b.34.12.1 (A:) Origin-recognition complex protein 3e-24
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 2e-22
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 5e-15
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 1e-14
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 2e-14
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 7e-12
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 2e-11
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 4e-10
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 3e-08
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 2e-07
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 7e-07
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 2e-06
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 2e-06
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 6e-06
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 8e-06
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 2e-05
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 2e-05
d1iqpa2231 c.37.1.20 (A:2-232) Replication factor C {Archaeon 1e-04
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 2e-04
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 0.004
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CDC6, N-domain
species: Archaeon Pyrobaculum aerophilum [TaxId: 13773]

 Score =  102 bits (254), Expect = 1e-24
 Identities = 49/282 (17%), Positives = 103/282 (36%), Gaps = 32/282 (11%)

Query: 458 LPKFLPCRNKEMEDITAFIKGATCDDQCLGRCLYIHGVPGTGKTMSVLAVMRSLRSEVES 517
           +PK LP R ++++ +   +     +         + G PGTGKT+++  +    + +  +
Sbjct: 14  VPKRLPHREQQLQQLDILLGNWLRNPGHHYPRATLLGRPGTGKTVTLRKLWELYKDKTTA 73

Query: 518 GSIRPYCFVEVNGLKLASPENIYRVIYEALSGHRVSWKKALHSLNERFLDGKKIGKEDDR 577
             +    F            N   +I E      + + +   S +E      +  +E D 
Sbjct: 74  RFVYINGF---------IYRNFTAIIGEIARSLNIPFPRRGLSRDEFLALLVEHLRERDL 124

Query: 578 PCILLIDELDLLVTRNQSVLYNILDW-PTKPNSKLIVIGIANTMDLPEKLLPRISSRMGV 636
              L++D+   L     S    +          ++ ++ + +   +   L P     MG 
Sbjct: 125 YMFLVLDDAFNLAPDILSTFIRLGQEADKLGAFRIALVIVGHNDAVLNNLDPSTRGIMGK 184

Query: 637 QRLCFGPYNHQQLQEIISSRLKGI---EAFEKQAIEFASRKVAAIS------GDARRALE 687
             + F PY   Q+ +I+  R K      ++ +  ++  +    A +      GDAR A++
Sbjct: 185 YVIRFSPYTKDQIFDILLDRAKAGLAEGSYSEDILQMIADITGAQTPLDTNRGDARLAID 244

Query: 688 ICRRAAEIADYRIKKQTSNKNSASVGKSLVGMADVEAAIQEM 729
           I  R+A  A                G+  +   DV  + +E+
Sbjct: 245 ILYRSAYAAQQN-------------GRKHIAPEDVRKSSKEV 273
>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 217 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 231 Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query842
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.94
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.93
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.88
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.87
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.85
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.84
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.81
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.79
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.79
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.78
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.78
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.78
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.77
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.74
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.67
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.67
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.66
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.66
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.52
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.47
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.42
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.39
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.38
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.36
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.36
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.32
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.29
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 99.29
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 99.25
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.21
d1m4za_217 Origin-recognition complex protein 120kDa subunit, 99.18
d1fnna1112 CDC6, C-terminal domain {Archaeon Pyrobaculum aero 99.16
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.15
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.11
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.09
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 98.97
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 98.95
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.92
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.92
d1w5sa1110 CDC6-like protein APE0152, C-terminal domain {Aero 98.88
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 98.86
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 98.83
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.62
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.61
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 98.47
d1wema_76 Death associated transcription factor 1, Datf1 (DI 98.42
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 98.41
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.01
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.86
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.38
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.15
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.08
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.06
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.04
d1tuea_205 Replication protein E1 helicase domain {Human papi 96.88
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.85
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.84
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.81
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.8
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.76
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.75
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.73
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 96.71
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 96.67
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.64
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.59
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.54
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.53
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.52
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.49
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 96.47
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.39
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.31
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.3
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.29
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.28
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.21
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.16
d2qy9a2211 GTPase domain of the signal recognition particle r 96.1
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.1
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.09
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.09
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 96.08
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.04
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.03
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.01
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.98
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.94
d1okkd2207 GTPase domain of the signal recognition particle r 95.93
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.9
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.9
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.88
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.83
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.83
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.81
d1vmaa2213 GTPase domain of the signal recognition particle r 95.75
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.66
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.62
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 95.62
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.59
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.52
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.49
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.48
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 95.35
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.35
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.29
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.23
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 95.23
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 95.1
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.9
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.75
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 94.7
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.68
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.66
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.6
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 94.48
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.44
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.41
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.41
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 94.25
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 94.07
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 93.78
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 93.63
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 93.6
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.43
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 93.37
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 93.32
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 93.1
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 93.07
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.92
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 92.82
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 92.68
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 92.36
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.32
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.32
d1xpua3289 Transcription termination factor Rho, ATPase domai 92.09
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 91.99
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 91.83
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 91.8
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 91.7
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 91.69
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 91.49
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 91.33
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.32
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 91.17
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 91.17
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.06
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 91.02
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 90.82
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 90.64
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 90.41
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 90.33
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 89.99
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 89.84
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 89.81
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 89.73
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 89.7
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 89.61
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 89.6
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 89.59
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 89.53
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 89.44
d2awna2232 Maltose transport protein MalK, N-terminal domain 89.44
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 89.43
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 89.41
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 89.35
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 89.34
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 89.28
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 89.27
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 89.22
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 89.16
d1nrjb_209 Signal recognition particle receptor beta-subunit 88.99
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 88.95
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 88.92
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 88.91
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 88.88
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 88.75
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 88.74
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.66
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 88.62
d1g2912240 Maltose transport protein MalK, N-terminal domain 88.6
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 88.58
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 88.51
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 88.44
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 88.42
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 88.38
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 88.35
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 88.28
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.22
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 88.17
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 88.17
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 88.15
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 88.03
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 87.99
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 87.98
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 87.94
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 87.88
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 87.88
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 87.84
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 87.76
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 87.76
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 87.63
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 87.53
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 87.53
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 87.5
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 87.47
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 87.43
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 87.3
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 87.22
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 87.21
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 87.08
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 87.0
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 86.89
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 86.79
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 86.67
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 86.66
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 86.35
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 86.05
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 85.99
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 85.97
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 85.89
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 85.87
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 85.87
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 85.54
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 85.52
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 85.46
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 85.35
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 85.32
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 85.32
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 85.24
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 85.14
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 85.13
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 84.98
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 84.56
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 84.34
d2hyda1255 Putative multidrug export ATP-binding/permease pro 84.3
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 84.15
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 83.9
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 83.54
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 83.35
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 83.16
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 82.91
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 82.7
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 82.48
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 82.44
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 82.31
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 81.88
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 81.82
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 81.63
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 81.61
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 81.39
d1f9va_342 Kinesin motor Ncd (non-claret disjunctional) {Bake 81.27
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 81.17
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 81.16
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 81.02
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 80.75
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 80.57
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 80.23
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 80.18
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 80.12
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CDC6, N-domain
species: Archaeon Pyrobaculum aerophilum [TaxId: 13773]

Probab=99.94  E-value=6.5e-26  Score=238.08  Aligned_cols=255  Identities=20%  Similarity=0.267  Sum_probs=204.3

Q ss_pred             HHhccccCCCCCCCCcHHHHHHHHHHHHHhhcCCcccCCeEEEEcCCCChHHHHHHHHHHHHHHHhhcCCCCCceEEEEe
Q 003175          450 KATLLLATLPKFLPCRNKEMEDITAFIKGATCDDQCLGRCLYIHGVPGTGKTMSVLAVMRSLRSEVESGSIRPYCFVEVN  529 (842)
Q Consensus       450 ~~~L~~~~~p~~L~gRe~e~~~l~~~l~~~i~~~~~~~~~ili~GppGtGKT~l~~~v~~~l~~~~~~~~~~~~~~v~in  529 (842)
                      +..|+++|+|+.|+|||.|++.|.++|...+.+....+++++|+||||||||++++.+++.+...      ..+.+++++
T Consensus         6 ~~~l~~~y~p~~l~~Re~ei~~l~~~l~~~l~~~~~~~~~lll~GppGtGKT~l~~~l~~~l~~~------~~~~~~~~~   79 (276)
T d1fnna2           6 DSVFSPSYVPKRLPHREQQLQQLDILLGNWLRNPGHHYPRATLLGRPGTGKTVTLRKLWELYKDK------TTARFVYIN   79 (276)
T ss_dssp             GGGGSTTCCCSCCTTCHHHHHHHHHHHHHHHHSTTSSCCEEEEECCTTSSHHHHHHHHHHHHTTS------CCCEEEEEE
T ss_pred             cccCCCCCCCCCCCCHHHHHHHHHHHHHHHHhCCCCCCCceEEECCCCCCHHHHHHHHHHHHhcc------cCCcEEEec
Confidence            46799999999999999999999999999887754457899999999999999999999998643      237799999


Q ss_pred             cccCCChHHHHHHHHHHHhCCC----CCHHHHHHHHHHHhhcccCCCCCCCCcEEEEEecCcccccCChHHHHHhhcCC-
Q 003175          530 GLKLASPENIYRVIYEALSGHR----VSWKKALHSLNERFLDGKKIGKEDDRPCILLIDELDLLVTRNQSVLYNILDWP-  604 (842)
Q Consensus       530 ~~~~~s~~~~~~~i~~~l~g~~----~~~~~~~~~L~~~f~~~~~~~~~~~~~~IlilDEid~L~~~~~~~L~~ll~~~-  604 (842)
                      |........++..+...+....    .........+.+.+...       ....++++|++|.+....+..+..++... 
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~  152 (276)
T d1fnna2          80 GFIYRNFTAIIGEIARSLNIPFPRRGLSRDEFLALLVEHLRER-------DLYMFLVLDDAFNLAPDILSTFIRLGQEAD  152 (276)
T ss_dssp             TTTCCSHHHHHHHHHHHTTCCCCSSCCCHHHHHHHHHHHHHHT-------TCCEEEEEETGGGSCHHHHHHHHHHTTCHH
T ss_pred             chhhhhhhhhhhhhHHhhhhhhhhhccchhHHHHHHHHHHhhc-------ccccccchhHHHHhhhhhhhhHHHHHhccc
Confidence            9999998888888777654322    12333334444333322       25678899999999876666666666532 


Q ss_pred             CCCCCcEEEEEEeCCCCCccccchhhhccCCceeEEecCCCHHHHHHHHHHHhcCc---ccCcHHHHHHHHHHHH-----
Q 003175          605 TKPNSKLIVIGIANTMDLPEKLLPRISSRMGVQRLCFGPYNHQQLQEIISSRLKGI---EAFEKQAIEFASRKVA-----  676 (842)
Q Consensus       605 ~~~~~~vivI~~tn~~dl~~~l~~~l~sR~~~~~i~f~p~~~~e~~~Il~~~l~~~---~~~~~~~l~~ia~~~~-----  676 (842)
                      .....++++|++++..++.+.+.+++.+|+....|.|++|+.+++.+||.+++...   ..+++++++++++.++     
T Consensus       153 ~~~~~~~~~i~~~~~~~~~~~~~~~~~~r~~~~~i~~~~~~~~e~~~il~~r~~~~~~~~~~~~~~l~~ia~~~~~~~~~  232 (276)
T d1fnna2         153 KLGAFRIALVIVGHNDAVLNNLDPSTRGIMGKYVIRFSPYTKDQIFDILLDRAKAGLAEGSYSEDILQMIADITGAQTPL  232 (276)
T ss_dssp             HHSSCCEEEEEEESSTHHHHTSCHHHHHHHTTCEEECCCCBHHHHHHHHHHHHHHHBCTTSSCHHHHHHHHHHHSBSSTT
T ss_pred             cccccceEEeecCCchhhhhhcchhhhhhhcchhccccchhHHHHHHHHHHHHHHhcccccccHHHHHHHHHHhhhhhhh
Confidence            23466789999999987788899999999877789999999999999999998742   3689999999988763     


Q ss_pred             -HHhcCHHHHHHHHHHHHHHHHHHHhhhccCCCcCCcCCCcccHHHHHHHHHHHh
Q 003175          677 -AISGDARRALEICRRAAEIADYRIKKQTSNKNSASVGKSLVGMADVEAAIQEMF  730 (842)
Q Consensus       677 -~~~Gd~R~al~ll~~A~~~A~~~~~~~~~~~~~~~~~~~~It~~dv~~A~~~~~  730 (842)
                       ...||+|.++++|+.|+..|..+             +...|+.+||++|+.++.
T Consensus       233 ~~~~G~~R~a~~ll~~a~~~A~~~-------------~~~~I~~edv~~A~~~~~  274 (276)
T d1fnna2         233 DTNRGDARLAIDILYRSAYAAQQN-------------GRKHIAPEDVRKSSKEVL  274 (276)
T ss_dssp             CTTSCCHHHHHHHHHHHHHHHHHT-------------TCSSCCHHHHHHHHHHHS
T ss_pred             hhcCCCHHHHHHHHHHHHHHHHHc-------------CCCCcCHHHHHHHHHHHh
Confidence             35799999999999999998866             357899999999998763
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna1 a.4.5.11 (A:277-388) CDC6, C-terminal domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w5sa1 a.4.5.11 (A:300-409) CDC6-like protein APE0152, C-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure