Citrus Sinensis ID: 003193


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840
MQSYEYSEDFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWGKNLTKLTVEKCGRLKFLFSSSMVNGLEQLQQLDISHCKSMNEVINTRVGRDDNMIEMVFPKLVSLQLSHLPKLTRFGIGDSVEFPSLCQLQIACCPNLKIFICSCTEEMSSEKNIHTTQTQPLFDEKVEVSFAATSSYIFILDLHILSFGFLLYFLASCFSFLRV
ccccccccEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccHHHHcccccccccHHHHHHHHHccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccccccccEEEccHHHHHHHHHHHcccEEEEcccccccccccccccccEEEEccccccccccccccccccEEEEEEccccccccccHHHcccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEcccccccccccHHHcccccccEEEccccccccccccccccccccccEEEcccccccEEEcccccccHHHccccccccEEEEEcccccccccccHHHHcccccEEEccccccccccccccEEEEEEEcccccccccccccccccccEEcccccccccccccccccccccccEEEEEcccccEEEccccccccccccccEEEEEccccccEEEEccccccccccccccccEEEEEcccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccEEcccccccccccccccccccccccEEEccccccEEccccccccccccccccEEEEEEccccccccccccccccccccEEEEEEcccccEEccccccccccccccccccccEEEEcccccccEEccccccccccccEEEEEccccccccccccccccccccEEEccccccccHHHHHcccccccccccccccccccccccccccccccccccc
cccccccccEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHcccccccccHHHEEcHcccccHHHHHHHHHHHHccccccEcHHHHHHHHHHHcHccccccccHHHHHHHHHHHHHHHccHcEcccccccEEHHHHHHHHHHHHHccccEEEEEccccccccccccccEEEEEEEcccccccccccccccccEEEEEccccccccccHHHHccccccEEEEEcccccccccccccccccccEEEccccccccccccccccccEEEEEcccccccccccHcccccccEEEEcccccccccccHHHcccccccEEEEEEccccccccccccccHHHHHcHHHccEEEcccccccccccHccHHHHHHcEEcccccccccccccccHHHHHHHHcccccccccccHcccccEEEEEcccccccccccccccccccccEEEEEccccccEEcccccccccccccccEEEEcccccHHHcccccccccccccccccccEEEEcccccHHccccccHHHccccccEEEEcccccccEcccccccccHHHHccccccccccccEcEccccccccEccccccccccccccccEEEccccccHcccccccccccccccEEEEccccccccccccccccccccccccEEEEccccccccccccHHHcccccccEEEEcccccHHEcccccccccccccccccccccEEEEcccccccccccccccccccccEEEEcccccccccccccccccHHHHHHccHHccHHccHcccccccHHHHHHHHHHHHHccHHHHcccccccccEEcc
MQSYEYSEDFLDWLLSNEEASHLFEKIVghsakksdfeTIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNqlsnsnprkiqgmdadLSSIELSYEFLKCKEVKSLFQLCgllkdgsriaVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLksasllfdgdsedhaKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELdkideaptaisipfrgiyelperlGFLKLKLFLFFTenlslqipdpffegmtELRVLDltgfrfhslpsslgclinlrtlslenclVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTclklldlsncsklkeirpnVISNLTRLEElymgnsftqwkvegqsnaslgelkqlsrlttlevhipdaqvmpqdLVFVELERFRICIgdvwswsdgyetsktLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILnsdgrvgtfpLLESLFLHNLInlekvcdgkvrlneddksfsNLRIIKVegchrvkhlfpFSLVKNLLQLqkvkvtdctnlklivgkesensahkngsisgvyFRKLHFlklqhlpqltssgfdletptntqgsnpgiiaegdpkdftslfnervvfpslkklklsSINVEKIWLNSFSAIESWGKnltkltvekcgrlkFLFSSSMVNGLEQLQQLDISHCKSMNEVIntrvgrddnmiEMVFPKLVSLQlshlpkltrfgigdsvefpslcqlqiaccpnlkiFICSCteemsseknihttqtqplfdekvevsfaatSSYIFILDLHILSFGFLLYFLASCFSFLRV
MQSYEYSEDFLDWLLSNEEASHLFEKIVghsakksdFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAvnqlsnsnprkiqGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIdeaptaisipfrgIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLsncsklkeirpnVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDvwswsdgyetsktlklqlNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLivgkesensahkngSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWGKNLTKLTVEKCGRLKFLFSSSMVNGLEQLQQLDISHCKSMNEVINTRVGRDDNMIEMVFPKLVSLQLSHLPKLTRFGIGDSVEFPSLCQLQIACCPNLKIFICSCTEEMSSEKNIHTTQTQPLFDEKVEVSFAATSSYIFILDLHILSFGFLLYFLASCFSFLRV
MQSYEYSEDFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGflklklflffTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSlvknllqlqkvkvTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWGKNLTKLTVEKCGRLKFLFSSSMVNGLEQLQQLDISHCKSMNEVINTRVGRDDNMIEMVFPKLVSLQLSHLPKLTRFGIGDSVEFPSLCQLQIACCPNLKIFICSCTEEMSSEKNIHTTQTQPLFDEKVEVSFAATSSYIFILDLHILSFGFLLYFLASCFSFLRV
*******EDFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAV****************DLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGK*********GSISGVYFRKLHFLKLQHLPQLT**************************DFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWGKNLTKLTVEKCGRLKFLFSSSMVNGLEQLQQLDISHCKSMNEVINTRVGRDDNMIEMVFPKLVSLQLSHLPKLTRFGIGDSVEFPSLCQLQIACCPNLKIFICSCTEE******IHTTQTQPLFDEKVEVSFAATSSYIFILDLHILSFGFLLYFLASCFSFL**
******SEDFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNQLSNSNPR**QG*DADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVW************KLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNE*DKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIV***************GVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWGKNLTKLTVEKCGRLKFLFSSSMVNGLEQLQQLDISHCKSMNEVINT*******M*EMVFPKLVSLQLSHLPKLTRFGIGDSVEFPSLCQLQIACCPNLK**************************************YIFILDLHILSFGFLLYFLASCFSFLRV
********DFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWGKNLTKLTVEKCGRLKFLFSSSMVNGLEQLQQLDISHCKSMNEVINTRVGRDDNMIEMVFPKLVSLQLSHLPKLTRFGIGDSVEFPSLCQLQIACCPNLKIFICSCTEEMSSEKNIHTTQTQPLFDEKVEVSFAATSSYIFILDLHILSFGFLLYFLASCFSFLRV
*****YSEDFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWGKNLTKLTVEKCGRLKFLFSSSMVNGLEQLQQLDISHCKSMNEVINTRVGRDDNMIEMVFPKLVSLQLSHLPKLTRFGIGDSVEFPSLCQLQIACCPNLKIFICSCTEEMSSEKNIHTTQTQPLFDEKVEVSFAATSSYIFILDLHILSFGFLLYFLASCFSFLRV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSYEYSEDFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWGKNLTKLTVEKCGRLKFLFSSSMVNGLEQLQQLDISHCKSMNEVINTRVGRDDNMIEMVFPKLVSLQLSHLPKLTRFGIGDSVEFPSLCQLQIACCPNLKIFICSCTEEMSSEKNIHTTQTQPLFDEKVEVSFAATSSYIFILDLHILSFGFLLYFLASCFSFLRV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query840 2.2.26 [Sep-21-2011]
O81825919 Probable disease resistan yes no 0.689 0.630 0.285 3e-46
Q9T048985 Disease resistance protei no no 0.679 0.579 0.262 9e-41
Q42484909 Disease resistance protei no no 0.605 0.559 0.263 6e-31
Q9LVT4843 Probable disease resistan no no 0.380 0.379 0.296 1e-21
Q9C8T9898 Putative disease resistan no no 0.433 0.405 0.264 9e-19
Q9FLB4874 Putative disease resistan no no 0.334 0.321 0.285 6e-18
Q7XBQ9970 Disease resistance protei N/A no 0.611 0.529 0.246 8e-17
Q9SI85893 Probable disease resistan no no 0.617 0.581 0.233 2e-15
Q8RXS5888 Probable disease resistan no no 0.370 0.350 0.280 6e-15
Q7XA42979 Putative disease resistan N/A no 0.365 0.313 0.281 6e-15
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score =  187 bits (475), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 176/616 (28%), Positives = 286/616 (46%), Gaps = 37/616 (6%)

Query: 15  LSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSP-RIWKDA 73
           L  +EA  LF   VG  A   + + I  ++  +C GLP+AI TI   L+ K    +WK  
Sbjct: 272 LQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHT 331

Query: 74  VNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVM 133
           +N L  S P  I   +    +++LSY+FL+   +KS F  C L  +   I V +L+ Y +
Sbjct: 332 LNLLKRSAP-SIDTEEKIFGTLKLSYDFLQ-DNMKSCFLFCALFPEDYSIKVSELIMYWV 389

Query: 134 GLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEK--- 190
              LL      E   N   TL++ LK + LL DGDS D  KMH ++   A+   + +   
Sbjct: 390 AEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEG 449

Query: 191 ---LLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERL--GFLKLKLFLFFTENLS 245
              L+   + + +  +  DK   +   +S+    +  LP  +  G   L L L    ++ 
Sbjct: 450 FHSLVMAGRGLIEFPQ--DKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQGNSHVK 507

Query: 246 LQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENC-LVVDVAIIGDLKKL 304
            ++P+ F +    LR+LDL+G R  +LP S   L +LR+L L NC  + ++  +  L KL
Sbjct: 508 -EVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKL 566

Query: 305 EILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQW 364
           + L L  S+I +LPR +  L+ L+ + +SN  +L+ I    I  L+ LE L M  S   W
Sbjct: 567 QFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSW 626

Query: 365 KVEG---QSNASLGELKQLSRLTTLEVHIPDAQVMPQ--DLVFVELERFRICIGDVWSWS 419
            ++G   +  A+L E+  L  L  L + + D        D +   L +F+     + S S
Sbjct: 627 GIKGEEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVS 686

Query: 420 DGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAG----FKNVVHELDDEEGFAR 475
                   L +   N +    G   LL+    L L+   G    F+N+V +   +  F  
Sbjct: 687 PPGTGEGCLAISDVNVSNASIG--WLLQHVTSLDLNYCEGLNGMFENLVTK--SKSSFVA 742

Query: 476 LRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLR 535
           ++ L +H  P +      + ++  FP LE L L N +NLE + +    L         L+
Sbjct: 743 MKALSIHYFPSLSLASGCESQLDLFPNLEELSLDN-VNLESIGELNGFLG---MRLQKLK 798

Query: 536 IIKVEGCHRVKHLFPFSLVKNLL-QLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYF 594
           +++V GC ++K LF   ++   L  LQ++KV  C  L+ +    S        S+     
Sbjct: 799 LLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAESL----L 854

Query: 595 RKLHFLKLQHLPQLTS 610
            KL  +KL++LPQL S
Sbjct: 855 PKLTVIKLKYLPQLRS 870




Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query840
255563252 1603 Disease resistance protein RPS5, putativ 0.921 0.482 0.466 1e-171
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.929 0.593 0.450 1e-171
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.9 0.564 0.453 1e-161
296087872 1152 unnamed protein product [Vitis vinifera] 0.914 0.666 0.418 1e-160
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.927 0.582 0.443 1e-159
224083434 1144 cc-nbs-lrr resistance protein [Populus t 0.934 0.686 0.419 1e-154
359488027 1520 PREDICTED: disease resistance protein At 0.889 0.491 0.412 1e-151
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.940 0.321 0.418 1e-149
147865073 1694 hypothetical protein VITISV_021876 [Viti 0.875 0.433 0.412 1e-141
359488095 1347 PREDICTED: probable disease resistance p 0.901 0.561 0.401 1e-139
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  610 bits (1573), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 382/818 (46%), Positives = 518/818 (63%), Gaps = 44/818 (5%)

Query: 14   LLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDA 73
            +L  EEA  LFE +VG   K  +F++   E+  KC GLP+ I TIA ALKNK   +WKDA
Sbjct: 309  VLQEEEALSLFEMMVG-DVKGGEFQSAASEVTKKCAGLPVLIVTIARALKNKDLYVWKDA 367

Query: 74   VNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVM 133
            V QLS  +  +IQ  +   S++ELSY  L   EVKSLF LCGLL   S IA+ DLL Y  
Sbjct: 368  VKQLSRCDNEEIQ--EKVYSALELSYNHLIGAEVKSLFLLCGLLGK-SDIAILDLLMYST 424

Query: 134  GLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAE-KLL 192
            GL L    DTL  ARNRVH LI +LK+A LL D D +   K+H ++  +A+SIA+  + L
Sbjct: 425  GLGLFKGIDTLGDARNRVHKLISDLKAACLLLDSDIKGRVKIHDVVRDVAISIASRMQHL 484

Query: 193  FNIQNVADLKEELDK-IDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDP 251
            F ++N A LKE  +K + ++ T IS+P+  I+ LPE L   +L+LFL FT+++SL++PD 
Sbjct: 485  FTVRNGALLKEWPNKDVCKSCTRISLPYNDIHGLPEVLECPELELFLLFTQDISLKVPDL 544

Query: 252  FFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKH 311
             FE    LRVL+ TG  F SLP SLG L NL TL L+ C + DVAIIG+L  L ILS KH
Sbjct: 545  CFELTKNLRVLNFTGMHFSSLPPSLGFLKNLFTLCLDWCALRDVAIIGELTGLTILSFKH 604

Query: 312  SSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEG--- 368
            S I +LPREI QLT LK LDLS+C KLK I   +IS LT+LEELYM NSF  W V+G   
Sbjct: 605  SDIVELPREIRQLTKLKFLDLSHCLKLKVIPAKIISELTQLEELYMNNSFDLWDVQGINN 664

Query: 369  QSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTL 428
            Q NASL EL+ L  LTTLE+ + DA+++P+DL F +LERFRI IGDVWS +  Y TS+TL
Sbjct: 665  QRNASLAELECLPYLTTLEICVLDAKILPKDLFFRKLERFRIFIGDVWSGTGDYGTSRTL 724

Query: 429  KLQLNNST-YLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEI 487
            KL+LN S+ +L +G+ +LL+ TEDL+L E+ G K+V+++LD  +GF +L+HL V N PEI
Sbjct: 725  KLKLNTSSIHLEHGLSILLEVTEDLYLAEVKGIKSVLYDLDS-QGFTQLKHLDVQNDPEI 783

Query: 488  LHILNSDGR--VGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRV 545
             +I++ + R     FP+LESL+L NL++LEK+C GK+       SFS LR + V  C R+
Sbjct: 784  QYIIDPNRRSPCNAFPILESLYLDNLMSLEKICCGKLTTG----SFSKLRSLTVVKCDRL 839

Query: 546  KHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHL 605
            K+LF FS+++ LLQLQ++KV DC NL+ IV   SE++   +     V   +L  L L+ L
Sbjct: 840  KNLFSFSMMRCLLQLQQMKVVDCANLEEIVACGSEDT---DNDYEAVKLTQLCSLTLKRL 896

Query: 606  P---------QLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLS 656
            P         +++     ++    T      I  +G+  D   LFNE   FP+L+ L+LS
Sbjct: 897  PMFKSFCSKKKVSPISLRVQKQLTTDTGLKEIAPKGELGDPLPLFNEMFCFPNLENLELS 956

Query: 657  SINVEKIWLNSFSAIESWGKNLTKLTVEKCGRLKFLFSSSMVNGLEQLQQLDISHCKSMN 716
            SI  EKI  +  SAI S   NL  L VE+C  LK+LF+SS+V  L  L++L++  C S+ 
Sbjct: 957  SIACEKICDDQLSAISS---NLMSLIVERCWNLKYLFTSSLVKNLLLLKRLEVFDCMSVE 1013

Query: 717  EVI-NTRVGRDDNMIEMVFPKLVSLQLSHLPKLTRFGIGDSVEFPSLCQLQIACCPNLKI 775
             +I    +  ++   + +FP+L  L+L +LP +TRF  G  VEF SL +L I  CP L +
Sbjct: 1014 GIIVAEELVEEERNRKKLFPELDFLKLKNLPHITRFCDGYPVEFSSLRKLLIENCPALNM 1073

Query: 776  FICSC----------TEEMSSEKNIHTTQTQPLFDEKV 803
            F+              + M+SEKN H T+TQPLF+EKV
Sbjct: 1074 FVSKSPSADMIESREAKGMNSEKN-HHTETQPLFNEKV 1110




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296087872|emb|CBI35155.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488027|ref|XP_002269288.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488095|ref|XP_002270726.2| PREDICTED: probable disease resistance protein At4g27220-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query840
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.695 0.635 0.273 3.5e-46
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.691 0.589 0.261 4.6e-39
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.435 0.402 0.279 2.9e-28
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.396 0.370 0.284 5.8e-24
TAIR|locus:2171579843 AT5G47250 [Arabidopsis thalian 0.378 0.377 0.291 6.7e-23
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.4 0.376 0.273 2.1e-20
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.4 0.373 0.261 2.9e-20
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.466 0.441 0.259 4.1e-20
TAIR|locus:2171589948 AT5G47260 [Arabidopsis thalian 0.45 0.398 0.253 4.2e-19
TAIR|locus:2031356884 AT1G63360 [Arabidopsis thalian 0.435 0.414 0.261 7.8e-18
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 490 (177.5 bits), Expect = 3.5e-46, Sum P(2) = 3.5e-46
 Identities = 167/611 (27%), Positives = 271/611 (44%)

Query:    15 LSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSP-RIWKDA 73
             L  +EA  LF   VG  A   + + I  ++  +C GLP+AI TI   L+ K    +WK  
Sbjct:   272 LQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHT 331

Query:    74 VNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVM 133
             +N L  S P  I   +    +++LSY+FL+   +KS F  C L  +   I V +L+ Y +
Sbjct:   332 LNLLKRSAP-SIDTEEKIFGTLKLSYDFLQ-DNMKSCFLFCALFPEDYSIKVSELIMYWV 389

Query:   134 GLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAV-SIAAEKLL 192
                LL      E   N   TL++ LK + LL DGDS D  KMH ++   A+  ++++   
Sbjct:   390 AEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEG 449

Query:   193 FNIQNVAD---LKEELDKIDEAPTAISIPFRGIYELPERLGXXXXXXXXXXTENLSL-QI 248
             F+   +A    ++   DK   +   +S+    +  LP  +             N  + ++
Sbjct:   450 FHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQGNSHVKEV 509

Query:   249 PDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVV-DVAIIGDLKKLEIL 307
             P+ F +    LR+LDL+G R  +LP S   L +LR+L L NC  + ++  +  L KL+ L
Sbjct:   510 PNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFL 569

Query:   308 SLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVE 367
              L  S+I +LPR +  L+ L+ + +SN  +L+ I    I  L+ LE L M  S   W ++
Sbjct:   570 DLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSWGIK 629

Query:   368 GQSN---ASLGELKQLSRLTTLEVHIPDAQVMPQ--DLVFVELERFRICIGDVWSWSDGY 422
             G+     A+L E+  L  L  L + + D        D +   L +F+     + S S   
Sbjct:   630 GEEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVSPPG 689

Query:   423 ETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHEL--DDEEGFARLRHLH 480
                  L +   N +    G   LL+    L L+   G   +   L    +  F  ++ L 
Sbjct:   690 TGEGCLAISDVNVSNASIGW--LLQHVTSLDLNYCEGLNGMFENLVTKSKSSFVAMKALS 747

Query:   481 VHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVE 540
             +H  P +      + ++  FP LE L L N +NLE + +    L         L++++V 
Sbjct:   748 IHYFPSLSLASGCESQLDLFPNLEELSLDN-VNLESIGELNGFLG---MRLQKLKLLQVS 803

Query:   541 GCHRVKHLFPFSXXXXXX-XXXXXXXTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHF 599
             GC ++K LF                   C  L+ +    S        S+      KL  
Sbjct:   804 GCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAESL----LPKLTV 859

Query:   600 LKLQHLPQLTS 610
             +KL++LPQL S
Sbjct:   860 IKLKYLPQLRS 870


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171579 AT5G47250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031356 AT1G63360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query840
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 3e-14
PLN032101153 PLN03210, PLN03210, Resistant to P 4e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score = 73.9 bits (182), Expect = 3e-14
 Identities = 36/129 (27%), Positives = 57/129 (44%), Gaps = 5/129 (3%)

Query: 14  LLSNEEASHLFEKIVGH--SAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKS-PRIW 70
            L  EE+  LF   V         + E +  EIV KC GLP+A+K +   L  KS  + W
Sbjct: 155 SLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEW 214

Query: 71  KDAVNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLR 130
           +  + QL+N       G++  LS + LSY+ L    +K  F    L  +   I  + L++
Sbjct: 215 EHVLEQLNNE-LAGRDGLNEVLSILSLSYDNLP-MHLKRCFLYLALFPEDYNIRKEQLIK 272

Query: 131 YVMGLRLLT 139
             +    + 
Sbjct: 273 LWIAEGFVI 281


Length = 285

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 840
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN032101153 Resistant to P. syringae 6; Provisional 99.92
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.89
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.88
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.87
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.85
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.85
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.81
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
KOG4237498 consensus Extracellular matrix protein slit, conta 99.59
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.55
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.52
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.48
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.44
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.36
KOG4341483 consensus F-box protein containing LRR [General fu 99.06
KOG4341483 consensus F-box protein containing LRR [General fu 99.01
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.0
KOG4237498 consensus Extracellular matrix protein slit, conta 98.98
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.97
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.94
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.94
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.94
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.92
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.71
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.71
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.71
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.63
PLN03150623 hypothetical protein; Provisional 98.49
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.45
PLN03150623 hypothetical protein; Provisional 98.4
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.39
PRK15386426 type III secretion protein GogB; Provisional 98.35
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.31
PRK15386 426 type III secretion protein GogB; Provisional 98.24
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.08
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.08
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.07
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.07
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.05
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.01
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.93
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.86
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.72
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.68
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.66
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.64
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.61
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.54
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.49
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.39
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.35
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.18
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.15
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.13
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.96
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.23
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.95
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.85
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.83
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.8
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.49
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.05
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.04
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.81
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.22
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.89
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.66
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.06
PRK04841903 transcriptional regulator MalT; Provisional 91.08
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.66
smart0037026 LRR Leucine-rich repeats, outliers. 89.94
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.94
KOG0473326 consensus Leucine-rich repeat protein [Function un 85.86
smart0037026 LRR Leucine-rich repeats, outliers. 85.75
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.75
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=1.5e-60  Score=546.73  Aligned_cols=357  Identities=29%  Similarity=0.436  Sum_probs=282.7

Q ss_pred             CCCCCceEEccCCCHHHHHHHHHHHhCCC--CCCCchhhHHHHHHHHhCCCchhHHHHHHHhcCC-CHHHHHHHHHHhhc
Q 003193            3 SYEYSEDFLDWLLSNEEASHLFEKIVGHS--AKKSDFETIGVEIVAKCGGLPIAIKTIANALKNK-SPRIWKDAVNQLSN   79 (840)
Q Consensus         3 ~~~~~~~~~l~~L~~~~s~~Lf~~~a~~~--~~~~~~~~i~~~i~~~c~GlPLai~~~g~~L~~~-~~~~W~~~l~~l~~   79 (840)
                      +||+..++++++|+++|||+||++.||+.  ..++.++++|++||+||+|+|||++++|+.|+.| +.++|+++.+.+.+
T Consensus       305 ~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s  384 (889)
T KOG4658|consen  305 AMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKS  384 (889)
T ss_pred             cccCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccc
Confidence            48999999999999999999999999944  4556699999999999999999999999999977 88999999999988


Q ss_pred             CCCCCccccccc-ccceeecccccCchhhhhHHHhccCCCCCCccCHHHHHHHHhhcccccccchHHHHHHHHHHHHHHH
Q 003193           80 SNPRKIQGMDAD-LSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNL  158 (840)
Q Consensus        80 ~~~~~~~~~~~~-~~~l~lSY~~L~~~~lk~cfl~~~~fp~~~~i~~~~li~~wia~gfi~~~~~~~~~~~~~~~~~~~L  158 (840)
                      ....++.++++. +++|++|||+||++ +|.||+|||+|||||+|++++|+.+||||||+++....+.+++.|++|+.+|
T Consensus       385 ~~~~~~~~~~~~i~~iLklSyd~L~~~-lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~L  463 (889)
T KOG4658|consen  385 SLAADFSGMEESILPILKLSYDNLPEE-LKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEEL  463 (889)
T ss_pred             cccCCCCchhhhhHHhhhccHhhhhHH-HHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHH
Confidence            866566666666 89999999999965 9999999999999999999999999999999988666778899999999999


Q ss_pred             hhccccccCC---CCCceEeehhHHHHHHHHHh-----hceEeEEecCccchhhhh-hccCCCcEEEeccCCcccCCccc
Q 003193          159 KSASLLFDGD---SEDHAKMHRIIHAIAVSIAA-----EKLLFNIQNVADLKEELD-KIDEAPTAISIPFRGIYELPERL  229 (840)
Q Consensus       159 ~~~~l~~~~~---~~~~~~mhdli~~l~~~i~~-----~e~~~~~~~~~~~~~~~~-~~~~~l~~L~l~~~~~~~l~~~~  229 (840)
                      +.+++++..+   +..+|+|||+|||||.++|+     ++..+ +..+......|+ ..+..+|++++.++.+..++...
T Consensus       464 V~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~i-v~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~  542 (889)
T KOG4658|consen  464 VRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQI-VSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSS  542 (889)
T ss_pred             HHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceE-EECCcCccccccccchhheeEEEEeccchhhccCCC
Confidence            9999998875   45789999999999999999     55522 444334444555 66789999999999999999888


Q ss_pred             CCCcceeEeeccCcc-ccCCCchhhcCCCCCcEEEcCCCC-CCCCChhhcCCCCCCEEEccCCccCCcccccCCCCCCEE
Q 003193          230 GFLKLKLFLFFTENL-SLQIPDPFFEGMTELRVLDLTGFR-FHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEIL  307 (840)
Q Consensus       230 ~~~~L~~L~l~~~~~-~~~~~~~~~~~l~~Lr~L~l~~~~-~~~lp~~l~~l~~L~~L~L~~~~~~~~~~i~~L~~L~~L  307 (840)
                      .+++|++|.+.+|.. ...++..+|..++.||+||+++|. +..+|++|++|.|||||+++++.+               
T Consensus       543 ~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I---------------  607 (889)
T KOG4658|consen  543 ENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGI---------------  607 (889)
T ss_pred             CCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCc---------------
Confidence            899999999999874 557888889999999999999764 568888888888777777776654               


Q ss_pred             eecCCCCcccChhhcCCCCCCEEEccCCCCCCccCcccccCCCCCcEEEccCCcccceecCCCCCCcccccCCCCCCeEE
Q 003193          308 SLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLE  387 (840)
Q Consensus       308 ~l~~~~l~~lp~~i~~L~~L~~L~L~~~~~l~~~p~~~l~~L~~L~~L~l~~~~~~~~~~~~~~~~l~~l~~l~~L~~L~  387 (840)
                             +.+|.++++|+.|.+|++..+..+..+| +.+..|.+||+|.+.....     ..+...+.++.++.+|+.+.
T Consensus       608 -------~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~-~i~~~L~~Lr~L~l~~s~~-----~~~~~~l~el~~Le~L~~ls  674 (889)
T KOG4658|consen  608 -------SHLPSGLGNLKKLIYLNLEVTGRLESIP-GILLELQSLRVLRLPRSAL-----SNDKLLLKELENLEHLENLS  674 (889)
T ss_pred             -------cccchHHHHHHhhheecccccccccccc-chhhhcccccEEEeecccc-----ccchhhHHhhhcccchhhhe
Confidence                   4555555555555555555544443332 2234455666555543321     11123345555555565555


Q ss_pred             Ee
Q 003193          388 VH  389 (840)
Q Consensus       388 l~  389 (840)
                      +.
T Consensus       675 ~~  676 (889)
T KOG4658|consen  675 IT  676 (889)
T ss_pred             ee
Confidence            53



>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query840
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 5e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-09
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 5e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-06
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-04
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
 Score =  100 bits (249), Expect = 5e-22
 Identities = 26/187 (13%), Positives = 54/187 (28%), Gaps = 11/187 (5%)

Query: 15  LSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAV 74
           L  +E     E            E +  + +    G P  +     + + K+        
Sbjct: 293 LEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLN 352

Query: 75  NQLSNSNPRKIQGMDAD-----LSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLL 129
           N+L +     ++ +          +++   E L   E +S      ++  G  I V    
Sbjct: 353 NKLESRGLVGVECITPYSYKSLAMALQRCVEVLSD-EDRSALAFAVVMPPGVDIPVKLWS 411

Query: 130 RYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGD--SEDHAKMHRIIHAIAVSIA 187
             +         + L+   + V   +  L     L  G        K+  IIH     + 
Sbjct: 412 CVIPVDICSNEEEQLD---DEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVV 468

Query: 188 AEKLLFN 194
             + + N
Sbjct: 469 DAQTIAN 475


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query840
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.83
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.83
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.83
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.82
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.82
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.82
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.81
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.79
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.78
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.78
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.77
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.76
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.75
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.75
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.74
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.74
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.74
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.74
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.73
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.73
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.72
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.71
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.7
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.7
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.67
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.66
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.66
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.66
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.62
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.62
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.62
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.61
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.61
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.6
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.6
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.59
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.59
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.59
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.58
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.58
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.57
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.57
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.57
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.56
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.55
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.54
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.53
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.52
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.52
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.51
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.51
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.51
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.5
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.49
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.47
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.46
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.45
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.43
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.41
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.4
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.38
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.37
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.36
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.35
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.32
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.32
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.3
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.28
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.27
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.25
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.24
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.2
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.19
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.13
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.01
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.96
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.86
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.8
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.7
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.67
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.66
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.65
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.6
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.4
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.33
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.32
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.2
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.12
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.97
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.78
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.78
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.74
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.58
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.5
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.26
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.4
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.29
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.81
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.69
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.1
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 92.25
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 91.94
2fna_A357 Conserved hypothetical protein; structural genomic 89.79
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 80.51
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=5.4e-36  Score=355.65  Aligned_cols=514  Identities=16%  Similarity=0.050  Sum_probs=291.3

Q ss_pred             hccCCCcEEEeccCCcc-cCCc--cc-CCCcceeEeeccCccccCCCchhhcCCCCCcEEEcCCCCCCCC-Chh---hcC
Q 003193          207 KIDEAPTAISIPFRGIY-ELPE--RL-GFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSL-PSS---LGC  278 (840)
Q Consensus       207 ~~~~~l~~L~l~~~~~~-~l~~--~~-~~~~L~~L~l~~~~~~~~~~~~~~~~l~~Lr~L~l~~~~~~~l-p~~---l~~  278 (840)
                      ....++++|++++|.+. .+|.  .+ .+++|++|++++|.+.+.+|..++.++++|++|++++|.++.. |..   +.+
T Consensus        97 ~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~  176 (768)
T 3rgz_A           97 KCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDG  176 (768)
T ss_dssp             CCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTC
T ss_pred             ccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhcc
Confidence            34567888888888774 3454  33 6788888888888777677766667778888888888877644 333   667


Q ss_pred             CCCCCEEEccCCccCCcccccCCCCCCEEeecCCCCcccChhhcCCCCCCEEEccCCCCCCccCcccccCCCCCcEEEcc
Q 003193          279 LINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMG  358 (840)
Q Consensus       279 l~~L~~L~L~~~~~~~~~~i~~L~~L~~L~l~~~~l~~lp~~i~~L~~L~~L~L~~~~~l~~~p~~~l~~L~~L~~L~l~  358 (840)
                      +++|++|++++|.+.....++++++|++|++++|.++..++.++++++|++|++++|.....+|.. ++++++|++|+++
T Consensus       177 l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~-l~~l~~L~~L~Ls  255 (768)
T 3rgz_A          177 CGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGDFSRA-ISTCTELKLLNIS  255 (768)
T ss_dssp             CTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCBCTTCCSCCEEECCSSCCCSCHHHH-TTTCSSCCEEECC
T ss_pred             CCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcccccCCCCCEEECcCCcCCCcccHH-HhcCCCCCEEECC
Confidence            777777777777776644447777777777777777654434777777777777774333344443 6777777777777


Q ss_pred             CCcccceecCCCCCCcccccCCCCCCeEEEecCCCC-CCCCcc-c-ccCcceEEEEEcC----ccCCCCCccccceEEEe
Q 003193          359 NSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQ-VMPQDL-V-FVELERFRICIGD----VWSWSDGYETSKTLKLQ  431 (840)
Q Consensus       359 ~~~~~~~~~~~~~~~l~~l~~l~~L~~L~l~~~~~~-~~~~~~-~-~~~L~~L~l~~~~----~~~~~~~~~~l~~L~l~  431 (840)
                      +|.+....+        .. .+++|+.|++++|.+. .+|..+ . +++|+.|++..+.    .+..+..+++|+.|+++
T Consensus       256 ~n~l~~~~~--------~~-~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~  326 (768)
T 3rgz_A          256 SNQFVGPIP--------PL-PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALS  326 (768)
T ss_dssp             SSCCEESCC--------CC-CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECC
T ss_pred             CCcccCccC--------cc-ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECC
Confidence            776543221        11 4555666666655544 344433 1 2555555554332    23334445555555555


Q ss_pred             eCCCc-cchhhHHHHHhcccceeeccccccccccccccchhhcc-cccEEEeecCCCeEEEE------------------
Q 003193          432 LNNST-YLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFA-RLRHLHVHNGPEILHIL------------------  491 (840)
Q Consensus       432 ~~~~~-~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~l~~~~~l~-~L~~L~l~~~~~l~~~~------------------  491 (840)
                      .+... .+|......+++|+.|++++|.....++..+   ..++ +|++|++++|.....++                  
T Consensus       327 ~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l---~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~  403 (768)
T 3rgz_A          327 SNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL---TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQN  403 (768)
T ss_dssp             SSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTH---HHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCS
T ss_pred             CCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHH---HhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCC
Confidence            54443 3343322234555555555554433344333   3333 44555544443111110                  


Q ss_pred             -----eCCCccccccccceeecccccccccccccccccCCCCcccCCccEEEEecCCCcccccchhHHhhcccccEEEEe
Q 003193          492 -----NSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVT  566 (840)
Q Consensus       492 -----~~~~~~~~~~~L~~L~l~~~~~L~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~L~~l~~~~~~~~l~~L~~L~i~  566 (840)
                           ........+++|++|+++++.--..++       ...+.+++|+.|++++|.-...+|  ..+..+++|++|+++
T Consensus       404 n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p-------~~l~~l~~L~~L~L~~n~l~~~~p--~~~~~l~~L~~L~L~  474 (768)
T 3rgz_A          404 NGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP-------SSLGSLSKLRDLKLWLNMLEGEIP--QELMYVKTLETLILD  474 (768)
T ss_dssp             SEEEEECCGGGGGCTTCCEEECCSSEEESCCC-------GGGGGCTTCCEEECCSSCCCSCCC--GGGGGCTTCCEEECC
T ss_pred             CccccccCHHHhcCCCCCEEECcCCcccCccc-------HHHhcCCCCCEEECCCCcccCcCC--HHHcCCCCceEEEec
Confidence                 011223444555555555532111111       113345556666665554222332  123455666666666


Q ss_pred             cccccceeeccccccccccCCccccccccccceeecccCcccccccCCCCCCCccCCCCCcccccCCCCCcccccccccc
Q 003193          567 DCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVV  646 (840)
Q Consensus       567 ~c~~l~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~c~~L~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~  646 (840)
                      +|.-...++             ..+..+++|++|++.++.-...++..     .....+++.+....+.-....+..+..
T Consensus       475 ~N~l~~~~p-------------~~l~~l~~L~~L~L~~N~l~~~~p~~-----~~~l~~L~~L~L~~N~l~~~~p~~l~~  536 (768)
T 3rgz_A          475 FNDLTGEIP-------------SGLSNCTNLNWISLSNNRLTGEIPKW-----IGRLENLAILKLSNNSFSGNIPAELGD  536 (768)
T ss_dssp             SSCCCSCCC-------------GGGGGCTTCCEEECCSSCCCSCCCGG-----GGGCTTCCEEECCSSCCEEECCGGGGG
T ss_pred             CCcccCcCC-------------HHHhcCCCCCEEEccCCccCCcCChH-----HhcCCCCCEEECCCCcccCcCCHHHcC
Confidence            554332222             23456777777777777544343332     234556777777776655566666777


Q ss_pred             cCCcceEecccccch-hhcccC----------------------------------------------------------
Q 003193          647 FPSLKKLKLSSINVE-KIWLNS----------------------------------------------------------  667 (840)
Q Consensus       647 l~~L~~L~l~~c~l~-~~~~~~----------------------------------------------------------  667 (840)
                      +++|+.|++++|.++ .+|...                                                          
T Consensus       537 l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~  616 (768)
T 3rgz_A          537 CRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNIT  616 (768)
T ss_dssp             CTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTT
T ss_pred             CCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccc
Confidence            888888888887554 222110                                                          


Q ss_pred             -------CccccccCCCceEEEecccCCcc-eeechhhHhhhcccceeeecccccchhhhccCcccccCccccccccccc
Q 003193          668 -------FSAIESWGKNLTKLTVEKCGRLK-FLFSSSMVNGLEQLQQLDISHCKSMNEVINTRVGRDDNMIEMVFPKLVS  739 (840)
Q Consensus       668 -------~~~~~~~l~~L~~L~i~~C~~L~-~l~~~~~~~~l~sL~~L~i~~C~~L~~i~~~~~~~~~~~~~~~l~sL~~  739 (840)
                             .+.....+++|+.|+++++ +++ .+|  ..++++++|+.|+++++.--..+   |+.+..      +++|+.
T Consensus       617 ~~~~~g~~~~~~~~l~~L~~LdLs~N-~l~g~ip--~~l~~l~~L~~L~Ls~N~l~g~i---p~~l~~------L~~L~~  684 (768)
T 3rgz_A          617 SRVYGGHTSPTFDNNGSMMFLDMSYN-MLSGYIP--KEIGSMPYLFILNLGHNDISGSI---PDEVGD------LRGLNI  684 (768)
T ss_dssp             SCEEEEECCCSCSSSBCCCEEECCSS-CCBSCCC--GGGGGCTTCCEEECCSSCCCSCC---CGGGGG------CTTCCE
T ss_pred             cceecccCchhhhccccccEEECcCC-cccccCC--HHHhccccCCEEeCcCCccCCCC---ChHHhC------CCCCCE
Confidence                   0111234567788888665 444 443  33777888888888886533344   665554      778888


Q ss_pred             cccccCCcceeecCCCCccCCCcceEEeccCCCc
Q 003193          740 LQLSHLPKLTRFGIGDSVEFPSLCQLQIACCPNL  773 (840)
Q Consensus       740 L~i~~c~~L~~l~~~~~~~l~sL~~L~i~~C~~L  773 (840)
                      |+++++.--..+|. .+.++++|++|++++|+--
T Consensus       685 LdLs~N~l~g~ip~-~l~~l~~L~~L~ls~N~l~  717 (768)
T 3rgz_A          685 LDLSSNKLDGRIPQ-AMSALTMLTEIDLSNNNLS  717 (768)
T ss_dssp             EECCSSCCEECCCG-GGGGCCCCSEEECCSSEEE
T ss_pred             EECCCCcccCcCCh-HHhCCCCCCEEECcCCccc
Confidence            88887753334443 3446778888888877533



>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 840
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 1e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 57.9 bits (139), Expect = 1e-09
 Identities = 12/88 (13%), Positives = 25/88 (28%), Gaps = 6/88 (6%)

Query: 15  LSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAV 74
           L  +E     E            E +  + +    G P  +     + + K+        
Sbjct: 185 LEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLN 244

Query: 75  NQLSNSNPRKIQGMDADLSSIELSYEFL 102
           N+L +     ++           SY+ L
Sbjct: 245 NKLESRGLVGVE------CITPYSYKSL 266


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query840
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.8
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.74
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.73
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.7
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.69
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.69
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.67
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.66
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.66
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.66
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.58
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.55
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.41
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.38
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.37
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.36
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.36
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.35
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.31
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.27
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.09
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.09
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.03
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.87
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.84
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.8
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.22
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.64
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.63
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.85
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.63
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.29
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.87
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.83  E-value=6.4e-19  Score=189.29  Aligned_cols=100  Identities=24%  Similarity=0.416  Sum_probs=68.4

Q ss_pred             CCCCCcEEEcCCCCCCCCChhhcCCCCCCEEEccCCccCCcccccCCCCCCEEeecCCCCcccChhhcCCCCCCEEEccC
Q 003193          255 GMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSN  334 (840)
Q Consensus       255 ~l~~Lr~L~l~~~~~~~lp~~l~~l~~L~~L~L~~~~~~~~~~i~~L~~L~~L~l~~~~l~~lp~~i~~L~~L~~L~L~~  334 (840)
                      .+.+|++|+++++.++.+ +.+..+++|++|++++|.+++.+.++++++|++|++++|.++.++. ++++++|+.|++.+
T Consensus        42 ~l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~i~~i~~-l~~l~~L~~L~~~~  119 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITP-LANLTNLTGLTLFN  119 (384)
T ss_dssp             HHTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCS
T ss_pred             HhCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCCcCCCCccccCCcccccccccccccccccc-cccccccccccccc
Confidence            456778888888877776 3677778888888888877775557777778888887777777654 67777777777766


Q ss_pred             CCCCCccCcccccCCCCCcEEEccC
Q 003193          335 CSKLKEIRPNVISNLTRLEELYMGN  359 (840)
Q Consensus       335 ~~~l~~~p~~~l~~L~~L~~L~l~~  359 (840)
                       +.+..++.  ......+..+....
T Consensus       120 -~~~~~~~~--~~~~~~~~~~~~~~  141 (384)
T d2omza2         120 -NQITDIDP--LKNLTNLNRLELSS  141 (384)
T ss_dssp             -SCCCCCGG--GTTCTTCSEEEEEE
T ss_pred             -cccccccc--cccccccccccccc
Confidence             44544443  33445555554443



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure