Citrus Sinensis ID: 003259

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-----
MARSRRKKGARSFALNVEQVVEFWKNLLEEKPLLPFVIPLVLLLWVFERWLFSFSNWVPLAIAVWATVQYGQYQHRIHVEELNKKWNQIILKTSPITPLEHCEWLNKLLMEVWPGYINPKLSIRFSQIVEKRLKHRKPRLIEKIELQEFSLGSTSPCLGLHGTRWSSSGDQRVMQLGFDWDANDISILLLAKLAKPLLGTAKIVINSLHIKGDLLVMPILEGKAVLYSFVSIPDVRIGVAFGSGGSQSLPATELPGVSNWLARLINETLVKTLVEPRRRCYSLPAVDLRKKAVGGIVYVRVISASKLSRSSLRGSPSRRQQNYSADSSLEEHYEDKDLTTFVEIELEELTRRTDARPGSDPRWDSMFNMVLHEETGTVRFNLYECIPGHVKYDYLTSCEVKMKYVADDSTTFWAIGPDSGIIAKHAEFCGDEVEMTVPFEGVNSGELTVRLVLKEWQFSDGSHSLNNFHSGSQQSLSGSSNFISRTGRKINVTVVEGKDLMPKDKSGKCDPYVKLQYGKIVQRTRTAHSPNHVWNQKFELDEIGGGECLMVKCYNEEIFGDENMGSARVNLEGLVEGSVRDIWVPLEKVNTGELRLQIEATRVDDNEGSRGQNIGSGNGWIELVIVEARDLVAADLRGTSDPYVKVQYGDLKKRTKVIFKTLNPQWHQTLEFPDDGSPLTLHVRDHNALLASSSIGDCVVEYQRLPPNQMADKWIPLQGVRKGEIHVLITRKVPELDKRTSIDSDSSSTRAHKISGQMKQMMVKFQSLIDDDNLEELSTALSELETLEDSQEEYMVQLETEQMLLLNKIKELGQEIINSSPSINRRSPGNGAIPY
cccHHHccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHEEEEEcHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEcccccEEEEEEEEEcccccEEEEEEEEEEEccccEEEEEEHHccccccccEEEEEEEEEEEEEEEEEEccccEEEEEEccccEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHccccccEEEEEccccccccccccEEEEEEEEEcccccccccccccccccccccccccccccccccccEEEEEEcccEEEEEEEcccccccccccEEEEEEEccccEEEEEEEEEcccccccEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEccccccccccccccccccccccccccccccccEEEEEEEEEEccccccccccccccEEEEEEccEEEEEEcccccccccccEEEEEEEccccEEEEEEEEccccccccEEEEEEEcccccccccEEEEEEccccccccEEEEEEEEEccccccccccccccccEEEEEEEEEcccccccccccccccEEEEEEccEEEEEEEEccccccccccEEEEcccccEEEEEEEEccccccccccEEEEEEcccccccccccEEEEcccccccEEEEEEEEEcccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccHHHHcccccccccccccccccc
ccHHHHccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHEEEEEEEccccccEEEEEEEEccccccEEEEEEEEEEcccccEEEEEEEHHcccEcEcEEEEEEEEEEEEEEEEEccccccEEEEEEEcccEEEEEEccccccccccHcccccHHHHHHHHHHHHHHHHccccccEEEEccHHHHccccccEEEEEEEEEcccccccccccccccHEccccccccccccccccEEEEEEEccccEEEEEEEEEcccccccccEEEEEEEcccccEEEEEEEccccccccccccEEEEcHHHHccccccHHHcccccccccHHHHHcccccccEEcccccccccEEEEEEEEEcccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccccEEEEEEcccEEEEEEEEccccccccEEEEEEcccccEEEEEEEEcccccccccEEEEEEHHHHcccccccEEEEcccccccEEEEEEEEEEcccccccccccccccccEEEEEEEEcccccccccccccccEEEEEEcccEEEEEEEEccccccccEEEEEEccccEEEEEEEEccccccccccEEEEEEHHHccccccccEEEEcccccccEEEEEEEEEcccEEEcccccccccccccccccccccHHHHHccccccccccccccccccHHHccHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccccccccccccc
marsrrkkgaRSFALNVEQVVEFWKNLleekpllpfvIPLVLLLWVFERWLFSFSNWVPLAIAVWATVQYGQYQHRIHVEELNKKWNQIIlktspitpleHCEWLNKLLMEVwpgyinpklsiRFSQIVEKRLKHRKPRLIEKielqefslgstspclglhgtrwsssgdQRVMQlgfdwdanDISILLLAKLAKPLLGTAKIVINSLhikgdllvmpiLEGKAVLYsfvsipdvrigvafgsggsqslpatelpgvSNWLARLINETLVKTLveprrrcyslpavdlrkkAVGGIVYVRVISASKlsrsslrgspsrrqqnysadssleehyedkdlTTFVEIELEELtrrtdarpgsdprwdsMFNMVLHeetgtvrfnlyecipghvkydYLTSCEVKMKyvaddsttfwaigpdsgiiakhaefcgdevemtvpfegvnsgELTVRLVLKEwqfsdgshslnnfhsgsqqslsgssnfisrtgrkinvtvvegkdlmpkdksgkcdpyvklqygkivqrtrtahspnhvwnqkfeldeigggeclmvkcyneeifgdenmgsarvnleglvegsvrdiwvplekvntgelRLQIEatrvddnegsrgqnigsgnGWIELVIVEARDLVAadlrgtsdpyvkvqygdlKKRTKVIFKTlnpqwhqtlefpddgspltlhvrdhnallasssigdcvveyqrlppnqmadkwiplqgvrkgEIHVLITRkvpeldkrtsidsdssstraHKISGQMKQMMVKFQSLIDDDNLEELSTALSELETLEDSQEEYMVQLETEQMLLLNKIKELGQEIinsspsinrrspgngaipy
marsrrkkgarsfalnVEQVVEFWKNLLEEKPLLPFVIPLVLLLWVFERWLFSFSNWVPLAIAVWATVQYGQYQHRIHVEELNKKWNQIILKTSPITPLEHCEWLNKLLMEVWPGYINPKLSIRFSQIVEKRLKHRKPRLIEkielqefslgstspCLGLHGTRWSSSGDQRVMQLGFDWDANDISILLLAKLAKPLLGTAKIVINSLHIKGDLLVMPILEGKAVLYSFVSIPDVRIGVAFGSGGSQSLPATELPGVSNWLARLINETLvktlveprrrcyslpavdlrkkavggIVYVRVIsasklsrsslrgspsrrqqnysadssleehyedkdlTTFVEIEleeltrrtdarpgsdprwDSMFNMVLHEETGTVRFNLYECIPGHVKYDYLTSCEVKMKYVADDSTTFWAIGPDSGIIAKHAEFCGDEVEMTVPFEGVNSGELTVRLVLKEWQFSDGSHSLNNFHSgsqqslsgssnfisrtgrkinvtvvegkdlmpkdksgkcdpyVKLQYGKIVQrtrtahspnhvwnQKFELDEIGGGECLMVKCYNEEIFGDENMGSARVNLEGLVEGSVRDIWVPLekvntgelrlqieatrvddnegsrgqnigsgngWIELVIVEARDLVAadlrgtsdpyvkvqygdlkkRTKVIFKTlnpqwhqtleFPDDGSPLTLHVRDHNALLASSSIGDCVVEYQRLPPNQMADkwiplqgvrkgEIHVLitrkvpeldkrtsidsdssstrahkisgqMKQMMVKFQSLIDDDNLEELSTALSELETLEDSQEEYMVQLETEQMLLLNKIKELGQEiinsspsinrrspgngaipy
MARSRRKKGARSFALNVEQVVEFWKNLLEEKpllpfviplvlllwvFERWLFSFSNWVPLAIAVWATVQYGQYQHRIHVEELNKKWNQIILKTSPITPLEHCEWLNKLLMEVWPGYINPKLSIRFSQIVEKRLKHRKPRLIEKIELQEFSLGSTSPCLGLHGTRWSSSGDQRVMQLGFDWDANDISIlllaklakpllgtakIVINSLHIKGDLLVMPILEGKAVLYSFVSIPDVRIGVAFGSGGSQSLPATELPGVSNWLARLINETLVKTLVEPRRRCYSLPAVDLRKKAVGGIVYVrvisasklsrsslrgspsrrQQNYSADSSLEEHYEDKDLTTFVEIELEELTRRTDARPGSDPRWDSMFNMVLHEETGTVRFNLYECIPGHVKYDYLTSCEVKMKYVADDSTTFWAIGPDSGIIAKHAEFCGDEVEMTVPFEGVNSGELTVRLVLKEWQFSDGSHSLNNFHsgsqqslsgssNFISRTGRKINVTVVEGKDLMPKDKSGKCDPYVKLQYGKIVQRTRTAHSPNHVWNQKFELDEIGGGECLMVKCYNEEIFGDENMGSARVNLEGLVEGSVRDIWVPLEKVNTGELRLQIEATRVDDNEGSRGQNIGSGNGWIELVIVEARDLVAADLRGTSDPYVKVQYGDLKKRTKVIFKTLNPQWHQTLEFPDDGSPLTLHVRDHNALLASSSIGDCVVEYQRLPPNQMADKWIPLQGVRKGEIHVLITRKVPELDKrtsidsdssstrAHKISGQMKQMMVKFQSLIDDDNleelstalseletleDSQEEYMVQLETEQMLLLNKIKELGQEiinsspsinrrspGNGAIPY
************FALNVEQVVEFWKNLLEEKPLLPFVIPLVLLLWVFERWLFSFSNWVPLAIAVWATVQYGQYQHRIHVEELNKKWNQIILKTSPITPLEHCEWLNKLLMEVWPGYINPKLSIRFSQIVEKRLKHRKPRLIEKIELQEFSLGSTSPCLGLHGTRWSSSGDQRVMQLGFDWDANDISILLLAKLAKPLLGTAKIVINSLHIKGDLLVMPILEGKAVLYSFVSIPDVRIGVAFGSGGSQSLPATELPGVSNWLARLINETLVKTLVEPRRRCYSLPAVDLRKKAVGGIVYVRVIS***********************************TTFVEIEL****************WDSMFNMVLHEETGTVRFNLYECIPGHVKYDYLTSCEVKMKYVADDSTTFWAIGPDSGIIAKHAEFCGDEVEMTVPFEGVNSGELTVRLVLKEWQFS*****************************KINVTVVEG**********KCDPYVKLQYGKIVQRTRTAHSPNHVWNQKFELDEIGGGECLMVKCYNEEIFGDENMGSARVNLEGLVEGSVRDIWVPLEKVNTGELRLQIEATR***********IGSGNGWIELVIVEARDLVAADLRGTSDPYVKVQYGDLKKRTKVIFKTLNPQWHQTLEFPDDGSPLTLHVRDHNALLASSSIGDCVVEYQRLPPNQMADKWIPLQGVRKGEIHVLITRKV**************************************************************VQLETEQMLLLNKIKEL***********************
******************QVVEFWKNLLEEKPLLPFVIPLVLLLWVFERWLFSFSNWVPLAIAVWATVQYGQYQHRIHVEEL*KKWNQIILKTSPITPLEHCEWLNKLLMEVWPGYINPKLSIRFSQIVEKRLKHRKPRLIEKIELQEFSLGSTSPCLGLHGTRWSSSGDQRVMQLGFDWDANDISILLLAKLAKPLLGTAKIVINSLHIKGDLLVMPILEGKAVLYSFVSIPDVRIGVAFGSGGSQSLPATELPGVSNWLARLINETLVKTLVEPRRRCYSLPAVDLRKKAVGGIVYVRVISASKLSRSSL**S***RQQNYSADSSLEEHYEDKDLTTFVEIELEELTRRTDARPGSDPRWDSMFNMVLHEETGTVRFNLYECIPGHVKYDYLTSCEVKMKYVADDSTTFWAIGPDSGIIAKHAEFCGDEVEMTVPFEGVNSGELTVRLVLKEWQFS*********************NFISRTGRKINVTVVEGKDLM****SGKCDPYVKLQYGKIVQRTRTAHSPNHVWNQKFELDEIGGGECLMVKCYNEEIFGDENMGSARVNLEGLVEGSVRDIWVPLEKVNTGELRLQIEA*************IGSGNGWIELVIVEARDLVAADLRGTSDPYVKVQYGDLKKRTKVIFKTLNPQWHQTLEFPDDGSPLTLHVRDHNALLASSSIGDCVVEYQRLPPNQMADKWIPLQGVRKGEIHVLITRKVP************************************************************************NKIK*************************
***********SFALNVEQVVEFWKNLLEEKPLLPFVIPLVLLLWVFERWLFSFSNWVPLAIAVWATVQYGQYQHRIHVEELNKKWNQIILKTSPITPLEHCEWLNKLLMEVWPGYINPKLSIRFSQIVEKRLKHRKPRLIEKIELQEFSLGSTSPCLGLHGTRWSSSGDQRVMQLGFDWDANDISILLLAKLAKPLLGTAKIVINSLHIKGDLLVMPILEGKAVLYSFVSIPDVRIGVAFGSGGSQSLPATELPGVSNWLARLINETLVKTLVEPRRRCYSLPAVDLRKKAVGGIVYVRVISASKL**************************EDKDLTTFVEIELEELTRRTDARPGSDPRWDSMFNMVLHEETGTVRFNLYECIPGHVKYDYLTSCEVKMKYVADDSTTFWAIGPDSGIIAKHAEFCGDEVEMTVPFEGVNSGELTVRLVLKEWQFSDGSHSLNNFHS*********SNFISRTGRKINVTVVEGKDLMPKDKSGKCDPYVKLQYGKIVQRTRTAHSPNHVWNQKFELDEIGGGECLMVKCYNEEIFGDENMGSARVNLEGLVEGSVRDIWVPLEKVNTGELRLQIEATRVDDNEGSRGQNIGSGNGWIELVIVEARDLVAADLRGTSDPYVKVQYGDLKKRTKVIFKTLNPQWHQTLEFPDDGSPLTLHVRDHNALLASSSIGDCVVEYQRLPPNQMADKWIPLQGVRKGEIHVLITRKVPELDK****************SGQMKQMMVKFQSLIDDDNLEELSTALSELETLEDSQEEYMVQLETEQMLLLNKIKELGQEIINSSPSINRRSPGNGAIPY
**********RSFALNVEQVVEFWKNLLEEKPLLPFVIPLVLLLWVFERWLFSFSNWVPLAIAVWATVQYGQYQHRIHVEELNKKWNQIILKTSPITPLEHCEWLNKLLMEVWPGYINPKLSIRFSQIVEKRLKHRKPRLIEKIELQEFSLGSTSPCLGLHGTRWSSSGDQRVMQLGFDWDANDISILLLAKLAKPLLGTAKIVINSLHIKGDLLVMPILEGKAVLYSFVSIPDVRIGVAFGSGGSQSLPATELPGVSNWLARLINETLVKTLVEPRRRCYSLPAVDLRKKAVGGIVYVRVISASKLSRSSLRGSPSRRQQNYSADSSLEEHYEDKDLTTFVEIELEELTRRTDARPGSDPRWDSMFNMVLHEETGTVRFNLYECIPGHVKYDYLTSCEVKMKYVADDSTTFWAIGPDSGIIAKHAEFCGDEVEMTVPFEGVNSGELTVRLVLKEWQFSD************************RTGRKINVTVVEGKDLMPKDKSGKCDPYVKLQYGKIVQRTRTAHSPNHVWNQKFELDEIGGGECLMVKCYNEEIFGDENMGSARVNLEGLVEGSVRDIWVPLEKVNTGELRLQIEATRVDDNEGSRGQNIGSGNGWIELVIVEARDLVAADLRGTSDPYVKVQYGDLKKRTKVIFKTLNPQWHQTLEFPDDGSPLTLHVRDHNALLASSSIGDCVVEYQRLPPNQMADKWIPLQGVRKGEIHVLITRKVPELDKRT***********************************E****LSELETLEDSQEEYMVQLETEQMLLLNKIKELGQEIINSSP*IN***P*N*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARSRRKKGARSFALNVEQVVEFWKNLLEEKPLLPFVIPLVLLLWVFERWLFSFSNWVPLAIAVWATVQYGQYQHRIHVEELNKKWNQIILKTSPITPLEHCEWLNKLLMEVWPGYINPKLSIRFSQIVEKRLKHRKPRLIEKIELQEFSLGSTSPCLGLHGTRWSSSGDQRVMQLGFDWDANDISILLLAKLAKPLLGTAKIVINSLHIKGDLLVMPILEGKAVLYSFVSIPDVRIGVAFGSGGSQSLPATELPGVSNWLARLINETLVKTLVEPRRRCYSLPAVDLRKKAVGGIVYVRVISASKLSRSSLRGSPSRRQQNYSADSSLEEHYEDKDLTTFVEIELEELTRRTDARPGSDPRWDSMFNMVLHEETGTVRFNLYECIPGHVKYDYLTSCEVKMKYVADDSTTFWAIGPDSGIIAKHAEFCGDEVEMTVPFEGVNSGELTVRLVLKEWQFSDGSHSLNNFHSGSQQSLSGSSNFISRTGRKINVTVVEGKDLMPKDKSGKCDPYVKLQYGKIVQRTRTAHSPNHVWNQKFELDEIGGGECLMVKCYNEEIFGDENMGSARVNLEGLVEGSVRDIWVPLEKVNTGELRLQIEATRVDDNEGSRGQNIGSGNGWIELVIVEARDLVAADLRGTSDPYVKVQYGDLKKRTKVIFKTLNPQWHQTLEFPDDGSPLTLHVRDHNALLASSSIGDCVVEYQRLPPNQMADKWIPLQGVRKGEIHVLITRKVPELDKRTSIDSDSSSTRAHKISGQMKQMMVKFQSLIDDDNLEELSTAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIINSSPSINRRSPGNGAIPY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query835 2.2.26 [Sep-21-2011]
Q8L706560 Synaptotagmin-5 OS=Arabid no no 0.283 0.423 0.263 2e-18
A0JJX5569 Synaptotagmin-4 OS=Arabid no no 0.283 0.416 0.273 3e-18
Q93XX4 751 C2 domain-containing prot no no 0.125 0.139 0.354 4e-13
O95294 804 RasGAP-activating-like pr yes no 0.245 0.254 0.279 3e-11
O43374 803 Ras GTPase-activating pro no no 0.259 0.270 0.257 3e-11
C9J798 803 Putative Ras GTPase-activ no no 0.259 0.270 0.257 3e-11
Q9Z268 799 RasGAP-activating-like pr no no 0.245 0.256 0.279 7e-11
Q6PFQ7 802 Ras GTPase-activating pro no no 0.259 0.270 0.257 8e-11
Q6DN12 878 Multiple C2 and transmemb no no 0.320 0.305 0.235 2e-10
Q5RJH2 878 Multiple C2 and transmemb no no 0.319 0.304 0.223 5e-10
>sp|Q8L706|SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana GN=SYT5 PE=2 SV=1 Back     alignment and function desciption
 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 134/285 (47%), Gaps = 48/285 (16%)

Query: 490 INVTVVEGKDLMPKDKSGKCDPYVKLQYGKIVQRTRTAHSPNH----VWNQKFE-LDEIG 544
           + V +V+ K+L  KD  GK DP+ K+    + ++T+ + + N+    +WN+ FE + E  
Sbjct: 264 LEVKLVQAKNLTNKDLVGKSDPFAKMFIRPLREKTKRSKTINNDLNPIWNEHFEFVVEDA 323

Query: 545 GGECLMVKCYNEE-IFGDENMGSARVNLEGLVEGSVRDIWVPLEK--------VNTGELR 595
             + L+V+ Y++E +   E +G A++ L  L  G V+D+W+ L K         N GE+ 
Sbjct: 324 STQHLVVRIYDDEGVQASELIGCAQIRLCELEPGKVKDVWLKLVKDLEIQRDTKNRGEVH 383

Query: 596 LQI----------------------------EATRVDDNEGSRGQNIGSGNGWIELVIVE 627
           L++                              T  ++N  SR +      G + + ++ 
Sbjct: 384 LELLYIPYGSGNGIVNPFVTSSMTSLERVLKNDTTDEENASSRKRKDVIVRGVLSVTVIS 443

Query: 628 ARDLVAADLRGTSDPYV--KVQYGDLKKRTKVIFKTLNPQWHQTLEF-PDDG--SPLTLH 682
           A ++   DL G +DPYV   ++    K +T+V+  +LNP W+QT +F  +DG    L L 
Sbjct: 444 AEEIPIQDLMGKADPYVVLSMKKSGAKSKTRVVNDSLNPVWNQTFDFVVEDGLHDMLVLE 503

Query: 683 VRDHNALLASSSIGDCVVEYQRLPPNQMADKWIPLQGVRKGEIHV 727
           V DH+       IG C++   R+   +    W PL   + G++ +
Sbjct: 504 VWDHDT-FGKDYIGRCILTLTRVIMEEEYKDWYPLDESKTGKLQL 547
May be involved in membrane trafficking.
Arabidopsis thaliana (taxid: 3702)
>sp|A0JJX5|SYT4_ARATH Synaptotagmin-4 OS=Arabidopsis thaliana GN=SYT4 PE=2 SV=1 Back     alignment and function description
>sp|Q93XX4|C2D61_ARATH C2 domain-containing protein At1g53590 OS=Arabidopsis thaliana GN=NTMC2T6.1 PE=1 SV=2 Back     alignment and function description
>sp|O95294|RASL1_HUMAN RasGAP-activating-like protein 1 OS=Homo sapiens GN=RASAL1 PE=1 SV=3 Back     alignment and function description
>sp|O43374|RASL2_HUMAN Ras GTPase-activating protein 4 OS=Homo sapiens GN=RASA4 PE=2 SV=2 Back     alignment and function description
>sp|C9J798|RAS4B_HUMAN Putative Ras GTPase-activating protein 4B OS=Homo sapiens GN=RASA4B PE=5 SV=2 Back     alignment and function description
>sp|Q9Z268|RASL1_MOUSE RasGAP-activating-like protein 1 OS=Mus musculus GN=Rasal1 PE=2 SV=2 Back     alignment and function description
>sp|Q6PFQ7|RASL2_MOUSE Ras GTPase-activating protein 4 OS=Mus musculus GN=Rasa4 PE=2 SV=1 Back     alignment and function description
>sp|Q6DN12|MCTP2_HUMAN Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens GN=MCTP2 PE=1 SV=3 Back     alignment and function description
>sp|Q5RJH2|MCTP2_MOUSE Multiple C2 and transmembrane domain-containing protein 2 OS=Mus musculus GN=Mctp2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query835
255582757829 synaptotagmin, putative [Ricinus communi 0.961 0.968 0.731 0.0
359491448822 PREDICTED: uncharacterized protein LOC10 0.976 0.991 0.740 0.0
297734213815 unnamed protein product [Vitis vinifera] 0.967 0.991 0.736 0.0
449439403817 PREDICTED: extended synaptotagmin-1-like 0.955 0.976 0.727 0.0
224135377825 plant synaptotagmin [Populus trichocarpa 0.970 0.981 0.733 0.0
224118810819 plant synaptotagmin [Populus trichocarpa 0.965 0.984 0.733 0.0
449441149838 PREDICTED: synaptotagmin-4-like [Cucumis 0.988 0.984 0.699 0.0
357500377828 Plant synaptotagmin [Medicago truncatula 0.967 0.975 0.705 0.0
356522767826 PREDICTED: uncharacterized protein LOC10 0.974 0.985 0.704 0.0
147815879783 hypothetical protein VITISV_035295 [Viti 0.883 0.942 0.702 0.0
>gi|255582757|ref|XP_002532155.1| synaptotagmin, putative [Ricinus communis] gi|223528165|gb|EEF30229.1| synaptotagmin, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1270 bits (3287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 588/804 (73%), Positives = 700/804 (87%), Gaps = 1/804 (0%)

Query: 14  ALNVEQVVEFWKNLLEEKPLLPFVIPLVLLLWVFERWLFSFSNWVPLAIAVWATVQYGQY 73
           +  VE+ VEF  +L  EKP+LPF+IPL  + W  ERW+FS SNWVPL +AVWATVQY  +
Sbjct: 14  SFTVEEAVEFLNHLYAEKPVLPFLIPLFFIFWCVERWVFSLSNWVPLVLAVWATVQYYIH 73

Query: 74  QHRIHVEELNKKWNQIILKTSPITPLEHCEWLNKLLMEVWPGYINPKLSIRFSQIVEKRL 133
           Q +I VE+LN+KW +++L TSPITP+EHCEWLNKLL+EVW  YI+PKLS RFS +VEKRL
Sbjct: 74  QRQILVEDLNRKWKRVVLSTSPITPVEHCEWLNKLLLEVWLNYIHPKLSTRFSSMVEKRL 133

Query: 134 KHRKPRLIEKIELQEFSLGSTSPCLGLHGTRWSSSGDQRVMQLGFDWDANDISILLLAKL 193
           K RK +LIE++ELQEFSLGS  PC GL GT WS+SGDQR M++GFDWD +DISI+LLAKL
Sbjct: 134 KQRKSKLIERVELQEFSLGSFPPCFGLQGTHWSTSGDQRFMRIGFDWDTSDISIMLLAKL 193

Query: 194 AKPLLGTAKIVINSLHIKGDLLVMPILEGKAVLYSFVSIPDVRIGVAFGSGGSQSLPATE 253
           AKP+ GTA+IVINSLHIKGDLL+MP+++G+A+LYSF+S P+VRIGVAFGSGGSQSLPATE
Sbjct: 194 AKPM-GTARIVINSLHIKGDLLLMPVVDGRAILYSFISAPEVRIGVAFGSGGSQSLPATE 252

Query: 254 LPGVSNWLARLINETLVKTLVEPRRRCYSLPAVDLRKKAVGGIVYVRVISASKLSRSSLR 313
           LPGVS+WL +++ +TLVKT+VEPRRRCYSLPAVDLRKKAVGG+++V VISA KL  S  R
Sbjct: 253 LPGVSSWLVKILTDTLVKTMVEPRRRCYSLPAVDLRKKAVGGVIHVTVISARKLCTSPFR 312

Query: 314 GSPSRRQQNYSADSSLEEHYEDKDLTTFVEIELEELTRRTDARPGSDPRWDSMFNMVLHE 373
           GSPSR+QQN S + S EEH++DKDL TFVE+ELE+LTRRT+ RPGS PRWDS FNMVLHE
Sbjct: 313 GSPSRKQQNCSVNCSSEEHFDDKDLQTFVEVELEQLTRRTNVRPGSSPRWDSTFNMVLHE 372

Query: 374 ETGTVRFNLYECIPGHVKYDYLTSCEVKMKYVADDSTTFWAIGPDSGIIAKHAEFCGDEV 433
           ETG +RF+LY C P +VK+DYL SCE+K+KYVADDST FWA+G +SG+IA+ AE CG EV
Sbjct: 373 ETGILRFHLYNCTPNNVKFDYLASCEIKLKYVADDSTMFWAVGHNSGVIAELAEICGKEV 432

Query: 434 EMTVPFEGVNSGELTVRLVLKEWQFSDGSHSLNNFHSGSQQSLSGSSNFISRTGRKINVT 493
           EM VPFEGVNSGEL V+LVLKEWQFSDGSHS N F   S++S++G SN +SRTGRKINV 
Sbjct: 433 EMAVPFEGVNSGELIVKLVLKEWQFSDGSHSFNKFPVSSRKSMTGLSNLVSRTGRKINVV 492

Query: 494 VVEGKDLMPKDKSGKCDPYVKLQYGKIVQRTRTAHSPNHVWNQKFELDEIGGGECLMVKC 553
           VVEGKDL  K+KSGKCDPYVKLQYGK +QRTRTA + N +WNQKFE DEI GGECLM+KC
Sbjct: 493 VVEGKDLSAKEKSGKCDPYVKLQYGKAIQRTRTATASNAIWNQKFEFDEIEGGECLMIKC 552

Query: 554 YNEEIFGDENMGSARVNLEGLVEGSVRDIWVPLEKVNTGELRLQIEATRVDDNEGSRGQN 613
           Y+EE+FGD+ MGSARV+LEGLVEGS+RD+WVPLEKV++GELRLQIEA RVDD EGS+G  
Sbjct: 553 YSEEMFGDDGMGSARVSLEGLVEGSIRDVWVPLEKVSSGELRLQIEAVRVDDYEGSKGSI 612

Query: 614 IGSGNGWIELVIVEARDLVAADLRGTSDPYVKVQYGDLKKRTKVIFKTLNPQWHQTLEFP 673
            GS NGWIELV++EA+DL+AADLRGTSDPYV+VQYG+LKKRTKV++KTLNPQW+QTLEFP
Sbjct: 613 AGSKNGWIELVLIEAKDLIAADLRGTSDPYVRVQYGNLKKRTKVMYKTLNPQWNQTLEFP 672

Query: 674 DDGSPLTLHVRDHNALLASSSIGDCVVEYQRLPPNQMADKWIPLQGVRKGEIHVLITRKV 733
           DDGSPL LHV+DHNALL +SSIGDCVVEYQ LPPNQM+DKWIPLQGV++GEIHV +TRK+
Sbjct: 673 DDGSPLMLHVKDHNALLPTSSIGDCVVEYQGLPPNQMSDKWIPLQGVKRGEIHVKVTRKI 732

Query: 734 PELDKRTSIDSDSSSTRAHKISGQMKQMMVKFQSLIDDDNLEELSTALSELETLEDSQEE 793
           PE+ KR S+DS++S T++H+ S QMKQMM+KF SLI+D +LE LSTALSE+E +E+ QEE
Sbjct: 733 PEIQKRPSLDSEASLTKSHQFSSQMKQMMIKFHSLIEDGDLEGLSTALSEMEGIEEMQEE 792

Query: 794 YMVQLETEQMLLLNKIKELGQEII 817
           YMVQLE EQ LLL KIKELGQEI 
Sbjct: 793 YMVQLEMEQTLLLEKIKELGQEIF 816

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359491448|ref|XP_002276429.2| PREDICTED: uncharacterized protein LOC100262742 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734213|emb|CBI15460.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449439403|ref|XP_004137475.1| PREDICTED: extended synaptotagmin-1-like [Cucumis sativus] gi|449486832|ref|XP_004157416.1| PREDICTED: extended synaptotagmin-1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224135377|ref|XP_002322058.1| plant synaptotagmin [Populus trichocarpa] gi|222869054|gb|EEF06185.1| plant synaptotagmin [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224118810|ref|XP_002317912.1| plant synaptotagmin [Populus trichocarpa] gi|222858585|gb|EEE96132.1| plant synaptotagmin [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449441149|ref|XP_004138346.1| PREDICTED: synaptotagmin-4-like [Cucumis sativus] gi|449477454|ref|XP_004155027.1| PREDICTED: synaptotagmin-4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357500377|ref|XP_003620477.1| Plant synaptotagmin [Medicago truncatula] gi|355495492|gb|AES76695.1| Plant synaptotagmin [Medicago truncatula] Back     alignment and taxonomy information
>gi|356522767|ref|XP_003530017.1| PREDICTED: uncharacterized protein LOC100789237 [Glycine max] Back     alignment and taxonomy information
>gi|147815879|emb|CAN72583.1| hypothetical protein VITISV_035295 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query835
TAIR|locus:2095062815 ATSYTF "AT3G18370" [Arabidopsi 0.959 0.982 0.553 1.3e-242
TAIR|locus:2184931569 SYTD "AT5G11100" [Arabidopsis 0.119 0.175 0.377 1.4e-24
TAIR|locus:2089601 737 NTMC2T6.2 [Arabidopsis thalian 0.125 0.142 0.372 1.1e-21
TAIR|locus:2024912 751 NTMC2T6.1 [Arabidopsis thalian 0.125 0.139 0.354 3e-18
RGD|1305199 946 Mctp1 "multiple C2 domains, tr 0.176 0.155 0.312 2.4e-16
ZFIN|ZDB-GENE-050506-136 665 mctp2b "multiple C2 domains, t 0.098 0.123 0.333 1.4e-15
WB|WBGene00020443713 esyt-2 [Caenorhabditis elegans 0.215 0.252 0.292 1.4e-14
UNIPROTKB|Q6DN14 999 MCTP1 "Multiple C2 and transme 0.129 0.108 0.350 1.9e-14
SGD|S0000056121186 TCB1 "Lipid-binding ER protein 0.154 0.108 0.272 3.3e-13
TAIR|locus:2201036560 NTMC2T2.1 "AT1G05500" [Arabido 0.203 0.303 0.280 5.3e-13
TAIR|locus:2095062 ATSYTF "AT3G18370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2338 (828.1 bits), Expect = 1.3e-242, P = 1.3e-242
 Identities = 451/815 (55%), Positives = 569/815 (69%)

Query:     1 MARSRRKKGARSFALNVEQVVEFWKNLLEEKXXXXXXXXXXXXXXXFERWLFSFSNWVPL 60
             M R  ++KG     +N E   EF  +L+ E+                ERW+F+FSNWVPL
Sbjct:     1 MGRRIKRKGL----INTEAAREFINHLVAERHSLLLLVPLVLAFWAIERWVFAFSNWVPL 56

Query:    61 AIAVWATVQYGQYQHRIHVEELNKKWNQIILKTSPITPLEHCEWLNKLLMEVWPGYINPK 120
              +AVWA++QYG YQ  +  E+L KKW Q +   S ITPLEHC+WLNKLL E+W  Y+N K
Sbjct:    57 VVAVWASLQYGSYQRALLAEDLTKKWRQTVFNASTITPLEHCQWLNKLLSEIWLNYMNKK 116

Query:   121 LSIRFSQIVEKRLKHRKPRLIEKIELQEFSLGSTSPCLGLHGTRWSSSGDQRVMQLGFDW 180
             LS+RFS +VEKRL+ R+ RLIE I+L EFSLGS  P LGLHGT WS SG+Q++M+L F+W
Sbjct:   117 LSLRFSSMVEKRLRQRRSRLIENIQLLEFSLGSCPPLLGLHGTCWSKSGEQKIMRLDFNW 176

Query:   181 DANDISIXXXXXXXXXXXXXXXIVINSLHIKGDLLVMPILEGKAVLYSFVSIPDVRIGVA 240
             D  D+SI               IV+NSL IKGD+L+ PILEG+A+LYSFVS P+VRIGVA
Sbjct:   177 DTTDLSILLQAKLSMPFNRTARIVVNSLCIKGDILIRPILEGRALLYSFVSNPEVRIGVA 236

Query:   241 FGSGGSQSLPATELPGVSNWLARLINETLVKTLVEPRRRCYSLPAVDLRKKAVGGIVYVX 300
             FG GG QSLPATELPGVS+WL +++ ETL K +VEPRR C+SLPA DL K A+GGI+YV 
Sbjct:   237 FGGGGGQSLPATELPGVSSWLVKILTETLNKKMVEPRRGCFSLPATDLHKTAIGGIIYVT 296

Query:   301 XXXXXXXXXXXXXXXXXXXQQNYSADSSLEEHYEDKDLTTFVEIELEELTRRTDARPGSD 360
                                 +     S    +   K + TFVE+ELE+L+RRT+ + G +
Sbjct:   297 VVSGNNLNRRILRGSPSKSSEIGEGSSG---NSSSKPVQTFVEVELEQLSRRTEMKSGPN 353

Query:   361 PRWDSMFNMVLHEETGTVRFNLYECIPGHVKYDYLTSCEVKMKYVADDSTTFWAIGPDSG 420
             P + S FNM+LH+ TGT++FNLYE  PG V+YD L SCEVKMKYV DDST FWA+G D+G
Sbjct:   354 PAYQSTFNMILHDNTGTLKFNLYENNPGSVRYDSLASCEVKMKYVGDDSTMFWAVGSDNG 413

Query:   421 IIAKHAEFCGDEVEMTVPFEGVNSGELTVRLVLKEWQFSDGSHSLNNFHXXXXXXXXXXX 480
             +IAKHAEFCG E+EM VPFEGV+SGELTVRL+LKEW FSDGSHSLN+ +           
Sbjct:   414 VIAKHAEFCGQEIEMVVPFEGVSSGELTVRLLLKEWHFSDGSHSLNSVNSSSLHSLDSSS 473

Query:   481 NFISRTGRKINVTVVEGKDLMPKDKSGKCDPYVKLQYGKIVQRTRTAHSPNHVWNQKFEL 540
               +S+TGRKI VTV+ GK+L+ KDKSGKCD  VKLQYGKI+Q+T+  ++   VWNQKFE 
Sbjct:   474 ALLSKTGRKIIVTVLAGKNLVSKDKSGKCDASVKLQYGKIIQKTKIVNAAECVWNQKFEF 533

Query:   541 DEIGGGECLMVKCYNEEIFGDENMGSARVNLEGLVEGSVRDIWVPLEKVNTGELRLQIEA 600
             +E+ G E L VKCY EE+ G +N+G+A ++L+G +  S   IWVPLE VN+GE+ L IEA
Sbjct:   534 EELAGEEYLKVKCYREEMLGTDNIGTATLSLQG-INNSEMHIWVPLEDVNSGEIELLIEA 592

Query:   601 TRVDDNEGSRGQNIGSGNGWIELVIVEARDLVAADLRGTSDPYVKVQYGDLKKRTKVIFK 660
                 D E S      S  G IELV+VEARDLVAAD+RGTSDPYV+VQYG+ K+RTKVI+K
Sbjct:   593 L---DPEYSEAD---SSKGLIELVLVEARDLVAADIRGTSDPYVRVQYGEKKQRTKVIYK 646

Query:   661 TLNPQWHQTLEFPDDGSPLTLHVRDHNALLASSSIGDCVVEYQRLPPNQMADKWIPLQGV 720
             TL P+W+QT+EFPDDGS L LHV+D+N LL +SSIG+CVVEYQ L PN+ ADKWI LQGV
Sbjct:   647 TLQPKWNQTMEFPDDGSSLELHVKDYNTLLPTSSIGNCVVEYQGLKPNETADKWIILQGV 706

Query:   721 RKGEIHVLITRKVPELDKXXXXXXXXXXXXAHKISGQMKQMMVKFQSLIDDDNXXXXXXX 780
             + GE+HV +TRKV E+ +            A  +S QMKQ+M+KFQ+LIDD +       
Sbjct:   707 KHGEVHVRVTRKVTEIQRRASAGPGTPFNKALLLSNQMKQVMIKFQNLIDDGDLEGLAEA 766

Query:   781 XXXXXXXXDSQEEYMVQLETEQMLLLNKIKELGQE 815
                     D QE+Y++QL+TEQ LL+NKIK+LG+E
Sbjct:   767 LEELESLEDEQEQYLLQLQTEQSLLINKIKDLGKE 801
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0005783 "endoplasmic reticulum" evidence=IDA
TAIR|locus:2184931 SYTD "AT5G11100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089601 NTMC2T6.2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024912 NTMC2T6.1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1305199 Mctp1 "multiple C2 domains, transmembrane 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050506-136 mctp2b "multiple C2 domains, transmembrane 2b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00020443 esyt-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DN14 MCTP1 "Multiple C2 and transmembrane domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
SGD|S000005612 TCB1 "Lipid-binding ER protein involved in ER-plasma membrane tethering" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TAIR|locus:2201036 NTMC2T2.1 "AT1G05500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query835
cd00030102 cd00030, C2, C2 domain 4e-22
pfam0016885 pfam00168, C2, C2 domain 9e-19
smart00239101 smart00239, C2, Protein kinase C conserved region 2e-17
cd00030102 cd00030, C2, C2 domain 2e-16
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 8e-16
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 2e-15
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 3e-15
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 7e-15
pfam0016885 pfam00168, C2, C2 domain 9e-15
smart00239101 smart00239, C2, Protein kinase C conserved region 6e-14
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 2e-12
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 3e-12
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 8e-12
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 8e-12
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 2e-11
cd08377119 cd08377, C2C_MCTP_PRT, C2 domain third repeat foun 2e-11
cd08405136 cd08405, C2B_Synaptotagmin-7, C2 domain second rep 2e-11
cd04027127 cd04027, C2B_Munc13, C2 domain second repeat in Mu 3e-11
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 4e-11
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 6e-11
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 7e-11
cd04017135 cd04017, C2D_Ferlin, C2 domain fourth repeat in Fe 1e-10
COG5038 1227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 1e-10
cd04027127 cd04027, C2B_Munc13, C2 domain second repeat in Mu 3e-10
cd08373127 cd08373, C2A_Ferlin, C2 domain first repeat in Fer 3e-10
cd04020162 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat 6e-10
cd04026131 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein 1e-09
cd04035123 cd04035, C2A_Rabphilin_Doc2, C2 domain first repea 1e-09
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 2e-09
cd08385124 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain 2e-09
cd08375136 cd08375, C2_Intersectin, C2 domain present in Inte 2e-09
cd08386125 cd08386, C2A_Synaptotagmin-7, C2A domain first rep 4e-09
cd08402136 cd08402, C2B_Synaptotagmin-1, C2 domain second rep 2e-08
cd04011111 cd04011, C2B_Ferlin, C2 domain second repeat in Fe 2e-08
cd04037124 cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer 2e-08
cd04031125 cd04031, C2A_RIM1alpha, C2 domain first repeat con 2e-08
cd04009133 cd04009, C2B_Munc13-like, C2 domain second repeat 2e-08
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 3e-08
cd04037124 cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer 3e-08
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 4e-08
cd04054121 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat 4e-08
cd04030127 cd04030, C2C_KIAA1228, C2 domain third repeat pres 4e-08
cd08379126 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repe 8e-08
cd04019150 cd04019, C2C_MCTP_PRT_plant, C2 domain third repea 8e-08
cd08688110 cd08688, C2_KIAA0528-like, C2 domain found in the 1e-07
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 2e-07
cd04032127 cd04032, C2_Perforin, C2 domain of Perforin 2e-07
cd04035123 cd04035, C2A_Rabphilin_Doc2, C2 domain first repea 3e-07
cd08403134 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s 3e-07
cd08681118 cd08681, C2_fungal_Inn1p-like, C2 domain found in 3e-07
cd08675137 cd08675, C2B_RasGAP, C2 domain second repeat of Ra 3e-07
cd04018151 cd04018, C2C_Ferlin, C2 domain third repeat in Fer 4e-07
cd04041111 cd04041, C2A_fungal, C2 domain first repeat; funga 5e-07
cd04019150 cd04019, C2C_MCTP_PRT_plant, C2 domain third repea 8e-07
cd04026131 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein 9e-07
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 9e-07
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 1e-06
cd08378121 cd08378, C2B_MCTP_PRT_plant, C2 domain second repe 2e-06
cd04043126 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma 2e-06
cd08521123 cd08521, C2A_SLP, C2 domain first repeat present i 3e-06
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 4e-06
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 5e-06
cd04036119 cd04036, C2_cPLA2, C2 domain present in cytosolic 5e-06
cd08681118 cd08681, C2_fungal_Inn1p-like, C2 domain found in 6e-06
cd04052111 cd04052, C2B_Tricalbin-like, C2 domain second repe 6e-06
cd08388128 cd08388, C2A_Synaptotagmin-4-11, C2A domain first 1e-05
cd08384133 cd08384, C2B_Rabphilin_Doc2, C2 domain second repe 1e-05
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 2e-05
cd08405136 cd08405, C2B_Synaptotagmin-7, C2 domain second rep 3e-05
cd04043126 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma 3e-05
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 3e-05
cd04017135 cd04017, C2D_Ferlin, C2 domain fourth repeat in Fe 4e-05
cd04028146 cd04028, C2B_RIM1alpha, C2 domain second repeat co 4e-05
cd08383117 cd08383, C2A_RasGAP, C2 domain (first repeat) of R 5e-05
cd08375136 cd08375, C2_Intersectin, C2 domain present in Inte 7e-05
cd08404136 cd08404, C2B_Synaptotagmin-4, C2 domain second rep 8e-05
cd08676153 cd08676, C2A_Munc13-like, C2 domain first repeat i 8e-05
cd04045120 cd04045, C2C_Tricalbin-like, C2 domain third repea 9e-05
cd04051125 cd04051, C2_SRC2_like, C2 domain present in Soybea 1e-04
cd08379126 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repe 2e-04
cd04050105 cd04050, C2B_Synaptotagmin-like, C2 domain second 3e-04
cd08387124 cd08387, C2A_Synaptotagmin-8, C2A domain first rep 3e-04
cd04033133 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the 4e-04
cd04015158 cd04015, C2_plant_PLD, C2 domain present in plant 4e-04
COG5038 1227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 5e-04
cd08382123 cd08382, C2_Smurf-like, C2 domain present in Smad 5e-04
cd08393125 cd08393, C2A_SLP-1_2, C2 domain first repeat prese 5e-04
cd04052111 cd04052, C2B_Tricalbin-like, C2 domain second repe 6e-04
cd04051125 cd04051, C2_SRC2_like, C2 domain present in Soybea 6e-04
cd08381122 cd08381, C2B_PI3K_class_II, C2 domain second repea 9e-04
cd08377119 cd08377, C2C_MCTP_PRT, C2 domain third repeat foun 0.001
cd08675137 cd08675, C2B_RasGAP, C2 domain second repeat of Ra 0.001
cd08682126 cd08682, C2_Rab11-FIP_classI, C2 domain found in R 0.001
cd08373127 cd08373, C2A_Ferlin, C2 domain first repeat in Fer 0.002
cd04032127 cd04032, C2_Perforin, C2 domain of Perforin 0.002
cd00275128 cd00275, C2_PLC_like, C2 domain present in Phospho 0.002
cd08389124 cd08389, C2A_Synaptotagmin-14_16, C2A domain first 0.002
cd08682126 cd08682, C2_Rab11-FIP_classI, C2 domain found in R 0.003
cd04014132 cd04014, C2_PKC_epsilon, C2 domain in Protein Kina 0.004
cd04010148 cd04010, C2B_RasA3, C2 domain second repeat presen 0.004
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information 
 Score = 91.4 bits (227), Expect = 4e-22
 Identities = 38/102 (37%), Positives = 57/102 (55%), Gaps = 5/102 (4%)

Query: 621 IELVIVEARDLVAADLRGTSDPYVKVQYGDLKK-RTKVIFKTLNPQWHQTLEFP---DDG 676
           + + ++EAR+L A DL G SDPYVKV  G  +K +TKV+  TLNP W++T EFP    + 
Sbjct: 1   LRVTVIEARNLPAKDLNGKSDPYVKVSLGGKQKFKTKVVKNTLNPVWNETFEFPVLDPES 60

Query: 677 SPLTLHVRDHNALLASSSIGDCVVEYQRL-PPNQMADKWIPL 717
             LT+ V D +       +G+  +    L    +  + W+PL
Sbjct: 61  DTLTVEVWDKDRFSKDDFLGEVEIPLSELLDSGKEGELWLPL 102

The C2 domain was first identified in PKC. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. Length = 102
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin Back     alignment and domain information
>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>gnl|CDD|176018 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>gnl|CDD|176025 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|175998 cd04032, C2_Perforin, C2 domain of Perforin Back     alignment and domain information
>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|175985 cd04018, C2C_Ferlin, C2 domain third repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176006 cd04041, C2A_fungal, C2 domain first repeat; fungal group Back     alignment and domain information
>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175994 cd04028, C2B_RIM1alpha, C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>gnl|CDD|176029 cd08383, C2A_RasGAP, C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin Back     alignment and domain information
>gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>gnl|CDD|176025 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>gnl|CDD|175982 cd04015, C2_plant_PLD, C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|176028 cd08382, C2_Smurf-like, C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>gnl|CDD|176039 cd08393, C2A_SLP-1_2, C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>gnl|CDD|176027 cd08381, C2B_PI3K_class_II, C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175998 cd04032, C2_Perforin, C2 domain of Perforin Back     alignment and domain information
>gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>gnl|CDD|176035 cd08389, C2A_Synaptotagmin-14_16, C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>gnl|CDD|175981 cd04014, C2_PKC_epsilon, C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>gnl|CDD|175977 cd04010, C2B_RasA3, C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 835
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 100.0
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.95
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.93
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 99.91
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 99.87
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.87
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.85
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.83
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.82
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.82
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.82
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.81
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.8
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.8
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.8
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.8
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.8
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 99.8
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.8
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.79
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.79
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.79
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.79
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.78
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.78
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.78
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.78
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.78
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.77
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.77
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.77
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.77
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.77
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.77
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.77
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.76
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.76
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.76
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.75
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.75
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.75
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.75
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.74
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.74
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.74
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.74
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.74
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.74
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.74
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.74
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.73
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.72
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.72
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.71
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.71
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.71
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.71
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.71
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.71
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.7
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.7
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.7
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.7
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.7
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.7
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.7
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.7
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.7
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.7
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.69
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.69
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.69
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.69
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.69
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.69
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.68
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.68
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.68
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.68
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.67
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.67
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.67
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.67
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.67
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.67
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.67
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.66
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.66
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.66
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.66
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.65
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.65
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.64
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.63
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.63
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.63
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.63
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.63
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.63
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.63
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.63
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.62
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.62
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.62
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.62
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.62
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.61
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.61
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.61
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.61
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.61
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.6
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.6
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.6
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.6
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.6
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.6
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.6
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.6
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.59
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.59
KOG0696 683 consensus Serine/threonine protein kinase [Signal 99.59
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.59
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.59
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.58
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.58
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.58
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.58
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.57
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.56
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.56
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.56
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.55
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.55
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.55
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.55
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.54
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.54
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.54
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.54
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.54
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.54
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.54
KOG1326 1105 consensus Membrane-associated protein FER-1 and re 99.54
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.54
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.53
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.53
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.53
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.53
PLN03008 868 Phospholipase D delta 99.53
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.52
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.52
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 99.52
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.52
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.51
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.51
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.51
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.5
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.49
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.48
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.48
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.48
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.46
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.46
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.45
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.45
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.45
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.44
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.43
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.43
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.43
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.43
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.42
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.42
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.4
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.4
PLN03008 868 Phospholipase D delta 99.4
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.39
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.39
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.38
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.38
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.38
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.38
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.37
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.37
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.35
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.35
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.35
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.35
KOG0696 683 consensus Serine/threonine protein kinase [Signal 99.34
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.34
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.33
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.31
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.3
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.3
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 99.29
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.27
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.26
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.22
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.2
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 99.17
KOG13261105 consensus Membrane-associated protein FER-1 and re 99.16
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 99.13
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.12
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.1
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.0
PLN02270 808 phospholipase D alpha 99.0
KOG13281103 consensus Synaptic vesicle protein BAIAP3, involve 98.97
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 98.93
PLN02270 808 phospholipase D alpha 98.89
PLN02223537 phosphoinositide phospholipase C 98.86
KOG1327 529 consensus Copine [Signal transduction mechanisms] 98.82
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 98.81
PLN02952599 phosphoinositide phospholipase C 98.79
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 98.76
KOG1328 1103 consensus Synaptic vesicle protein BAIAP3, involve 98.73
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 98.72
PLN02230598 phosphoinositide phospholipase C 4 98.71
PF1029691 DUF2404: Putative integral membrane protein conser 98.7
PLN02222581 phosphoinositide phospholipase C 2 98.65
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 98.63
PLN02223537 phosphoinositide phospholipase C 98.63
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 98.59
PLN02228567 Phosphoinositide phospholipase C 98.58
KOG0169746 consensus Phosphoinositide-specific phospholipase 98.57
PLN02952599 phosphoinositide phospholipase C 98.5
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.41
PLN02230598 phosphoinositide phospholipase C 4 98.39
PLN02222581 phosphoinositide phospholipase C 2 98.35
KOG0169746 consensus Phosphoinositide-specific phospholipase 98.31
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 98.28
KOG1327529 consensus Copine [Signal transduction mechanisms] 98.27
PLN02228567 Phosphoinositide phospholipase C 98.26
PLN02352 758 phospholipase D epsilon 98.24
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.17
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 98.16
PLN02352 758 phospholipase D epsilon 98.02
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 97.98
PF12416340 DUF3668: Cep120 protein; InterPro: IPR022136 This 97.7
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 97.68
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 97.57
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 97.46
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 97.41
PLN02964644 phosphatidylserine decarboxylase 97.32
PLN02964 644 phosphatidylserine decarboxylase 97.09
KOG3837523 consensus Uncharacterized conserved protein, conta 97.06
PF12416 340 DUF3668: Cep120 protein; InterPro: IPR022136 This 96.59
KOG3837523 consensus Uncharacterized conserved protein, conta 96.51
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 96.46
PF15627156 CEP76-C2: CEP76 C2 domain 95.55
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 95.0
PF15627156 CEP76-C2: CEP76 C2 domain 94.75
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 94.71
cd08397159 C2_PI3K_class_III C2 domain present in class III p 94.29
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 94.23
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 94.21
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 94.18
KOG1265 1189 consensus Phospholipase C [Lipid transport and met 93.94
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 93.53
KOG1265 1189 consensus Phospholipase C [Lipid transport and met 92.96
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 92.84
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 92.68
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 91.36
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 90.69
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 90.42
cd08397159 C2_PI3K_class_III C2 domain present in class III p 88.67
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 88.38
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 87.51
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 87.29
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 86.8
KOG1452 442 consensus Predicted Rho GTPase-activating protein 86.38
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 85.88
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 82.77
cd08695189 C2_Dock-B C2 domains found in Dedicator Of CytoKin 82.65
KOG1452442 consensus Predicted Rho GTPase-activating protein 82.02
PF11618107 DUF3250: Protein of unknown function (DUF3250); In 81.97
cd08694196 C2_Dock-A C2 domains found in Dedicator Of CytoKin 80.82
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=4.5e-87  Score=767.81  Aligned_cols=654  Identities=21%  Similarity=0.281  Sum_probs=534.4

Q ss_pred             HHHHHHhhhcc-CCchhHHHHHHHHHHHHHHHHhhhhhHHHHHHHHhhhhhhhhhhhhhHHHHHHHHHHhhcccCCCCCC
Q 003259           21 VEFWKNLLEEK-PLLPFVIPLVLLLWVFERWLFSFSNWVPLAIAVWATVQYGQYQHRIHVEELNKKWNQIILKTSPITPL   99 (835)
Q Consensus        21 ~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~s~~~w~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~   99 (835)
                      ...+..|+.+| |++++++++++++|++++++||++ -+++++++|+.+|...++|  .++++++..+++....+...++
T Consensus       144 ~y~~~~~y~~w~qs~~i~l~~~v~Swifg~~~fs~~-slffii~~~~~vY~~~~~r--v~rnird~v~~~~~~ek~~nd~  220 (1227)
T COG5038         144 NYILKKFYGDWYQSVAIVLIGSVASWIFGYLGFSFA-SLFFIILVTMYVYRTCIKR--VRRNIRDLVQQELSEEKLENDY  220 (1227)
T ss_pred             hhhhHHHhhhhhhhhhHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHhhhcch
Confidence            45667778888 799999999999999999999987 3334445554444446776  6777777777888888889999


Q ss_pred             cchHHHHHHHHHHCCCCchHHHHHHHHHHHHHHHhhcCCcccccEEEEEEecCCCCCccceeEEEeCCCCCeEEEEEEEE
Q 003259          100 EHCEWLNKLLMEVWPGYINPKLSIRFSQIVEKRLKHRKPRLIEKIELQEFSLGSTSPCLGLHGTRWSSSGDQRVMQLGFD  179 (835)
Q Consensus       100 E~~eWlN~~l~~~W~~~~~~~~~~~i~~~v~~~l~~~~P~~i~~i~~~~f~LG~~pp~i~~ir~~~~~~~d~~~~d~~~~  179 (835)
                      ||+||||+||++|||++ ||.+|+.|.+++|+.|++..|+||++++|++||||++||||.+||+||++++|.+.|||+++
T Consensus       221 ESveWLNtfL~KfW~i~-eP~iSqqV~dqvn~~la~~iPsFI~~l~l~efTLGsk~PrI~~Irsyp~te~dtv~mD~~~s  299 (1227)
T COG5038         221 ESVEWLNTFLQKFWPII-EPSISQQVVDQVNQQLAEAIPSFIDALALDEFTLGSKPPRIDGIRSYPSTESDTVVMDVDFS  299 (1227)
T ss_pred             hHHHHHHHHHHhheecc-ChHHHHHHHHHHHHHHHhhcchhhhhhhhhhcccCCCCCceeeeeecCCCCCceEEEEeeec
Confidence            99999999999999955 99999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeCCchhhhhh--------------hhhcCCcce-eeEEEEEEEEEEEEEEEe-----EeeeccEEEEEeccCCeEEEEe
Q 003259          180 WDANDISILLL--------------AKLAKPLLG-TAKIVINSLHIKGDLLVM-----PILEGKAVLYSFVSIPDVRIGV  239 (835)
Q Consensus       180 ~~~~~~~~~l~--------------~~~~~~~~g-~~~i~v~~~~~~g~~Ri~-----p~~~~~~v~~sf~~~P~vd~~~  239 (835)
                      |+|+|++++.+              ++.|+.+.. ++||.|+|+.|+|++|++     ++|++++|++||||.|+|||.+
T Consensus       300 ftP~d~sD~t~~~~r~~vn~kIsL~v~~Gk~~~~~~lPI~Vedl~f~g~~Rvr~~L~~~~PfiktV~~~Lle~Pe~df~l  379 (1227)
T COG5038         300 FTPHDISDVTATSARASVNPKISLVVKKGKSFGSFTLPILVEDLFFKGRVRVRVELMSKYPFIKTVSFQLLEVPEFDFIL  379 (1227)
T ss_pred             cCccchhhhhhHHHhhhcCcceeEEEEeeeeeeEEeccEEEEeeeeeEEEEEEEEecCCCcceeEEEEEEecCcceeEEE
Confidence            99999888733              344544443 999999999999999997     6788999999999999999999


Q ss_pred             eecCCCCCcCCCCCCccHHHHHHHHHHHHhhcceecCceEEEecCccccc-ccccccEEEEEEEecCCCCCCCCCCCCcc
Q 003259          240 AFGSGGSQSLPATELPGVSNWLARLINETLVKTLVEPRRRCYSLPAVDLR-KKAVGGIVYVRVISASKLSRSSLRGSPSR  318 (835)
Q Consensus       240 ~~~~~~~~~~~i~~iPgl~~~i~~~i~~~l~~~~v~P~~~~~~l~~~~~~-~~~~~GvL~V~V~~A~~L~~~~~~g~~~~  318 (835)
                      +|.+++.+++|||+||||++||+++|+.+|++||++|++++|+|+++... ...++|||.|+|.+|++|+..+..     
T Consensus       380 ~Plg~~~~g~dI~~iPGL~~fI~~~i~~~l~pml~~Pnsl~idi~~~m~~~s~~aIGVv~vkI~sa~~lk~~d~~-----  454 (1227)
T COG5038         380 VPLGGDFFGVDIFAIPGLSRFIQEIINSTLGPMLLPPNSLTIDISQIMAGDSGTAIGVVEVKIKSAEGLKKSDST-----  454 (1227)
T ss_pred             EEcCCCccceeEecCccHHHHHHHHHHhhcCCeeeCCceEEEcHHHhhccccCCeeEEEEEEEeeccCccccccc-----
Confidence            99999899999999999999999999999999999999999999986554 556889999999999999988721     


Q ss_pred             cccccCCCCccccccCCCCcCeEEEEEec--ceeeeeccCCCCCCcccceeEEEEEcCCceEEEEEEEeCCCCCCcceeE
Q 003259          319 RQQNYSADSSLEEHYEDKDLTTFVEIELE--ELTRRTDARPGSDPRWDSMFNMVLHEETGTVRFNLYECIPGHVKYDYLT  396 (835)
Q Consensus       319 ~~~~~~~dpy~~~~~~~~~~dpyv~v~~g--~~~~t~~i~~~~nP~W~etf~~~v~~~~~~L~~~v~d~~~~~~kdd~LG  396 (835)
                        .             ++.+|||+++...  ...||++++++.||+||||||+++++.+++|.++|||++. ..+|+.+|
T Consensus       455 --i-------------~~~vDpyit~~~~~r~~gkT~v~~nt~nPvwNEt~Yi~lns~~d~L~LslyD~n~-~~sd~vvG  518 (1227)
T COG5038         455 --I-------------NGTVDPYITVTFSDRVIGKTRVKKNTLNPVWNETFYILLNSFTDPLNLSLYDFNS-FKSDKVVG  518 (1227)
T ss_pred             --c-------------cCCCCceEEEEeccccCCccceeeccCCccccceEEEEecccCCceeEEEEeccc-cCCcceee
Confidence              0             1224778888763  3468999999999999999999999999999999999987 68899999


Q ss_pred             EEEEecccccCCCcceeeeCCCCccccccccccCceeeeEeecCCCCcceEEEEEEEeecccCCCCcccCccccCCCccc
Q 003259          397 SCEVKMKYVADDSTTFWAIGPDSGIIAKHAEFCGDEVEMTVPFEGVNSGELTVRLVLKEWQFSDGSHSLNNFHSGSQQSL  476 (835)
Q Consensus       397 ~~~i~L~~L~~~~~~~w~v~~~~~~~~~~~~~~g~~~~~~~~~~~~~~G~l~~~l~l~~~~~~d~~~~~~~~~~~~~~~~  476 (835)
                      +..++|..|++++...                 ++..+..  ...++.|+|.+++.+-|...+....         ....
T Consensus       519 ~~~l~L~~L~~~~~~~-----------------ne~~e~~--~~~k~vGrL~yDl~ffp~~e~k~~~---------~~s~  570 (1227)
T COG5038         519 STQLDLALLHQNPVKK-----------------NELYEFL--RNTKNVGRLTYDLRFFPVIEDKKEL---------KGSV  570 (1227)
T ss_pred             eEEechHHhhhccccc-----------------cceeeee--ccCccceEEEEeeeeecccCCcccc---------cccc
Confidence            9999999999875320                 1111111  1223569999988665422211110         0001


Q ss_pred             cCCCCccCCCCcEEEEEEEEeecCCCCCCCCCCCcEEEEEE-CCeEeecccc-CCCCCccceEEEEEeeCC-ceeEEEEE
Q 003259          477 SGSSNFISRTGRKINVTVVEGKDLMPKDKSGKCDPYVKLQY-GKIVQRTRTA-HSPNHVWNQKFELDEIGG-GECLMVKC  553 (835)
Q Consensus       477 ~~~p~~~~~~g~~L~V~V~~a~~L~~~~~~g~~dpyv~v~l-g~~~~kT~~~-~t~nP~Wne~f~f~v~~~-~~~L~i~V  553 (835)
                        +|.....+| ++.+++.++++|.... ......++++++ +++++.|+.+ .+.+|.||+.++..+.+. ...+.+.+
T Consensus       571 --e~~ed~n~G-I~k~tl~~~~~l~~~~-~~~~~~~a~l~~~~keV~st~~~k~t~~~~wn~~~~~~v~~~~ns~~~~~~  646 (1227)
T COG5038         571 --EPLEDSNTG-ILKVTLREVKALDELS-SKKDNKSAELYTNAKEVYSTGKLKFTNHPSWNLQYNVLVTDRKNSSIKVVT  646 (1227)
T ss_pred             --CCcccCCcc-eeEEEeeccccccCcc-ccccceeEEEEecceEEeccceeeeccCCceeeecceEeccCcceeEEEEe
Confidence              122223345 9999999999996432 223334488988 5678899999 999999999999988775 77888999


Q ss_pred             EEeccCCCceEEEEEEeccccccCC-eeeeEEecccCCCceEEEEEEEeecCCCCCCCCCC-CCCcceEEEEEEEEeecC
Q 003259          554 YNEEIFGDENMGSARVNLEGLVEGS-VRDIWVPLEKVNTGELRLQIEATRVDDNEGSRGQN-IGSGNGWIELVIVEARDL  631 (835)
Q Consensus       554 ~d~d~~~d~~IG~~~i~L~~l~~~~-~~~~w~~L~~~~~G~I~l~l~~~~~~~~~~~~~~~-~~~~~g~L~v~v~~a~~L  631 (835)
                      +|..  ..+.||+...+|.+++... ....||++. .++|+|.++..|.|+....++.... +..+.|.++|+|..|.+|
T Consensus       647 ~d~~--~g~~i~~~~~~l~~li~~t~dt~~~f~~~-~~kg~I~~t~~W~Pi~~~~~~~s~~~~~~pIg~irv~v~~andl  723 (1227)
T COG5038         647 FDVQ--SGKVIATEGSTLPDLIDRTLDTFLVFPLR-NPKGRIFITNYWKPIYNAGGSSSKTVYDTPIGAIRVSVRKANDL  723 (1227)
T ss_pred             cccc--cCceeccccccchHhhhccccceEEEEcC-CCcceEEEEeccceeeccccccceeeecCccceEEEEeehhhcc
Confidence            8876  4688999999999988665 556899998 4689999999999998877655443 778999999999999999


Q ss_pred             CcCCcCCCCCCEEEEEECC-eEeeeeeecCCCCCeeeeEEEeecC--CCcEEEEEEECCCCCCCCeEEEEEEEccccCCC
Q 003259          632 VAADLRGTSDPYVKVQYGD-LKKRTKVIFKTLNPQWHQTLEFPDD--GSPLTLHVRDHNALLASSSIGDCVVEYQRLPPN  708 (835)
Q Consensus       632 ~~~d~~g~~DPyv~v~~~~-~~~kT~v~~~t~nP~wne~f~f~v~--~~~L~i~V~d~d~~~~d~~iG~~~i~l~~l~~~  708 (835)
                      ......|.+|||++|.+++ .++||-....|+||+|||..+.++.  .+.+.++++|++..+.|..+|++.++.+++...
T Consensus       724 ~n~i~g~~~dPya~v~~n~~~k~rti~~~~~~npiw~~i~Yv~v~sk~~r~~l~~~~~~~sgddr~lg~~~i~vsn~~~k  803 (1227)
T COG5038         724 RNEIPGGKSDPYATVLVNNLVKYRTIYGSSTLNPIWNEILYVPVTSKNQRLTLECMDYEESGDDRNLGEVNINVSNVSKK  803 (1227)
T ss_pred             cccccCcccccceEEEecceeEEEEecccCccccceeeeEEEEecCCccEEeeeeecchhccccceeceeeeeeeeeeec
Confidence            9888999999999999987 5789999999999999999999984  677999999999999999999999999987542


Q ss_pred             Ccee----------eEEecC--C-CCCcEEEEEEEEEecC
Q 003259          709 QMAD----------KWIPLQ--G-VRKGEIHVLITRKVPE  735 (835)
Q Consensus       709 ~~~~----------~w~~L~--~-~~~G~i~l~l~~~~p~  735 (835)
                      ....          .--+|.  + ..+|++.+.+.| .|.
T Consensus       804 ~~~s~~~~~i~g~~~t~~l~~~~~~~~~tit~~~~f-~p~  842 (1227)
T COG5038         804 DEDSALMETIDGAEETGKLSLTGKKVKGTITYKCRF-YPA  842 (1227)
T ss_pred             CCCcceEEeecCcccccccccccCCcceeEEEEEEE-Eee
Confidence            1111          111111  1 346999999999 444

>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PF10296 DUF2404: Putative integral membrane protein conserved region (DUF2404); InterPro: IPR019411 This is entry represents a domain of unknown function found in mitochondrial distribution and morphology proteins Mdm12 and Mdm34, and in maintenance of mitochondrial morphology protein Mmm1 Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>PF11618 DUF3250: Protein of unknown function (DUF3250); InterPro: IPR021656 This family of proteins represents a protein with unknown function Back     alignment and domain information
>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query835
2ep6_A133 Solution Structure Of The Second C2 Domain From Hum 1e-08
3kwt_A148 Munc13-1 C2b-Domain, Calcium-Free Length = 148 3e-08
1dqv_A296 Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt 1e-07
1dqv_A296 Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt 4e-04
3hn8_A296 Crystal Structure Of Synaptotagmin Length = 296 2e-07
3hn8_A296 Crystal Structure Of Synaptotagmin Length = 296 5e-04
2d8k_A141 Solution Structure Of The First C2 Domain Of Synapt 1e-06
1rh8_A142 Three-Dimensional Structure Of The Calcium-Free Pic 3e-06
3gpe_A137 Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain 4e-06
1dsy_A139 C2 Domain From Protein Kinase C (Alpha) Complexed W 4e-06
2r83_A284 Crystal Structure Analysis Of Human Synaptotagmin 1 1e-05
1byn_A128 Solution Structure Of The Calcium-Bound First C2-Do 2e-05
3pfq_A 674 Crystal Structure And Allosteric Activation Of Prot 2e-05
4dnl_A140 Crystal Structure Of A C2 Domain Of A Protein Kinas 3e-05
1a25_A149 C2 Domain From Protein Kinase C (Beta) Length = 149 3e-05
1rsy_A152 Structure Of The First C2-domain Of Synaptotagmin I 7e-05
3f04_A143 Crystal Structure Of Synaptotagmin I C2a Domain Len 7e-05
3f00_A143 Crystal Structure Of Synaptotagmin I C2a Domain Wit 7e-05
2uzp_A144 Crystal Structure Of The C2 Domain Of Human Protein 9e-05
3jzy_A510 Crystal Structure Of Human Intersectin 2 C2 Domain 3e-04
2k3h_A140 Structural Determinants For Ca2+ And Pip2 Binding B 4e-04
2chd_A142 Crystal Structure Of The C2a Domain Of Rabphilin-3a 4e-04
2nsq_A155 Crystal Structure Of The C2 Domain Of The Human E3 5e-04
>pdb|2EP6|A Chain A, Solution Structure Of The Second C2 Domain From Human Mctp2 Protein Length = 133 Back     alignment and structure 
Iteration: 1

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 60/113 (53%), Gaps = 13/113 (11%)
Query: 619 GWIELVIVEARDLVAADLRGTSDPYVKVQYGDLKKRTKVIFKTLNPQWHQTLEFPDDGSP 678
           G +++ +++A DL+AAD  G SDP+  ++ G+ + +T  ++K LNP+W++   FP     
Sbjct: 13  GILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFP----- 67
Query: 679 LTLHVRDHNALLASSSIGDCVVEYQRLPPNQMADKWIPLQGVRKGEIHVLITR 731
               ++D + +L  +       E    PP+ +    IPL  +R G+ +  + +
Sbjct: 68  ----IKDIHDVLEVTVFD----EDGDKPPDFLGKVAIPLLSIRDGQPNCYVLK 112
>pdb|3KWT|A Chain A, Munc13-1 C2b-Domain, Calcium-Free Length = 148 Back     alignment and structure
>pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 Back     alignment and structure
>pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 Back     alignment and structure
>pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 Back     alignment and structure
>pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 Back     alignment and structure
>pdb|2D8K|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Vii Length = 141 Back     alignment and structure
>pdb|1RH8|A Chain A, Three-Dimensional Structure Of The Calcium-Free Piccolo C2a- Domain Length = 142 Back     alignment and structure
>pdb|3GPE|A Chain A, Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain Complexed With Ca2+ And Ptdins(4,5)p2 Length = 137 Back     alignment and structure
>pdb|1DSY|A Chain A, C2 Domain From Protein Kinase C (Alpha) Complexed With Ca2+ And Phosphatidylserine Length = 139 Back     alignment and structure
>pdb|2R83|A Chain A, Crystal Structure Analysis Of Human Synaptotagmin 1 C2a-c2b Length = 284 Back     alignment and structure
>pdb|1BYN|A Chain A, Solution Structure Of The Calcium-Bound First C2-Domain Of Synaptotagmin I Length = 128 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|4DNL|A Chain A, Crystal Structure Of A C2 Domain Of A Protein Kinase C Alpha (Prkca) From Homo Sapiens At 1.90 A Resolution Length = 140 Back     alignment and structure
>pdb|1A25|A Chain A, C2 Domain From Protein Kinase C (Beta) Length = 149 Back     alignment and structure
>pdb|1RSY|A Chain A, Structure Of The First C2-domain Of Synaptotagmin I: A Novel Ca2+(slash)phospholipid Binding Fold Length = 152 Back     alignment and structure
>pdb|3F04|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain Length = 143 Back     alignment and structure
>pdb|3F00|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain With Cu(Ii) Length = 143 Back     alignment and structure
>pdb|2UZP|A Chain A, Crystal Structure Of The C2 Domain Of Human Protein Kinase C Gamma. Length = 144 Back     alignment and structure
>pdb|3JZY|A Chain A, Crystal Structure Of Human Intersectin 2 C2 Domain Length = 510 Back     alignment and structure
>pdb|2K3H|A Chain A, Structural Determinants For Ca2+ And Pip2 Binding By The C2a Domain Of Rabphilin-3a Length = 140 Back     alignment and structure
>pdb|2CHD|A Chain A, Crystal Structure Of The C2a Domain Of Rabphilin-3a Length = 142 Back     alignment and structure
>pdb|2NSQ|A Chain A, Crystal Structure Of The C2 Domain Of The Human E3 Ubiquitin-Protein Ligase Nedd4-Like Protein Length = 155 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query835
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 6e-37
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 6e-35
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 7e-27
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 4e-31
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 3e-29
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 2e-22
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 4e-28
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 3e-24
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 8e-26
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 2e-25
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 9e-26
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 1e-23
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 3e-25
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 2e-20
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 6e-25
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 2e-21
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 7e-24
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 2e-18
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 2e-23
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 5e-18
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 3e-23
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 3e-19
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 3e-22
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 2e-13
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 4e-22
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 3e-12
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 1e-19
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 9e-16
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 6e-19
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 3e-17
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 9e-19
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 2e-12
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 2e-18
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 2e-12
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 3e-18
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 7e-12
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 6e-18
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 2e-11
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 9e-18
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 3e-13
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 3e-17
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 7e-09
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 2e-16
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 8e-11
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 3e-16
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 1e-07
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 2e-15
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 6e-10
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 4e-15
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 8e-09
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 5e-15
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 4e-11
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 3e-14
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 5e-08
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 7e-14
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 1e-06
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 1e-13
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 5e-08
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 1e-13
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 4e-08
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 5e-13
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 1e-07
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 8e-13
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 1e-07
3nsj_A540 Perforin-1; pore forming protein, immune system; H 9e-13
3nsj_A540 Perforin-1; pore forming protein, immune system; H 1e-07
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 1e-12
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 1e-06
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 1e-12
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 1e-08
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 5e-11
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 2e-07
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 3e-10
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 3e-09
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 4e-10
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 2e-06
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 2e-08
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 2e-06
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 1e-05
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 4e-06
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
 Score =  139 bits (352), Expect = 6e-37
 Identities = 59/278 (21%), Positives = 112/278 (40%), Gaps = 38/278 (13%)

Query: 484 SRTGRKINVTVVEGKDLMPKDKSGKCDPYVK---LQYGKIVQRTRTAH-SPNHVWNQKFE 539
                ++ V +++  +L   D  G  DPYVK   L   K    T+    + N V+N++F 
Sbjct: 15  DFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFT 74

Query: 540 LD---EIGGGECLMVKCYNEEIFG-DENMGSARVNLEGLVEGSVRDIWVPLEKVNTGELR 595
                    G+ L++  Y+ + F   + +G  +V +  +  G V + W  L+     E  
Sbjct: 75  FKVPYSELAGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQE 134

Query: 596 LQIEATRVDDNEGSRGQNIGSGNGWIELVIVEARDLVAADLRGTSDPYVKVQYGDL---- 651
              +         + G+        + +VI+EA++L   D+ G SDPYVK+         
Sbjct: 135 KLGDICFSLRYVPTAGK--------LTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRL 186

Query: 652 -KKRTKVIFKTLNPQWHQTLEF-----PDDGSPLTLHVRDHNALLASSSIGDCVVEYQRL 705
            KK+T +   TLNP ++++  F           + + V D++ +  + +IG   V Y   
Sbjct: 187 KKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNST 246

Query: 706 P------------PNQMADKWIPLQGVRKGEIHVLITR 731
                        P +   +W  LQ   + +  + + +
Sbjct: 247 GAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK 284
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query835
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 100.0
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.97
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.95
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.94
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.82
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.81
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.81
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.8
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.8
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.8
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.8
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.8
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.8
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.8
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.8
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.79
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.79
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.79
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.79
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.79
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.78
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.78
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.77
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.77
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.77
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.77
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.77
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.77
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.76
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.76
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.76
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.76
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.75
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.75
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.75
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.73
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.73
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.72
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.7
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.7
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.7
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.7
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.7
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.69
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.67
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.65
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.62
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.62
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.62
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.61
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.61
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.6
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.6
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.6
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.6
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.6
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.59
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.58
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.58
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.58
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.57
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.57
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.57
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.55
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.55
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.54
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.54
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.54
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.54
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.53
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.53
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.53
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.52
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.49
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.48
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.46
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.43
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.42
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.42
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.4
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.37
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.35
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 99.31
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.23
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.18
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.15
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 99.12
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.01
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.96
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.96
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 98.9
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 98.87
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 98.85
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 98.7
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.62
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.62
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.61
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 98.53
2yrb_A156 Protein fantom; beta sandwich, NPPSFA, national pr 91.53
2wxf_A 940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 84.17
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
Probab=100.00  E-value=3.5e-32  Score=291.84  Aligned_cols=219  Identities=26%  Similarity=0.452  Sum_probs=193.8

Q ss_pred             cEEEEEEEEeecCCCCCCCCCCCcEEEEEEC---CeEeecccc-CCCCCccceEEEEEeeCC---ceeEEEEEEEeccC-
Q 003259          488 RKINVTVVEGKDLMPKDKSGKCDPYVKLQYG---KIVQRTRTA-HSPNHVWNQKFELDEIGG---GECLMVKCYNEEIF-  559 (835)
Q Consensus       488 ~~L~V~V~~a~~L~~~~~~g~~dpyv~v~lg---~~~~kT~~~-~t~nP~Wne~f~f~v~~~---~~~L~i~V~d~d~~-  559 (835)
                      +.|.|+|++|++|+.++..|.+||||+++++   ++.++|+++ ++.||.|||+|.|.+...   ...|.|+|||++.. 
T Consensus        19 ~~L~v~v~~a~~L~~~d~~~~~dpyv~v~~~~~~~~~~~T~~~~~~~nP~wne~f~f~v~~~~~~~~~l~~~V~d~d~~~   98 (284)
T 2r83_A           19 NQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELAGKTLVMAVYDFDRFS   98 (284)
T ss_dssp             TEEEEEEEEEECCCCCSSSSSCCEEEEEEEETCTTSCEECCCCCSCSSCEEEEEEEECCCGGGCTTCEEEEEEEECCSSS
T ss_pred             CEEEEEEEEeeCCCCCCCCCCCCeEEEEEEEcCCCceEeCCcccCCCCCeeCceEEEEechHHhCcCEEEEEEEECCCCC
Confidence            3899999999999999989999999999994   458899999 999999999999987542   57899999999987 


Q ss_pred             CCceEEEEEEeccccccCCeeeeEEecccC------CCceEEEEEEEeecCCCCCCCCCCCCCcceEEEEEEEEeecCCc
Q 003259          560 GDENMGSARVNLEGLVEGSVRDIWVPLEKV------NTGELRLQIEATRVDDNEGSRGQNIGSGNGWIELVIVEARDLVA  633 (835)
Q Consensus       560 ~d~~IG~~~i~L~~l~~~~~~~~w~~L~~~------~~G~I~l~l~~~~~~~~~~~~~~~~~~~~g~L~v~v~~a~~L~~  633 (835)
                      ++++||++.++|.++..+.....|++|...      ..|+|.+++.|.              +..+.|+|.|++|++|+.
T Consensus        99 ~~~~lG~~~i~l~~l~~~~~~~~w~~L~~~~~~~~~~~G~i~l~l~~~--------------p~~~~l~v~v~~a~~L~~  164 (284)
T 2r83_A           99 KHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYV--------------PTAGKLTVVILEAKNLKK  164 (284)
T ss_dssp             CCCEEEEEEEEGGGCCCSSCEEEEEECBCCSSCCCCCCCEEEEEEEEE--------------TTTTEEEEEEEEEESCCC
T ss_pred             CCceeEEEEEcchhcccCCcceeEEEeeccccccccccccEEEEEEec--------------CcCCceEEEEEEeECCCC
Confidence            799999999999999888888899999753      359999999998              567899999999999999


Q ss_pred             CCcCCCCCCEEEEEEC--C---eEeeeeeecCCCCCeeeeEEEeecC-----CCcEEEEEEECCCCCCCCeEEEEEEEcc
Q 003259          634 ADLRGTSDPYVKVQYG--D---LKKRTKVIFKTLNPQWHQTLEFPDD-----GSPLTLHVRDHNALLASSSIGDCVVEYQ  703 (835)
Q Consensus       634 ~d~~g~~DPyv~v~~~--~---~~~kT~v~~~t~nP~wne~f~f~v~-----~~~L~i~V~d~d~~~~d~~iG~~~i~l~  703 (835)
                      .|..|.+||||++++.  +   .+++|+++++|+||+|||+|.|.+.     ...|.|+|||+|.++++++||++.++++
T Consensus       165 ~d~~~~~dpyv~v~~~~~~~~~~~~kT~v~~~t~nP~wne~f~f~v~~~~l~~~~l~i~V~d~d~~~~~~~iG~~~i~l~  244 (284)
T 2r83_A          165 MDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYN  244 (284)
T ss_dssp             CSTTSCCCEEEEEEEEETTEEEEEEECCCCCSCSSCEEEEEEEEECCTTTGGGEEEEEEEEECCSSSCCCEEEEEEEETT
T ss_pred             cCCCCCcCeEEEEEEEeCCcEeeeeccceecCCCCCEEceeEEEeCCHHHhCceEEEEEEEeCCCCCCCcEEEEEEECCC
Confidence            9999999999999984  2   4679999999999999999999985     2369999999999999999999999997


Q ss_pred             cc------------CCCCceeeEEecCCC
Q 003259          704 RL------------PPNQMADKWIPLQGV  720 (835)
Q Consensus       704 ~l------------~~~~~~~~w~~L~~~  720 (835)
                      .+            .++....+||+|.+.
T Consensus       245 ~~~~~~~~w~~~~~~~~~~~~~W~~L~~~  273 (284)
T 2r83_A          245 STGAELRHWSDMLANPRRPIAQWHTLQVE  273 (284)
T ss_dssp             CCHHHHHHHHHHHHSTTSCEEEEEECBCH
T ss_pred             CCCcHHHHHHHHHHCCCCchheeeecCCc
Confidence            52            345567899999763
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2yrb_A Protein fantom; beta sandwich, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 835
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 2e-20
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 3e-15
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 7e-18
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 6e-15
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 2e-17
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 8e-16
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 6e-16
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 4e-15
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 2e-15
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 2e-13
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 2e-15
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 2e-10
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 1e-14
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 6e-11
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 2e-14
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 2e-13
d1gmia_136 b.7.1.1 (A:) Domain from protein kinase C epsilon 3e-14
d1gmia_136 b.7.1.1 (A:) Domain from protein kinase C epsilon 6e-11
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 8e-14
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 6e-13
d1bdya_123 b.7.1.1 (A:) Domain from protein kinase C delta {R 2e-12
d1bdya_123 b.7.1.1 (A:) Domain from protein kinase C delta {R 2e-08
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 3e-10
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 2e-08
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 4e-10
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 5e-10
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 2e-09
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 7e-07
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 4e-09
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 7e-08
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 4e-09
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 6e-07
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 3e-08
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 8e-08
d1dqva1130 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus 5e-08
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 3e-07
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 7e-07
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Domain from cytosolic phospholipase A2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 85.5 bits (211), Expect = 2e-20
 Identities = 24/122 (19%), Positives = 42/122 (34%), Gaps = 8/122 (6%)

Query: 486 TGRKINVTVVEGKDLMP---KDKSGKCDPYVKLQYGKIVQRTRTAH----SPNHVWNQKF 538
           +  K  V V+    +      D     DPYV+L         +         N VWN+ F
Sbjct: 1   SSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRTRHFNNDINPVWNETF 60

Query: 539 ELDEIGG-GECLMVKCYNEEIFGDENMGSARVNLEGLVEGSVRDIWVPLEKVNTGELRLQ 597
           E          L +   +     DE +G+A   +  +  G  +++     +V    L + 
Sbjct: 61  EFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEVPFIFNQVTEMVLEMS 120

Query: 598 IE 599
           +E
Sbjct: 121 LE 122
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query835
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.83
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.81
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.81
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.8
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.8
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.78
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.77
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.76
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.75
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.74
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.74
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.73
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.73
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.73
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.72
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.72
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.71
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.71
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.69
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.67
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.66
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.66
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.65
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.62
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.61
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.6
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.59
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.58
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.55
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.55
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.51
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.49
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.49
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.47
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.45
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.44
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.37
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.33
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.21
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.02
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 90.52
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 87.84
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.83  E-value=7.7e-21  Score=175.40  Aligned_cols=114  Identities=25%  Similarity=0.466  Sum_probs=103.5

Q ss_pred             CcceEEEEEEEEeecCCcCCcCCCCCCEEEEEECCeEeeeeeecCCCCCeeeeEEEeecC--CCcEEEEEEECCCCCCCC
Q 003259          616 SGNGWIELVIVEARDLVAADLRGTSDPYVKVQYGDLKKRTKVIFKTLNPQWHQTLEFPDD--GSPLTLHVRDHNALLASS  693 (835)
Q Consensus       616 ~~~g~L~v~v~~a~~L~~~d~~g~~DPyv~v~~~~~~~kT~v~~~t~nP~wne~f~f~v~--~~~L~i~V~d~d~~~~d~  693 (835)
                      .+.|.|+|+|++|++|+.++..|.+||||++.+++++++|+++++|.||+|||+|.|++.  ...|.|+|||++.+++|+
T Consensus         3 ~~~G~L~V~v~~A~~L~~~d~~g~~Dpyv~v~~~~~~~~T~~~~~t~nP~wne~f~f~v~~~~~~L~i~V~d~~~~~~d~   82 (126)
T d2ep6a1           3 KDVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKDIHDVLEVTVFDEDGDKPPD   82 (126)
T ss_dssp             CCSEEEEEEEEEEESCCCSSSSSCCCEEEEEEETTEEEECCCCSSCSSCCCCEEEEEEESCTTCEEEEEEEEEETTEEEE
T ss_pred             CccEEEEEEEEEeECCCCCCCCCCcCeEEEEEcCCeEEEEEeeCCceeEEEEEEEEEEEeccCceeEEEEEEccCCcCcc
Confidence            467999999999999999999999999999999999999999999999999999999985  578999999999999999


Q ss_pred             eEEEEEEEccccCCCCceeeEEecC-----CCCCcEEEEEEEE
Q 003259          694 SIGDCVVEYQRLPPNQMADKWIPLQ-----GVRKGEIHVLITR  731 (835)
Q Consensus       694 ~iG~~~i~l~~l~~~~~~~~w~~L~-----~~~~G~i~l~l~~  731 (835)
                      +||++.++|+++..+.  .+|+.|.     +..+|+|++++++
T Consensus        83 ~lG~~~i~l~~l~~~~--~~~~~l~~~~~~~~~~G~i~l~~~~  123 (126)
T d2ep6a1          83 FLGKVAIPLLSIRDGQ--PNCYVLKNKDLEQAFKGVIYLEMDL  123 (126)
T ss_dssp             ECCBCEEEGGGCCSSC--CEECCCBCSCTTSCCSSEEEEEEEE
T ss_pred             eEEEEEEEHHHCCCCC--ceEEEccccCCCCceeEEEEEEEEE
Confidence            9999999999997654  4788774     3457999999987
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure