Citrus Sinensis ID: 003291
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 833 | 2.2.26 [Sep-21-2011] | |||||||
| Q76PD2 | 732 | LIM domain and RING finge | yes | no | 0.322 | 0.367 | 0.318 | 5e-42 | |
| Q05580 | 639 | LIM domain and RING finge | yes | no | 0.296 | 0.386 | 0.321 | 1e-36 | |
| Q80YR4 | 908 | Zinc finger protein 598 O | yes | no | 0.322 | 0.296 | 0.294 | 2e-34 | |
| Q86UK7 | 904 | Zinc finger protein 598 O | yes | no | 0.320 | 0.295 | 0.303 | 2e-34 | |
| Q6PFK1 | 953 | Zinc finger protein 598 O | yes | no | 0.319 | 0.279 | 0.293 | 4e-34 |
| >sp|Q76PD2|YJ01_SCHPO LIM domain and RING finger protein C1223.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1223.01 PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 173 bits (438), Expect = 5e-42, Method: Compositional matrix adjust.
Identities = 95/298 (31%), Positives = 149/298 (50%), Gaps = 29/298 (9%)
Query: 5 CAVCADTLEWVAYGGCGHREVCSTCVARLRFICQDRRCCICKTENNVVFVTKALGDYTRM 64
C +CA+ + + C HR +C C RLR + + + C CKTE + V +TK D+
Sbjct: 81 CFICAEGITYSCVLPCNHR-MCHVCALRLRALYKTKECTFCKTEWDTVLITK---DHEID 136
Query: 65 ISDFSVLPTELREGRVGSYWYHEDTQAFFDDVDHYKMIKAMCRLSCSVCDNMEGPNDGSK 124
I D + ++ ++G + E Q + + + + C ++C
Sbjct: 137 IHDVDLAKLPFQDEKLGIVYSDEHAQEESNLLLQFNCPEDACDITC-------------- 182
Query: 125 RRARFRNIEQLKGHLFHRHKLLMCSLCLEGRKVFICEQKLYTRAQLNQHINSGDSVVDGT 184
+ LK H +H C LC++ +KVF E L+++ L +H GD G+
Sbjct: 183 -----KGWFDLKLHAKVKHHKFFCDLCVKNKKVFTHEHTLFSKKGLTKHNEVGDQ---GS 234
Query: 185 ESERGGFMGHPMCEFCRTPFYGDNELYTHMSTEHYTCHICQRQHPGQ--YEYYKNYDDLE 242
+ E GF GHP CEFC T FY D+EL+ H +H C+IC Q G+ ++Y+KNYD LE
Sbjct: 235 DLEITGFKGHPKCEFCNTHFYDDDELFKHCREKHERCYICD-QVAGRPTHQYFKNYDSLE 293
Query: 243 IHFRRDHFLCEDEACLAKKFVVFQSEAEMKRHNAIEHGGRMSRAKRNAALQIPICFRY 300
HF +DH++C + CL +KFVVF +E ++K H EH ++ + A +I F Y
Sbjct: 294 RHFEKDHYICRERECLERKFVVFGTEIDLKAHQLDEHPHNFTQRELREARRIIPQFSY 351
|
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812) |
| >sp|Q05580|YD266_YEAST LIM domain and RING finger protein YDR266C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR266C PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q80YR4|ZN598_MOUSE Zinc finger protein 598 OS=Mus musculus GN=Znf598 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q86UK7|ZN598_HUMAN Zinc finger protein 598 OS=Homo sapiens GN=ZNF598 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6PFK1|ZN598_DANRE Zinc finger protein 598 OS=Danio rerio GN=znf598 PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 833 | ||||||
| 224068671 | 819 | predicted protein [Populus trichocarpa] | 0.969 | 0.986 | 0.650 | 0.0 | |
| 359479972 | 842 | PREDICTED: uncharacterized protein LOC10 | 0.971 | 0.960 | 0.666 | 0.0 | |
| 224128195 | 812 | predicted protein [Populus trichocarpa] | 0.962 | 0.987 | 0.639 | 0.0 | |
| 356503960 | 832 | PREDICTED: uncharacterized protein LOC10 | 0.969 | 0.971 | 0.630 | 0.0 | |
| 297744044 | 780 | unnamed protein product [Vitis vinifera] | 0.897 | 0.958 | 0.645 | 0.0 | |
| 356571017 | 804 | PREDICTED: uncharacterized protein LOC10 | 0.945 | 0.980 | 0.623 | 0.0 | |
| 357511481 | 860 | LIM domain and RING finger protein [Medi | 0.965 | 0.934 | 0.599 | 0.0 | |
| 449436365 | 824 | PREDICTED: uncharacterized protein LOC10 | 0.973 | 0.984 | 0.635 | 0.0 | |
| 297821122 | 811 | zinc finger family protein [Arabidopsis | 0.930 | 0.955 | 0.555 | 0.0 | |
| 15228713 | 812 | RING/U-box domain-containing protein [Ar | 0.931 | 0.955 | 0.553 | 0.0 |
| >gi|224068671|ref|XP_002302796.1| predicted protein [Populus trichocarpa] gi|222844522|gb|EEE82069.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 1090 bits (2818), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 548/842 (65%), Positives = 653/842 (77%), Gaps = 34/842 (4%)
Query: 1 MDDSCAVCADTLEWVAYGGCGHREVCSTCVARLRFICQDRRCCICKTENNVVFVTKALGD 60
MDDSCAVCA+ LEWVAYG CGH +VCSTCV+RLRFIC DRRCCICKTE++VVFVTKALGD
Sbjct: 1 MDDSCAVCAEALEWVAYGACGHLDVCSTCVSRLRFICDDRRCCICKTESSVVFVTKALGD 60
Query: 61 YTRMISDFSVLPTELREGRVGSYWYHEDTQAFFDDVDHYKMIKAMCRLSCSVCDNMEGPN 120
YTRMI+DF +LP+E +EGR+GSYWYHEDTQAFFDDVDHYKMIKAMCRLSCSVCD E N
Sbjct: 61 YTRMINDFLLLPSEPKEGRMGSYWYHEDTQAFFDDVDHYKMIKAMCRLSCSVCDKEES-N 119
Query: 121 DGSKRRARFRNIEQLKGHLFHRHKLLMCSLCLEGRKVFICEQKLYTRAQLNQHINSGDSV 180
DGSKRR +FRNI QLKGHLFH+HKL MCSLCLEGRKVFICEQKLYTRAQLNQHI++GDS
Sbjct: 120 DGSKRRGKFRNINQLKGHLFHQHKLHMCSLCLEGRKVFICEQKLYTRAQLNQHISTGDSD 179
Query: 181 VDGTESERGGFMGHPMCEFCRTPFYGDNELYTHMSTEHYTCHICQRQHPGQYEYYKNYDD 240
VDG+ESERGGFMGHPMCEFC+ PFYGDNELY HMSTEHYTCH+CQRQHPGQYEYYKNYDD
Sbjct: 180 VDGSESERGGFMGHPMCEFCKKPFYGDNELYKHMSTEHYTCHLCQRQHPGQYEYYKNYDD 239
Query: 241 LEIHFRRDHFLCEDEACLAKKFVVFQSEAEMKRHNAIEHGGRMSRAKRNAALQIPICFRY 300
LEIHFRRDHFLC+DE CLAKKF+VFQ+EAE+KRHN IEH G MSR++RNAALQIP FRY
Sbjct: 240 LEIHFRRDHFLCDDEGCLAKKFIVFQTEAELKRHNTIEHAGHMSRSQRNAALQIPTSFRY 299
Query: 301 RRNNEQEHRRGRGRTFHRESSDVNELSMAIQASLETVGADSTSYDPSSSRSLVSDHGDAE 360
RR+NEQ++R GRGRTF R+ SD N+LS+AIQASLE ++STS D SSS +SDH D
Sbjct: 300 RRSNEQDNRHGRGRTFRRDQSD-NQLSIAIQASLEAAYSESTSRDRSSSAQAISDHVDLS 358
Query: 361 DIDTLIQPFESLATTDSELASRYLQALGQNSRTAPLEESSFPPLPMASSSSQQNPRSNSE 420
DID ++QPFESL+ TD E RYLQALG +SR APL+ESSFPPL +SS QQ + SE
Sbjct: 359 DIDPIVQPFESLSATDPETTLRYLQALGPSSRNAPLQESSFPPLFTTTSSGQQKAKDESE 418
Query: 421 GLP-NSMAAHLRRKNNRNVTVLHAGLGWPSASQRPVLSSNNSTQPRRAANIGSAVSQSSS 479
LP N+MA HLRR+NNRN TV+++ WP+AS+ V SS +P + S+SS+
Sbjct: 419 SLPNNTMATHLRRQNNRNATVVNSPQQWPAASRGHVSSSPALYRP--TVDTSPLSSRSSA 476
Query: 480 GSRTVSCKAASAQAQVLAQSTAV----SSASSRNSGNIRRITHSASAPNLAN-GSVEPSV 534
+S A+S Q+ + AV S+ S SG RI+ +ASA NLA+ GS++PSV
Sbjct: 477 SGPGLSSYASSIQSHAQTRPAAVRGHPSAGSVGISGTTSRISSTASASNLADSGSLKPSV 536
Query: 535 SDFPPVSAMRTDKMPSISQPAPSVENIQAANRSLVERMRAAFEYDEDKYTAFKDITAQYR 594
SDFPPVSA+ KMP+ SQ +VE Q AN+SLVE++RAA E DED+YT FKDI+ QYR
Sbjct: 537 SDFPPVSAVPMHKMPTSSQVVLNVEEFQTANKSLVEKIRAALENDEDRYTLFKDISGQYR 596
Query: 595 QGLIDTRKYLEYVKQYGLSHLVLELARLCPDALKQKELIETYNATLQGNNQLDNDWAHIS 654
QG IDT +YL+YV+Q+GLS L+ ELARLCPDA KQKEL+ETYNA+L+ + + +N W S
Sbjct: 597 QGSIDTGEYLDYVQQFGLSRLIPELARLCPDAQKQKELVETYNASLRSSGKKENGWGRGS 656
Query: 655 VRAKDTNGSKKSKGKSVATEACKNDKGKSTVANDSNSKHAVANNFLSTVRELQSSFKPSE 714
+ K TNGSK +GK NDS+SK + ++F++TVR LQS++KP E
Sbjct: 657 AQLKGTNGSK---------------EGKGIAENDSSSKDRLTDSFINTVRALQSNYKPVE 701
Query: 715 EDEEVLSKDGYRGAKGKSKPMVDE---QLRGQNDLTSAGGGSSQTSVDRGGGGKQRKKTS 771
++ ++LSKDGYR AKGKS M+DE + R QN SAG GSS+ D GG KQRKKTS
Sbjct: 702 DEAQLLSKDGYRAAKGKSNVMLDERQMEPRIQNGSLSAGDGSSKNLKD-GGTEKQRKKTS 760
Query: 772 KFHRVRLGDGSMAALLDLKNSDTGPDP-EPLDSRLDGNQNPAEGLPVPVRGVWKRGGGHK 830
K HR RLGDGSMAALLDL+NS+ PDP E +++R+D + N GL PVRGVW++GGG K
Sbjct: 761 KVHRARLGDGSMAALLDLQNSE--PDPRETVENRIDDSSNSVGGL--PVRGVWRKGGGQK 816
Query: 831 LF 832
LF
Sbjct: 817 LF 818
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359479972|ref|XP_003632382.1| PREDICTED: uncharacterized protein LOC100262296 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224128195|ref|XP_002320267.1| predicted protein [Populus trichocarpa] gi|222861040|gb|EEE98582.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356503960|ref|XP_003520767.1| PREDICTED: uncharacterized protein LOC100799878 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297744044|emb|CBI37014.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356571017|ref|XP_003553678.1| PREDICTED: uncharacterized protein LOC100780426 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357511481|ref|XP_003626029.1| LIM domain and RING finger protein [Medicago truncatula] gi|355501044|gb|AES82247.1| LIM domain and RING finger protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449436365|ref|XP_004135963.1| PREDICTED: uncharacterized protein LOC101214376 [Cucumis sativus] gi|449488786|ref|XP_004158171.1| PREDICTED: uncharacterized protein LOC101227037 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297821122|ref|XP_002878444.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297324282|gb|EFH54703.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15228713|ref|NP_191783.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|6899934|emb|CAB71884.1| putative zinc-finger protein [Arabidopsis thaliana] gi|28058808|gb|AAO29956.1| putative zinc-finger protein [Arabidopsis thaliana] gi|34098831|gb|AAQ56798.1| At3g62240 [Arabidopsis thaliana] gi|332646805|gb|AEE80326.1| RING/U-box domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 833 | ||||||
| TAIR|locus:2097988 | 812 | AT3G62240 [Arabidopsis thalian | 0.546 | 0.560 | 0.637 | 1.3e-216 | |
| TAIR|locus:2041464 | 766 | AT2G47090 "AT2G47090" [Arabido | 0.805 | 0.875 | 0.474 | 1.8e-185 | |
| POMBASE|SPCC1223.01 | 732 | SPCC1223.01 "ubiquitin-protein | 0.230 | 0.262 | 0.38 | 6.2e-42 | |
| ASPGD|ASPL0000055640 | 767 | AN10068 [Emericella nidulans ( | 0.211 | 0.229 | 0.439 | 2.8e-41 | |
| UNIPROTKB|F1NQS9 | 875 | ZNF598 "Uncharacterized protei | 0.201 | 0.192 | 0.355 | 7.5e-40 | |
| DICTYBASE|DDB_G0275581 | 911 | DDB_G0275581 [Dictyostelium di | 0.202 | 0.185 | 0.350 | 5.4e-39 | |
| ZFIN|ZDB-GENE-060602-3 | 953 | znf598 "zinc finger protein 59 | 0.206 | 0.180 | 0.364 | 2.7e-38 | |
| UNIPROTKB|Q86UK7 | 904 | ZNF598 "Zinc finger protein 59 | 0.198 | 0.182 | 0.35 | 2.5e-37 | |
| FB|FBgn0035024 | 867 | CG11414 [Drosophila melanogast | 0.232 | 0.223 | 0.379 | 3.1e-37 | |
| UNIPROTKB|F1Q034 | 909 | ZNF598 "Uncharacterized protei | 0.200 | 0.183 | 0.344 | 6.7e-37 |
| TAIR|locus:2097988 AT3G62240 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1590 (564.8 bits), Expect = 1.3e-216, Sum P(3) = 1.3e-216
Identities = 303/475 (63%), Positives = 355/475 (74%)
Query: 1 MDDSCAVCADTLEWVAYGGCGHREVCSTCVARLRFICQDRRCCICKTENNVVFVTKALGD 60
MDDSCAVCAD LEWVAYG CGHREVCSTCV RLRF+ D RCCICKTE+ +VFVTKALGD
Sbjct: 1 MDDSCAVCADNLEWVAYGSCGHREVCSTCVVRLRFVLDDPRCCICKTESPIVFVTKALGD 60
Query: 61 YTRMISDFSVLPTELREGRVGSYWYHEDTQAFFDDVDHYKMIKAMCRLSCSVCDNMEG-P 119
YTR I+DFS P+ REGRVG++WYHEDTQAFFDD+D Y+MIKAMCRLSC VCD E P
Sbjct: 61 YTRTINDFSTFPSAPREGRVGAFWYHEDTQAFFDDLDQYRMIKAMCRLSCGVCDKTEDKP 120
Query: 120 NDGSKR--RARFRNIEQLKGHLFHRHKLLMCSLCLEGRKVFICEQKLYTRAQLNQHINSG 177
+G R R R +++EQLKGHL+H+HKL MC LCLEGRK+FICEQKLYTRAQLNQHI +G
Sbjct: 121 REGGPRHHRQRIKSVEQLKGHLYHKHKLHMCGLCLEGRKIFICEQKLYTRAQLNQHIQTG 180
Query: 178 DSVVDGTESERGGFMGHPMCEFCRTPFYGDNELYTHMSTEHYTCHICQRQHPGQYEYYKN 237
DS VDG+ESERGGF GHPMCEFCR PFYGDNELYTHMSTEHYTCH+CQR PGQYEYYKN
Sbjct: 181 DSEVDGSESERGGFAGHPMCEFCRNPFYGDNELYTHMSTEHYTCHLCQRSQPGQYEYYKN 240
Query: 238 YDDLEIHFRRDHFLCEDEACLAKKFVVFQSEAEMKRHNAIEHGGRMSRAKRNAALQIPIC 297
YDDLEIHFRRDHFLCED++CLAKKF VFQ+E+E+KRHNAIEHGG+MSR++R+AALQIP
Sbjct: 241 YDDLEIHFRRDHFLCEDDSCLAKKFTVFQNESELKRHNAIEHGGKMSRSQRSAALQIPTS 300
Query: 298 FRYRRNNEQEHRRGRGRTFHRESSDVNELSMAIQASLETVGADXXXXXXXXXXXLV---- 353
FRY R N+QE+RRGR R+F RE D E ++A+ A+L ++
Sbjct: 301 FRYSRGNDQENRRGRPRSFRREPGD-EEYNLAVHAALRLSESEYSRQEPAPPPSSAPPGF 359
Query: 354 SDHGD--AEDIDTLIQPFESLATTDSELASRYLQALGQ-NSRTAPLEESSFPPLPMAXXX 410
S++ + +D D LIQP ESL+TTD E +SRYLQA+G + L ES+FPPL
Sbjct: 360 SENNNIHVDDTDPLIQPMESLSTTDMEPSSRYLQAVGSFGGGGSRLGESAFPPL-----S 414
Query: 411 XXXXXXXXXEGLP-NSMAAHLRRKNNRNVT---VLHAGLGWPSASQRPVLSSNNS 461
E LP N+MAA LRR+ NR T + GWP ++ P +S S
Sbjct: 415 GQQSSGQNVESLPTNTMAARLRRQTNRTSTASAIASPSQGWPVINRGPGQASITS 469
|
|
| TAIR|locus:2041464 AT2G47090 "AT2G47090" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPCC1223.01 SPCC1223.01 "ubiquitin-protein ligase E3 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000055640 AN10068 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NQS9 ZNF598 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0275581 DDB_G0275581 [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060602-3 znf598 "zinc finger protein 598" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q86UK7 ZNF598 "Zinc finger protein 598" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0035024 CG11414 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q034 ZNF598 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | gw1.II.498.1 | hypothetical protein (813 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 833 | |||
| COG5236 | 493 | COG5236, COG5236, Uncharacterized conserved protei | 1e-48 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 4e-04 |
| >gnl|CDD|227561 COG5236, COG5236, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
Score = 179 bits (455), Expect = 1e-48
Identities = 92/300 (30%), Positives = 138/300 (46%), Gaps = 35/300 (11%)
Query: 5 CAVCADTLEWVAYGGCGHREVCSTCVARLRFICQDRRCCICKTENNVVFVTKALGDYTRM 64
C +CA + + A CGH+ +C C RLR + + C +C+TE V T
Sbjct: 64 CQICAGSTTYSARYPCGHQ-ICHACAVRLRALYMQKGCPLCRTETEAVVFTA---SSPAD 119
Query: 65 ISDFSVLPTELREGRVGSYWYHEDTQAFFDDVDHYKMIKAMCRLSCSVCDNMEGPNDGSK 124
I+D + RE +VG ++ ED + +D+ +K K+ C
Sbjct: 120 ITD--RRQWKGREEKVGIFYEGEDVRDEMEDLLSFKCPKSKCHR---------------- 161
Query: 125 RRARFRNIEQLKGHLFHRHKLLMCSLCLEGRKVFICEQKLYTRAQLNQHINSGDSVVDGT 184
R ++++LK H +H ++CS C+ +K F E +L+ + L H N G
Sbjct: 162 ---RCGSLKELKKHYKAQHGFVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGL------ 212
Query: 185 ESERGGFMGHPMCEFCRTPFYGDNELYTHMSTEHYTCHICQRQHPGQYEYYKNYDDLEIH 244
E GF GHP+C FC+ FY D+EL H H CHIC P +Y+Y+K+Y+DLE H
Sbjct: 213 --EEEGFKGHPLCIFCKIYFYDDDELRRHCRLRHEACHICDMVGPIRYQYFKSYEDLEAH 270
Query: 245 FRRDHFLCEDEACLAKKFVVFQSEAEMKRHNAIEHG--GRMSRAKRNAALQIPICFRYRR 302
FR H+ C + C K VF E+ H H R+S R IP+ ++R
Sbjct: 271 FRNAHYCCTFQTCRVGKCYVFPYHTELLEHLTRFHKVNARLSEIPRPGRCSIPVMDPFKR 330
|
Length = 493 |
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 833 | |||
| KOG2231 | 669 | consensus Predicted E3 ubiquitin ligase [Posttrans | 100.0 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 100.0 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 99.62 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 99.48 | |
| KOG2231 | 669 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.44 | |
| KOG3608 | 467 | consensus Zn finger proteins [General function pre | 99.29 | |
| KOG3576 | 267 | consensus Ovo and related transcription factors [T | 99.11 | |
| KOG3608 | 467 | consensus Zn finger proteins [General function pre | 99.07 | |
| KOG3576 | 267 | consensus Ovo and related transcription factors [T | 98.92 | |
| KOG1074 | 958 | consensus Transcriptional repressor SALM [Transcri | 98.88 | |
| KOG1074 | 958 | consensus Transcriptional repressor SALM [Transcri | 98.82 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 98.67 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 98.49 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 98.46 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 98.44 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.36 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.26 | |
| PHA00733 | 128 | hypothetical protein | 98.26 | |
| PHA00733 | 128 | hypothetical protein | 98.05 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.84 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 97.66 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 97.43 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 97.23 | |
| KOG3993 | 500 | consensus Transcription factor (contains Zn finger | 97.02 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 96.93 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 96.79 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 96.69 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 96.65 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 96.61 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 96.51 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 96.5 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 96.49 | |
| PHA00732 | 79 | hypothetical protein | 96.46 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 96.42 | |
| KOG3993 | 500 | consensus Transcription factor (contains Zn finger | 96.39 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 96.34 | |
| PHA00732 | 79 | hypothetical protein | 96.15 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.97 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 95.93 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.89 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 95.55 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 95.44 | |
| KOG2893 | 341 | consensus Zn finger protein [General function pred | 95.38 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 95.36 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 95.3 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.05 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.87 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 94.7 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 94.52 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 94.4 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.36 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 94.21 | |
| KOG4173 | 253 | consensus Alpha-SNAP protein [Intracellular traffi | 93.97 | |
| PHA00616 | 44 | hypothetical protein | 93.96 | |
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 93.87 | |
| PHA00616 | 44 | hypothetical protein | 93.7 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 93.44 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 93.07 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 92.85 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 92.84 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 92.27 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 91.76 | |
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 91.47 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.12 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.01 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 90.6 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 90.52 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 89.8 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 89.03 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 88.68 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 88.67 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 88.32 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 88.27 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 88.03 | |
| KOG2482 | 423 | consensus Predicted C2H2-type Zn-finger protein [T | 87.2 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 86.33 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 85.55 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 85.48 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 84.64 | |
| KOG2893 | 341 | consensus Zn finger protein [General function pred | 83.39 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 82.93 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 82.31 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 81.96 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 81.83 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 81.81 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 81.76 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 81.22 | |
| PHA02862 | 156 | 5L protein; Provisional | 80.91 |
| >KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.6e-56 Score=512.14 Aligned_cols=650 Identities=31% Similarity=0.426 Sum_probs=427.2
Q ss_pred CcccccccccceeeeecCCCcccccchHhHHHhHhCCCccccccccCceEEEeccCCCccccccCCCCCCcccccCcccc
Q 003291 3 DSCAVCADTLEWVAYGGCGHREVCSTCVARLRFICQDRRCCICKTENNVVFVTKALGDYTRMISDFSVLPTELREGRVGS 82 (833)
Q Consensus 3 ~~C~IC~e~~~~~a~~~C~H~~~C~~C~lRLR~L~~~k~CpiCrte~~~V~~tk~l~d~~~~~~~fs~l~~~~~e~k~g~ 82 (833)
+.|+||+...+|.+++.|+|..+|..|++|||.++++..|.+|+.++..++.++.+++++..+..|. ++..+.
T Consensus 1 ~~c~ic~~s~~~~~~~s~~h~~v~~~~~~R~~~~~~~~~~~~~~~vcr~~~~~~s~~~~~~~~~t~~-------~~~~~~ 73 (669)
T KOG2231|consen 1 DSCAICAFSPDFVGRGSCGHNEVCATCVVRLRFELNNRKCSNECPVCRREVETKSNGDSSDAVGTFP-------EGRKCD 73 (669)
T ss_pred CCcceeecCccccccccccccccchhhhhhhhhhcccccccccCcccccceeeeccccccccccccc-------cccccc
Confidence 4699999999999999999998999999999999998888888888888888887777776655554 445567
Q ss_pred eeeeccccccc-cchHHHHHHHhhcccccccCCCCCC--CCCC--CcccccccChhhhhcccccccCccccCcccCCCcc
Q 003291 83 YWYHEDTQAFF-DDVDHYKMIKAMCRLSCSVCDNMEG--PNDG--SKRRARFRNIEQLKGHLFHRHKLLMCSLCLEGRKV 157 (833)
Q Consensus 83 ~~~~e~~~~~f-~d~~~~k~i~~l~~~~C~~C~k~~~--~~~g--~~~~~~F~s~~~Lk~Hlr~~H~~~~C~iC~k~~Kv 157 (833)
+|++++..++| +|..+|.+++.++.+.|.+|+.... .+++ ..+ ..|.++..|+.||+..|+.++|.+|..++|+
T Consensus 74 ~~~~e~~~~if~~d~~~y~~~~~~~~~~C~~C~~~~~~~~~~~~~~~c-~~~~s~~~Lk~H~~~~H~~~~c~lC~~~~ki 152 (669)
T KOG2231|consen 74 FDEHEDTCVIFFADKLTYTKLEACLHHSCHICDRRFRALYNKKECLHC-TEFKSVENLKNHMRDQHKLHLCSLCLQNLKI 152 (669)
T ss_pred cccccceeeeeeccccHHHHHHHHHhhhcCccccchhhhcccCCCccc-cchhHHHHHHHHHHHhhhhhcccccccccee
Confidence 78888876555 9999999999999999999998221 0011 012 4677999999999999999999999999999
Q ss_pred ccccccccCHHHHHHHHhcCCCCCCCCcccCCCCCCCCCCCCCCCccCCchhHhhhccCCcccCCCCCCccCCcccccCC
Q 003291 158 FICEQKLYTRAQLNQHINSGDSVVDGTESERGGFMGHPMCEFCRTPFYGDNELYTHMSTEHYTCHICQRQHPGQYEYYKN 237 (833)
Q Consensus 158 F~~E~~fyt~~~L~~H~r~h~~e~~g~~~~~~g~~~h~~C~~C~k~F~~~~~L~~Hmrekhf~C~iC~k~~~~~~~yF~~ 237 (833)
|++|+++|++.+|.+|++.++.+ ..++++|++|+||..+|++.++|++||+..||.|++|++. +++++||.+
T Consensus 153 f~~e~k~Yt~~el~~h~~~gd~d-------~~s~rGhp~C~~C~~~fld~~el~rH~~~~h~~chfC~~~-~~~neyy~~ 224 (669)
T KOG2231|consen 153 FINERKLYTRAELNLHLMFGDPD-------DESCRGHPLCKFCHERFLDDDELYRHLRFDHEFCHFCDYK-TGQNEYYND 224 (669)
T ss_pred eeeeeehehHHHHHHHHhcCCCc-------cccccCCccchhhhhhhccHHHHHHhhccceeheeecCcc-cccchhccc
Confidence 99999999999999999998874 3567889999999999999999999999999999999984 799999999
Q ss_pred hhHHHhhhcCCCccCChhhhcccccccc-CChHHHHHHHHHhhCCCCChHhhhcccccCcccccccC-chhhcccCCCCC
Q 003291 238 YDDLEIHFRRDHFLCEDEACLAKKFVVF-QSEAEMKRHNAIEHGGRMSRAKRNAALQIPICFRYRRN-NEQEHRRGRGRT 315 (833)
Q Consensus 238 ~~~L~~H~r~kHy~C~~~~C~k~kfvvF-~s~~eLk~H~~~hHg~~~s~~~r~~~~~i~~~f~~~~~-~~~~~r~G~gr~ 315 (833)
|.+|+.|+|+.||.|++..|..++|++| ..+.+|++|. +++.+.|.|... .++++...++|+
T Consensus 225 ~~dLe~HfR~~HflCE~~~C~~~~f~~~~~~ei~lk~~~----------------~~~~~e~~~~~~~~r~Gr~s~~~r~ 288 (669)
T KOG2231|consen 225 YDDLEEHFRKGHFLCEEEFCRTKKFYVAFELEIELKAHN----------------RFIQHEKCYICRPSRPGRPSSRYRG 288 (669)
T ss_pred chHHHHHhhhcCccccccccccceeeehhHHHHHHHhhc----------------cccchheeccCCcccCCCCcccccC
Confidence 9999999999999999888999999877 8899999887 167778888765 343333333333
Q ss_pred CCCCCchHHHhHHHHHHhHhhhcCCCCCCCCCCcccccccCCCcccccccccccccccCCChhhhhH----HHHHhccCC
Q 003291 316 FHRESSDVNELSMAIQASLETVGADSTSYDPSSSRSLVSDHGDAEDIDTLIQPFESLATTDSELASR----YLQALGQNS 391 (833)
Q Consensus 316 ~~r~~~d~~~~s~ai~~~~~~a~~~~s~~~~s~s~~~l~~~~~~~~~~~~~~~~~~~~~~~s~~~~~----~~~~~~~~~ 391 (833)
.-+...+.+.++.. ......+.+....+. .....+...++...+++-.+.-...++ ..+.+...
T Consensus 289 ~~~~~~~~~~~~~~-~~~~~t~pq~~~~~~----------~~~~~~~s~~~~~~~~~~s~~~~~~~~~~~~~~s~~~~~- 356 (669)
T KOG2231|consen 289 PYRRLESHFRVSDE-ARDGSTAPQGKGNNF----------GSRRDEGSPLAGNRQELPSTANGNPSRFTSPNSSRINAA- 356 (669)
T ss_pred Cccccccccccccc-ccCccccCccccccC----------CccccccCcccccccccccccCCCCCcccCCccchhccc-
Confidence 21111110111110 000111111000000 000111111111111111111111111 11111111
Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCc-chhHHHhhhccCCcceecccCCCCCCCCCCCCCCCCCCCCccccccC
Q 003291 392 RTAPLEESSFPPLPMASSSSQQNPRSNSEGLP-NSMAAHLRRKNNRNVTVLHAGLGWPSASQRPVLSSNNSTQPRRAANI 470 (833)
Q Consensus 392 ~~~~~~ee~fP~L~~~s~~~~~~s~~~~~~~~-~t~a~~lr~~~~~~~~~l~~~~~~~~~~~~~~~~~s~~~~~~~~~~~ 470 (833)
.+......|..-+. -.+.+++.++. +.+..+++..+++.+..-...++|+..+.++...+......-+..+.
T Consensus 357 --sr~~~~a~~~~~~~-----~~S~~~s~S~~~~~~~~~~~~~t~r~a~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~ 429 (669)
T KOG2231|consen 357 --SRQIRKADPAVVGQ-----IISLAGSSSSSSTPGRSRISPVTNRSAAAPGAAAPYPAPNRGPGENSIKSLRRVPSSGR 429 (669)
T ss_pred --cccccccccccccc-----ccccCCCCcCcCccccccccccccccccCCccccCccccccCccccccccccccccccc
Confidence 12222333333211 11222222222 45555666666666555455567777776665533221111111111
Q ss_pred CCCCcCCCCCCCccccchhhhhhhhhhcccccccccCCCCCCcccccccCCCCCCCCCCCC--CCCCCCCCcc--cccCC
Q 003291 471 GSAVSQSSSGSRTVSCKAASAQAQVLAQSTAVSSASSRNSGNIRRITHSASAPNLANGSVE--PSVSDFPPVS--AMRTD 546 (833)
Q Consensus 471 ~~~~s~~~~~~~~~s~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~s~p~~~~~~~~--~~~~~~p~~s--a~~~~ 546 (833)
.+.+.+.+.-........++.+.......+-++ ++++.|+..++.+. ++.++.|.++ ...++
T Consensus 430 s~~~~s~~~~rv~~~~p~a~~~~~~~~k~~e~~--------------~~ps~~~~ss~r~~~~~~ss~~~~~s~~~~~n~ 495 (669)
T KOG2231|consen 430 SAASQSLSSDRVEQTRPLASVVLQIARKAAETP--------------SSPSSPYNSSTRSTAQPSSSLGPQSSLPSLKNR 495 (669)
T ss_pred chhhccccccccccCCCcchhhhhhhhhccccC--------------CCCcchhhhhcccccCCccccCccccchhhcCc
Confidence 111111110000000111111111111011111 22233333222222 3455555554 22222
Q ss_pred C---CCCCCCCCCCHHHHHHHHHHHHHHHHHhhcCChhHHHHHHHHHHhhccCCcChHHHHHHHHHhhhhhhHHHHHhhC
Q 003291 547 K---MPSISQPAPSVENIQAANRSLVERMRAAFEYDEDKYTAFKDITAQYRQGLIDTRKYLEYVKQYGLSHLVLELARLC 623 (833)
Q Consensus 547 ~---~~~~~~~~~~~~~~~~~nk~lvekir~~L~~d~~~f~~Fk~~s~~~r~G~i~~~~y~~~~~~~gl~~lv~ela~Ll 623 (833)
+ ++........+.++..+|++|+|+++..|+.+|+.|.+||..+..||.++|++..|++++.-+|+.++++++++|+
T Consensus 496 ~s~~~s~~~~~~~g~p~~~~~~~~~~e~~~~~~~~~e~~~~~~k~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~r~~ 575 (669)
T KOG2231|consen 496 KSSSTSAPRGHSQGPPDVSSANKALGEKNIKNLGHKESPSAAPKNFSGKYRKNSIDARTNGAPVTPYGLSPLLLDGARLC 575 (669)
T ss_pred cccccCCCCCCCCCCCCcccchhhhhHHhhhccccccchhhCcCCCCCcccccccchhhccCcCCCcCCCccccCCCCCC
Confidence 1 1222223344568899999999999999999999999999999999999999999999999999999999999999
Q ss_pred CChHHHHHHHHHHHhhhccCcccCCCccccccccccccCCCCCCCCccccccccCCCCCccccCCCChhhHhhhhhHHHH
Q 003291 624 PDALKQKELIETYNATLQGNNQLDNDWAHISVRAKDTNGSKKSKGKSVATEACKNDKGKSTVANDSNSKHAVANNFLSTV 703 (833)
Q Consensus 624 Pd~~K~~eL~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 703 (833)
|++..+.+|.+.+++.+.. |-+++++.+ .++.++..++|..++
T Consensus 576 ppp~~~s~i~~~~~a~~~~----------------------k~~~~~~~~---------------~~~p~s~~~~~~~~~ 618 (669)
T KOG2231|consen 576 PPPGLVSNIIKSSNALLNS----------------------KNKPKPVKY---------------PDPPDSKPRNQILTV 618 (669)
T ss_pred CCchhccccccCccccccc----------------------ccccccccc---------------CCCCCcccccccchh
Confidence 9999999999888765541 334444543 578889999999999
Q ss_pred HHHhhcCCCCccccceeccCCCCCCCCCCCCcccccccCCCcccccCCCCCccccCCCCCCccccccccccccc
Q 003291 704 RELQSSFKPSEEDEEVLSKDGYRGAKGKSKPMVDEQLRGQNDLTSAGGGSSQTSVDRGGGGKQRKKTSKFHRVR 777 (833)
Q Consensus 704 ~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~s~~~~~~ 777 (833)
+.+|....++++. -+|.-|+.++|+.+... + .+. ....++.+|++||+++|
T Consensus 619 ~~~~~~~~~q~~~---k~~~~~~~~~~~~~~~~-----~------~~~---------~~k~q~~~~~~~~~~~~ 669 (669)
T KOG2231|consen 619 RRLQLLDPKQAGK---KDKFQDGSDSGNLYFLN-----L------FSE---------LDKQQELKKTHKFHRNR 669 (669)
T ss_pred hhhhhccchhhhc---ccccccccccccccccc-----c------ccc---------cccccccccccccccCC
Confidence 9999999999888 46778888888755111 0 000 02357889999999986
|
|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3608 consensus Zn finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3576 consensus Ovo and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >KOG3608 consensus Zn finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3576 consensus Ovo and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >KOG1074 consensus Transcriptional repressor SALM [Transcription] | Back alignment and domain information |
|---|
| >KOG1074 consensus Transcriptional repressor SALM [Transcription] | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG2893 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2893 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 833 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-06 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 49.5 bits (117), Expect = 5e-06
Identities = 51/411 (12%), Positives = 104/411 (25%), Gaps = 153/411 (37%)
Query: 30 VARLRFICQDRRCCICKTENNVV--FVTKALG-DYTRMISDFSVLPTELREGRVGSYWYH 86
V+ + + + +V FV + L +Y ++S TE R+ + + Y
Sbjct: 61 VSGTLRLFW----TLLSKQEEMVQKFVEEVLRINYKFLMSPIK---TEQRQPSMMTRMYI 113
Query: 87 EDTQAFFDDVD------------HYKMIKAMCRL----------------SC---SVCDN 115
E ++D + K+ +A+ L + VC +
Sbjct: 114 EQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLS 173
Query: 116 ------MEGP----NDGSKRRARFRNIEQLKGHLFHRHKLLMCSLC------------LE 153
M+ N + +E L+ L ++ S ++
Sbjct: 174 YKVQCKMDFKIFWLNLKNCNSPETV-LEMLQ-KLLYQIDPNWTSRSDHSSNIKLRIHSIQ 231
Query: 154 GRKVFICEQKLYTRAQL-------NQHINSGD------------SVVDGTESERGGFMGH 194
+ + K Y L + N+ + V D + H
Sbjct: 232 AELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAAT---TTH 288
Query: 195 PMCEFCRTPFYGDNEL-----YTHMSTE---HYTC-----HICQ-----RQHPGQYEYYK 236
+ D Y + + R ++ +K
Sbjct: 289 ISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWK 348
Query: 237 NY-------------DDLEIHFRRDHFLCEDEACLAKKFVVFQSEA------------EM 271
+ + LE R F + VF A ++
Sbjct: 349 HVNCDKLTTIIESSLNVLEPAEYRKMF---------DRLSVFPPSAHIPTILLSLIWFDV 399
Query: 272 KRHNAIE-----HGGRMSRAKRNA---ALQIP-ICFRYRRNNEQE---HRR 310
+ + + H + S ++ + IP I + E E HR
Sbjct: 400 IKSDVMVVVNKLH--KYSLVEKQPKESTISIPSIYLELKVKLENEYALHRS 448
|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 833 | |||
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 99.74 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 99.72 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 99.68 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 99.63 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 99.62 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 99.54 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 99.5 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 99.47 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 99.41 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 99.4 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 99.4 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 99.38 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 99.34 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 99.31 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 99.29 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 99.29 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 99.19 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 99.15 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 99.11 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 99.11 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 99.1 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 99.08 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 99.08 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 99.07 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 99.07 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 99.05 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 99.05 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 99.03 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 98.97 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 98.96 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 98.96 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 98.92 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 98.88 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 98.87 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 98.84 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 98.84 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 98.83 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 98.83 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 98.8 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 98.7 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 98.69 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 98.69 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 98.68 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 98.63 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 98.6 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 98.59 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 98.56 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 98.56 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 98.5 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 98.5 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 98.45 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 98.45 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 98.44 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 98.42 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 98.41 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 98.38 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 98.38 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 98.37 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 98.35 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 98.33 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 98.31 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 98.31 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 98.3 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 98.29 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 98.29 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 98.25 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 98.25 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 98.22 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 98.22 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 98.22 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 98.21 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 98.21 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 98.21 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 98.19 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 98.18 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 98.16 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 98.15 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 98.14 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 98.12 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 98.09 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 98.07 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.99 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.99 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.97 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.96 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 97.96 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.96 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.95 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.95 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 97.95 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.95 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.94 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.93 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 97.92 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.92 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.92 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.92 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.91 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.91 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.91 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.91 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.9 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.89 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.89 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 97.89 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.89 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.89 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.89 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.89 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.89 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.89 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.89 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.88 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.87 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.87 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.87 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 97.87 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.86 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.86 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 97.86 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.85 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.85 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.83 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.83 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.81 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 97.8 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 97.8 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 97.79 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.79 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 97.79 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.78 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.77 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.75 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 97.74 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 97.74 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 97.74 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 97.73 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.67 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 97.66 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 97.65 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.65 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.65 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.64 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.64 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.64 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.63 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.63 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.63 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 97.63 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.63 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 97.63 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.62 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.62 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.62 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.61 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.61 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.61 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.61 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.6 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.6 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.6 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.6 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.59 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.59 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.59 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.58 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.58 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.58 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.58 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.58 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 97.58 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.57 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 97.57 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.57 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.57 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 97.57 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 97.56 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 97.56 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.55 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.55 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.55 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.55 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.54 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.54 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.54 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.54 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.54 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.53 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.53 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.53 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.53 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 97.52 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.52 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.52 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.52 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.52 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.52 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.52 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.52 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.51 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 97.51 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.5 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.5 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.5 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.49 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 97.48 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 97.48 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.48 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 97.48 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.48 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.48 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.47 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.47 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 97.46 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 97.46 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 97.43 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.43 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.42 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.42 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 97.42 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.41 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 97.41 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.4 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 97.4 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.39 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.39 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.39 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 97.38 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.37 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.37 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 97.37 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.35 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 97.32 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 97.31 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.31 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 97.3 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.28 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 97.28 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.28 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.28 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.28 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 97.25 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.25 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.21 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 97.21 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 97.19 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 97.18 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 97.15 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.14 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.14 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.14 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.13 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 97.12 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.12 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 97.12 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.11 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.11 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.11 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.11 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 97.11 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 97.1 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 97.1 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 97.09 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 97.09 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.09 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 97.08 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.08 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.08 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.07 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 97.07 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.07 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 97.07 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 97.06 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 97.05 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 97.04 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 97.03 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.03 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.03 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 97.03 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 97.03 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 97.01 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 97.01 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.0 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.0 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.99 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.99 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 96.98 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.98 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 96.97 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 96.97 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.96 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.95 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 96.93 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 96.92 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.92 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 96.92 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.91 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.91 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 96.91 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 96.89 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.89 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 96.89 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 96.88 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.88 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.87 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 96.86 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 96.84 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 96.84 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 96.83 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 96.83 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 96.81 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 96.8 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 96.79 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.78 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.76 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.72 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.68 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.68 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 96.68 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 96.68 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 96.65 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.64 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 96.62 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 96.61 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 96.61 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 96.58 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.58 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 96.58 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 96.57 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 96.55 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 96.52 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 96.52 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 96.49 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 96.48 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 96.46 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 96.46 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 96.46 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 96.42 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 96.33 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 96.3 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 96.3 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 96.27 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 96.26 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 96.26 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.18 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.17 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.13 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.1 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 96.09 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 96.08 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 96.08 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 96.07 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 96.05 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 96.04 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 96.04 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 95.98 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 95.93 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.92 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.9 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 95.85 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 95.78 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.77 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 95.76 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 95.74 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 95.73 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.72 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 95.71 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 95.62 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 95.61 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 95.57 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 95.53 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 95.49 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 95.46 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 95.43 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 95.38 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 95.35 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 95.34 | |
| 2cr7_A | 80 | Paired amphipathic helix protein SIN3B; paired amp | 95.33 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 95.15 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 95.13 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 95.09 | |
| 2czy_A | 77 | Paired amphipathic helix protein SIN3B; SIN3, PAH1 | 95.07 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.0 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 93.96 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 94.95 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.93 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 94.92 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 94.89 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 94.89 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 94.83 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 94.81 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 94.75 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 94.63 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 94.57 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 94.56 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 94.55 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 93.56 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 94.51 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 94.37 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 94.35 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 94.32 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.3 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 94.28 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 94.11 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 94.11 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 94.1 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 94.08 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.03 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 94.02 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 93.99 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 93.97 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.95 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.94 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 93.94 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.93 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 92.98 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 93.85 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 93.84 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 93.76 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 92.73 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.63 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 92.67 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 93.45 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.44 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.42 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.37 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 93.3 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 93.16 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 93.02 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 93.01 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 92.15 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 92.62 | |
| 1e91_A | 85 | Paired amphipathic helix protein SIN3B; eukaryotic | 91.94 | |
| 1g1e_B | 89 | SIN3A; four-helix bundle, protein-peptide complex, | 91.94 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 91.81 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 91.51 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 91.48 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 90.83 | |
| 1zw8_A | 64 | Zinc-responsive transcriptional regulator ZAP1; in | 90.68 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 90.17 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 89.54 | |
| 2f05_A | 105 | Paired amphipathic helix protein SIN3B; helix bund | 89.48 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 89.36 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 86.78 | |
| 2ld7_B | 75 | Paired amphipathic helix protein SIN3A; transcript | 85.24 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 85.08 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 81.08 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 80.99 |
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
Probab=99.74 E-value=3.1e-19 Score=177.73 Aligned_cols=132 Identities=22% Similarity=0.451 Sum_probs=114.6
Q ss_pred hcccccccCCCCCCCCCCCcccccccChhhhhccccccc--CccccCcccCCCccccccccccCHHHHHHHHhcCCCCCC
Q 003291 105 MCRLSCSVCDNMEGPNDGSKRRARFRNIEQLKGHLFHRH--KLLMCSLCLEGRKVFICEQKLYTRAQLNQHINSGDSVVD 182 (833)
Q Consensus 105 l~~~~C~~C~k~~~~~~g~~~~~~F~s~~~Lk~Hlr~~H--~~~~C~iC~k~~KvF~~E~~fyt~~~L~~H~r~h~~e~~ 182 (833)
..+|.|++|++ .|.+...|..|++.++ .+|.|.+|++ .|.+...|..|++.|.++
T Consensus 47 ~~~~~C~~C~~------------~f~~~~~l~~H~~~h~~~~~~~C~~C~~---------~f~~~~~l~~H~~~h~~~-- 103 (190)
T 2i13_A 47 EKPYKCPECGK------------SFSDKKDLTRHQRTHTGEKPYKCPECGK---------SFSQRANLRAHQRTHTGE-- 103 (190)
T ss_dssp -CCEECTTTCC------------EESSHHHHHHHHHHHHCCCCEECTTTCC---------EESCHHHHHHHHHHHHTC--
T ss_pred CCCccCCCcCc------------hhCCHHHHHHHHHhcCCCCCccCcccCC---------ccCCHHHHHHHHHhcCCC--
Confidence 35789999998 9999999999998766 4799999998 899999999999998876
Q ss_pred CCcccCCCCCCCCCCCCCCCccCCchhHhhhcc----CCcccCCCCCCccCCcccccCChhHHHhhhc----CCCccCCh
Q 003291 183 GTESERGGFMGHPMCEFCRTPFYGDNELYTHMS----TEHYTCHICQRQHPGQYEYYKNYDDLEIHFR----RDHFLCED 254 (833)
Q Consensus 183 g~~~~~~g~~~h~~C~~C~k~F~~~~~L~~Hmr----ekhf~C~iC~k~~~~~~~yF~~~~~L~~H~r----~kHy~C~~ 254 (833)
.++.|.+|++.|.....|..|++ +++|.|.+|++. |.+...|..|++ .++|.|+.
T Consensus 104 ----------~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~-------f~~~~~L~~H~~~H~~~~~~~C~~ 166 (190)
T 2i13_A 104 ----------KPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKS-------FSREDNLHTHQRTHTGEKPYKCPE 166 (190)
T ss_dssp ----------CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCE-------ESCHHHHHHHHHHHHCCCCEECTT
T ss_pred ----------CCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcc-------cCCHHHHHHHHHhcCCCCCeECCC
Confidence 67899999999999999999987 789999999998 999999999887 47899999
Q ss_pred hhhccccccccCChHHHHHHHHHhhCCC
Q 003291 255 EACLAKKFVVFQSEAEMKRHNAIEHGGR 282 (833)
Q Consensus 255 ~~C~k~kfvvF~s~~eLk~H~~~hHg~~ 282 (833)
|++. |.+...|+.|+++|+|++
T Consensus 167 --C~~~----f~~~~~L~~H~~~H~~~k 188 (190)
T 2i13_A 167 --CGKS----FSRRDALNVHQRTHTGKK 188 (190)
T ss_dssp --TCCE----ESSHHHHHHHHTTC----
T ss_pred --CCCc----cCCHHHHHHHHHhcCCCC
Confidence 9985 999999999999988864
|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2cr7_A Paired amphipathic helix protein SIN3B; paired amphipathic helix repeat, transcriptional repressor, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rmr_A 2rms_A | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2czy_A Paired amphipathic helix protein SIN3B; SIN3, PAH1, transcriptional repressor, gene regulation; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >1e91_A Paired amphipathic helix protein SIN3B; eukaryotic transcriptional regulation, SIN3, PAH domains, protein-protein interactions; NMR {Mus musculus} SCOP: a.59.1.1 PDB: 1pd7_A | Back alignment and structure |
|---|
| >1g1e_B SIN3A; four-helix bundle, protein-peptide complex, transcription; NMR {Mus musculus} SCOP: a.59.1.1 PDB: 1s5q_B 1s5r_B 2l9s_B | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2f05_A Paired amphipathic helix protein SIN3B; helix bundle, transcription repressor; NMR {Mus musculus} SCOP: a.59.1.1 | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >2ld7_B Paired amphipathic helix protein SIN3A; transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 833 | |||
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 98.48 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 98.31 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 97.83 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 97.62 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 97.56 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.5 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 97.5 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 97.48 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 97.34 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 97.33 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 97.31 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 97.3 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 97.26 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 97.22 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 97.18 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 97.18 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 97.17 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 97.13 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 97.13 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 97.06 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 97.02 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.01 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 97.0 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 96.97 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 96.94 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 96.89 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 96.87 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 96.84 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 96.76 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 96.76 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 96.73 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 96.65 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 96.62 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 96.59 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 96.56 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 96.53 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 96.51 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 96.45 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 96.37 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 96.33 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 96.26 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 96.21 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 96.18 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 96.18 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 96.12 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 96.08 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 95.82 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 95.8 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 95.78 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 95.57 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 95.28 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 95.14 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 94.99 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 94.38 | |
| d2j7ja2 | 29 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 94.37 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 94.06 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 93.99 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 93.97 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 93.89 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 93.78 | |
| d1tf3a2 | 30 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 93.66 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 93.64 | |
| d1bhia_ | 38 | Transactivation domain of cre-bp1/atf-2 {Human (Ho | 93.11 | |
| d2f05a1 | 85 | Sin3B {Mouse (Mus musculus) [TaxId: 10090]} | 92.97 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 92.42 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 91.33 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 90.83 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 90.57 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 90.16 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 90.04 | |
| d1tf3a1 | 31 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 89.98 | |
| d1s5qb_ | 89 | Sin3A {Mouse (Mus musculus) [TaxId: 10090]} | 89.97 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 89.9 | |
| d2dlqa3 | 30 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 89.69 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 89.46 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 89.46 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 89.46 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 89.33 | |
| d2glia4 | 31 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 89.26 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 89.23 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 89.2 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 89.0 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 88.78 | |
| d2dmda1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 88.51 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 87.09 | |
| d1znfa_ | 26 | XFIN, third domain {Xenopus laevis [TaxId: 8355]} | 87.02 | |
| d2ct1a1 | 28 | Transcriptional repressor CTCF {Human (Homo sapien | 86.47 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 86.23 | |
| d2adra2 | 31 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 85.97 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 85.48 | |
| d1x5wa2 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 85.33 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 85.11 | |
| d2dlqa1 | 26 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 84.54 | |
| d1znfa_ | 26 | XFIN, third domain {Xenopus laevis [TaxId: 8355]} | 84.25 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 84.1 | |
| d2dlqa3 | 30 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 83.45 | |
| d2dlqa2 | 28 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 80.38 |
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: Zinc finger protein 297b species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.48 E-value=2.6e-08 Score=78.23 Aligned_cols=50 Identities=24% Similarity=0.436 Sum_probs=39.5
Q ss_pred CccccCcccCCCccccccccccCHHHHHHHHhcCCCCCCCCcccCCCCCCCCCCCCCCCccCCchhHhhhcc
Q 003291 144 KLLMCSLCLEGRKVFICEQKLYTRAQLNQHINSGDSVVDGTESERGGFMGHPMCEFCRTPFYGDNELYTHMS 215 (833)
Q Consensus 144 ~~~~C~iC~k~~KvF~~E~~fyt~~~L~~H~r~h~~e~~g~~~~~~g~~~h~~C~~C~k~F~~~~~L~~Hmr 215 (833)
++|.|+ |++ .|.....|..|+++|+++ ++|.|.+|++.|.....|..||+
T Consensus 2 K~y~C~-Cgk---------~F~~~~~l~~H~~~Ht~e------------kpy~C~~C~k~F~~~~~L~~H~r 51 (53)
T d2csha1 2 KLYPCQ-CGK---------SFTHKSQRDRHMSMHLGL------------RPYGCGVCGKKFKMKHHLVGHMK 51 (53)
T ss_dssp CCEECT-TSC---------EESSHHHHHHHHHHHSCC------------CSEECTTTSCEESSSHHHHHHHT
T ss_pred cCCCCC-CCC---------eECCHHHhHHHhhccccc------------cCCcCCCcCCEecCHHHHHHHHh
Confidence 467785 887 888888888888888776 67788888888888888888875
|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f05a1 a.59.1.1 (A:1-85) Sin3B {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1s5qb_ a.59.1.1 (B:) Sin3A {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|