Citrus Sinensis ID: 003295


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830---
MDLRRLSIPKPCSLSIAVSRPLTHVTSTAQQQQELHNRNQQQQPPPPQSSNQSLLKWVSSVLSKQSLDPSKCKLFLPNLSPQEFDTLFFSIRSNVNPKTALKFFYFASQSCNFRFTVRSYCLLIRLLLFSNLLSPARLLLIRLIDGKMPVLYASNPSIRHIEIASQMVDLNVTSEPALGVQIADLLVHVYCTQFKNLGFGYAIDVFSIFSSKGIFPSLKTCNFLLNSLVKANEVQKGIEVFETMCRGVSPDVFLFSTAINAFCKRGRIEDAIGLFTKMEELGIAPNVVTYNNIIHGLCRNGRLYEAFHLKEKMVLREVEPSLITYSILINGLIKLEKFDDANFVLKEMSVRGFVPNYVVYNTLIDGYCKKGNISEALKIRDDMVSKGMSPNSVTFNSLIHGFCKSGQMDNAENALEEMLSRGLSINQGAYTSVIKWLCINSRFNSALHFTKEMLLRNLRPGDGLLTLLVSGLCKNGKQAEATELCFRLFEKGFTVNTVTSNALIHGMCEAGNLKEAGKLLMEMLQRGLILDKVTYNTLILGCCKDGKPEEGFKLKEDMIKRGIQPDNYTYNLLLHGLCSLGKMEEAIELWEECKRTVFGPDIYTYGVMIDGFCKADKIEEGETLFNEMISKKMELNPVVYNTLIRAYCKIGNTTAAFRLSNDMKSRGILPTSVTYSSLIHGLCNIGLIEDAKCLFDEMRKEGLLPNVACYTALIGGYCKLGQMDEAESVLQEMASINIHPNKITYTIMIGGYCKLGDMKEAAKLLNVMAEKGISPDSITYNVFMDGHCKGGNVEEAFKVCDRMLSEGLSLDEITYTTLIDGWQSSTITNQDNH
cccccccccccccccccccccccccccccHHHHHHcccccccccccccccHHHHHHHHHHHccccccccHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccc
cccHHcccccccccccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHcc
mdlrrlsipkpcslsiavsrplthvtsTAQQQQELHnrnqqqqppppqssnqslLKWVSSVLskqsldpskcklflpnlspqefDTLFFSIRSNVNPKTALKFFYFAsqscnfrfTVRSYCLLIRLLLFSNLLSPARLLLIRLIdgkmpvlyasnpsirHIEIASQMvdlnvtsepalgVQIADLLVHVYCTQFKNLGFGYAIDVFSifsskgifpslkTCNFLLNSLVKANEVQKGIEVFETMcrgvspdvfLFSTAINAFCKRGRIEDAIGLFTKMeelgiapnvvtynniihglcrngrlyeafhlKEKMVLREVEPSLITYSILINGLIklekfddanfvlkemsvrgfvpnYVVYNTLIDGyckkgnisEALKIRDdmvskgmspnsvtfnSLIHgfcksgqmdNAENALEEMLSRglsinqgaYTSVIKWLCINSRFNSALHFTKEMLLrnlrpgdgLLTLLVSGLCKNGKQAEATELCFRLFEKGFTVNTVTSNALIHGMCEAGNLKEAGKLLMEMLQRGLILDKVTYNTLILgcckdgkpeegfKLKEDMIkrgiqpdnytYNLLLHGLCSLGKMEEAIELWEECKrtvfgpdiytyGVMIDGFCKADKIEEGETLFNEMISKKMELNPVVYNTLIRAYCKIGnttaafrlsndmksrgilptsvtySSLIHGLCNIGLIEDAKCLFDEMrkegllpnvaCYTALIGGYCKLGQMDEAESVLQEMASinihpnkiTYTIMIGGYCKLGDMKEAAKLLNVMAekgispdsitynvfmdghckggnveEAFKVCDRMLseglsldeiTYTTLIdgwqsstitnqdnh
mdlrrlsipkpcslsiavsrplTHVTSTAQQQQELHNRNQQQQPPPPQSSNQSLLKWVSSVLSKQSLDPSKCKLFLPNLSPQEFDTLFFSIRSNVNPKTALKFFYFASQSCNFRFTVRSYCLLIRLLLFSNLLSPARLLLIRLIDGKMPVLYASNPSIRHIEIASQMVDLNVTSEPALGVQIADLLVHVYCTQFKNLGFGYAIDVFSIFSSKGIFPSLKTCNFLLNSLVKANEVQKGIEVFETMCRGVSPDVFLFSTAINAFCKRGRIEDAIGLFTKMEELGIAPNVVTYNNIIHGLCRNGRLYEAFHLKEKMVLREVEPSLITYSILINGLIKLEKFDDANFVLKEMSVRGFVPNYVVYNTLIDGYCKKGNISEALKIRDDMVSKGMSPNSVTFNSLIHGFCKSGQMDNAENALEEMLSRGLSINQGAYTSVIKWLCINSRFNSALHFTKEMLLRNLRPGDGLLTLLVSGLCKNGKQAEATELCFRLFEKGFTVNTVTSNALIHGMCEAGNLKEAGKLLMEMLQRGLILDKVTYNTLILGCCKDGKPEEGFKLKEDMIKRGIQPDNYTYNLLLHGLCSLGKMEEAIELWEECKRTVFGPDIYTYGVMIDGFCKADKIEEGETLFNEMISKKMELNPVVYNTLIRAYCKIGNTTAAFRLSNDMKSRGILPTSVTYSSLIHGLCNIGLIEDAKCLFDEMRKEGLLPNVACYTALIGGYCKLGQMDEAESVLQEMASINIHPNKITYTIMIGGYCKLGDMKEAAKLLNVMAEKGISPDSITYNVFMDGHCKGGNVEEAFKVCDRMLSEGLSLDEITYTtlidgwqsstitnqdnh
MDLRRLSIPKPCSLSIAVSRPLTHVTSTAqqqqelhnrnqqqqppppqssnqsllkwvssvlskqslDPSKCKLFLPNLSPQEFDTLFFSIRSNVNPKTALKFFYFASQSCNFRFTVRSYCllirlllfsnllsparlllirliDGKMPVLYASNPSIRHIEIASQMVDLNVTSEPALGVQIADLLVHVYCTQFKNLGFGYAIDVFSIFSSKGIFPSLKTCNFLLNSLVKANEVQKGIEVFETMCRGVSPDVFLFSTAINAFCKRGRIEDAIGLFTKMEELGIAPNVVTYNNIIHGLCRNGRLYEAFHLKEKMVLREVEPSLITYSILINGLIKLEKFDDANFVLKEMSVRGFVPNYVVYNTLIDGYCKKGNISEALKIRDDMVSKGMSPNSVTFNSLIHGFCKSGQMDNAENALEEMLSRGLSINQGAYTSVIKWLCINSRFNSALHFTKEMLLRNLRPGDGLLTLLVSGLCKNGKQAEATELCFRLFEKGFTVNTVTSNALIHGMCEAGNLKEAGKLLMEMLQRGLILDKVTYNTLILGCCKDGKPEEGFKLKEDMIKRGIQPDNYTYNLLLHGLCSLGKMEEAIELWEECKRTVFGPDIYTYGVMIDGFCKADKIEEGETLFNEMISKKMELNPVVYNTLIRAYCKIGNTTAAFRLSNDMKSRGILPTSVTYSSLIHGLCNIGLIEDAKCLFDEMRKEGLLPNVACYTALIGGYCKLGQMDEAESVLQEMASINIHPNKITYTIMIGGYCKLGDMKEAAKLLNVMAEKGISPDSITYNVFMDGHCKGGNVEEAFKVCDRMLSEGLSLDEITYTTLIDGWQSSTITNQDNH
********************************************************WVS*V*********KCKLFLPNLSPQEFDTLFFSIRSNVNPKTALKFFYFASQSCNFRFTVRSYCLLIRLLLFSNLLSPARLLLIRLIDGKMPVLYASNPSIRHIEIASQMVDLNVTSEPALGVQIADLLVHVYCTQFKNLGFGYAIDVFSIFSSKGIFPSLKTCNFLLNSLVKANEVQKGIEVFETMCRGVSPDVFLFSTAINAFCKRGRIEDAIGLFTKMEELGIAPNVVTYNNIIHGLCRNGRLYEAFHLKEKMVLREVEPSLITYSILINGLIKLEKFDDANFVLKEMSVRGFVPNYVVYNTLIDGYCKKGNISEALKIRDDMV*******SVTFNSLIHGFCKSG********LEEMLSRGLSINQGAYTSVIKWLCINSRFNSALHFTKEMLLRNLRPGDGLLTLLVSGLCKNGKQAEATELCFRLFEKGFTVNTVTSNALIHGMCEAGNLKEAGKLLMEMLQRGLILDKVTYNTLILGCCKDGKPEEGFKLKEDMIKRGIQPDNYTYNLLLHGLCSLGKMEEAIELWEECKRTVFGPDIYTYGVMIDGFCKADKIEEGETLFNEMISKKMELNPVVYNTLIRAYCKIGNTTAAFRLSNDMKSRGILPTSVTYSSLIHGLCNIGLIEDAKCLFDEMRKEGLLPNVACYTALIGGYCKLGQMDEAESVLQEMASINIHPNKITYTIMIGGYCKLGDMKEAAKLLNVMAEKGISPDSITYNVFMDGHCKGGNVEEAFKVCDRMLSEGLSLDEITYTTLIDGWQ**********
*****************************************************LLKWVSSVL****************LSPQEFDTLFFSIRSNVNPKTALKFFYFASQSCNFRFTVRSYCLLIRLLLFSNLLSPARLLLIRLIDGKMPVLYASNPSIRHIEIASQMVDLNVTSEPALGVQIADLLVHVYCTQFKNLGFGYAIDVFSIFSSKGIFPSLKTCNFLLNSLVKANEVQKGIEVFETMCRGVSPDVFLFSTAINAFCKRGRIEDAIGLFTKMEELGIAPNVVTYNNIIHGLCRNGRLYEAFHLKEKMVLREVEPSLITYSILINGLIKLEKFDDANFVLKEMSVRGFVPNYVVYNTLIDGYCKKGNISEALKIRDDMVSKGMSPNSVTFNSLIHGFCKSGQMDNAENALEEMLSRGLSINQGAYTSVIKWLCINSRFNSALHFTKEMLLRNLRPGDGLLTLLVSGLCKNGKQAEATELCFRLFEKGFTVNTVTSNALIHGMCEAGNLKEAGKLLMEMLQRGLILDKVTYNTLILGCCKDGKPEEGFKLKEDMIKRGIQPDNYTYNLLLHGLCSLGKMEEAIELWEECKRTVFGPDIYTYGVMIDGFCKADKIEEGETLFNEMISKKMELNPVVYNTLIRAYCKIGNTTAAFRLSNDMKSRGILPTSVTYSSLIHGLCNIGLIEDAKCLFDEMRKEGLLPNVACYTALIGGYCKLGQMDEAESVLQEMASINIHPNKITYTIMIGGYCKLGDMKEAAKLLNVMAEKGISPDSITYNVFMDGHCKGGNVEEAFKVCDRMLSEGLSLDEITYTTLIDGWQSSTITNQDNH
MDLRRLSIPKPCSLSIAVSRPL*******************************LLKWVSSVLSKQSLDPSKCKLFLPNLSPQEFDTLFFSIRSNVNPKTALKFFYFASQSCNFRFTVRSYCLLIRLLLFSNLLSPARLLLIRLIDGKMPVLYASNPSIRHIEIASQMVDLNVTSEPALGVQIADLLVHVYCTQFKNLGFGYAIDVFSIFSSKGIFPSLKTCNFLLNSLVKANEVQKGIEVFETMCRGVSPDVFLFSTAINAFCKRGRIEDAIGLFTKMEELGIAPNVVTYNNIIHGLCRNGRLYEAFHLKEKMVLREVEPSLITYSILINGLIKLEKFDDANFVLKEMSVRGFVPNYVVYNTLIDGYCKKGNISEALKIRDDMVSKGMSPNSVTFNSLIHGFCKSGQMDNAENALEEMLSRGLSINQGAYTSVIKWLCINSRFNSALHFTKEMLLRNLRPGDGLLTLLVSGLCKNGKQAEATELCFRLFEKGFTVNTVTSNALIHGMCEAGNLKEAGKLLMEMLQRGLILDKVTYNTLILGCCKDGKPEEGFKLKEDMIKRGIQPDNYTYNLLLHGLCSLGKMEEAIELWEECKRTVFGPDIYTYGVMIDGFCKADKIEEGETLFNEMISKKMELNPVVYNTLIRAYCKIGNTTAAFRLSNDMKSRGILPTSVTYSSLIHGLCNIGLIEDAKCLFDEMRKEGLLPNVACYTALIGGYCKLGQMDEAESVLQEMASINIHPNKITYTIMIGGYCKLGDMKEAAKLLNVMAEKGISPDSITYNVFMDGHCKGGNVEEAFKVCDRMLSEGLSLDEITYTTLIDGWQSS********
*****LSIPKPCSLSIAVSRPLTHVTSTAQQQQELHNRNQQQQPPPPQSSNQSLLKWVSSVLSKQSLDPSKCKLFLPNLSPQEFDTLFFSIRSNVNPKTALKFFYFASQSCNFRFTVRSYCLLIRLLLFSNLLSPARLLLIRLIDGKMPVLYASNPSIRHIEIASQMVDLNVTSEPALGVQIADLLVHVYCTQFKNLGFGYAIDVFSIFSSKGIFPSLKTCNFLLNSLVKANEVQKGIEVFETMCRGVSPDVFLFSTAINAFCKRGRIEDAIGLFTKMEELGIAPNVVTYNNIIHGLCRNGRLYEAFHLKEKMVLREVEPSLITYSILINGLIKLEKFDDANFVLKEMSVRGFVPNYVVYNTLIDGYCKKGNISEALKIRDDMVSKGMSPNSVTFNSLIHGFCKSGQMDNAENALEEMLSRGLSINQGAYTSVIKWLCINSRFNSALHFTKEMLLRNLRPGDGLLTLLVSGLCKNGKQAEATELCFRLFEKGFTVNTVTSNALIHGMCEAGNLKEAGKLLMEMLQRGLILDKVTYNTLILGCCKDGKPEEGFKLKEDMIKRGIQPDNYTYNLLLHGLCSLGKMEEAIELWEECKRTVFGPDIYTYGVMIDGFCKADKIEEGETLFNEMISKKMELNPVVYNTLIRAYCKIGNTTAAFRLSNDMKSRGILPTSVTYSSLIHGLCNIGLIEDAKCLFDEMRKEGLLPNVACYTALIGGYCKLGQMDEAESVLQEMASINIHPNKITYTIMIGGYCKLGDMKEAAKLLNVMAEKGISPDSITYNVFMDGHCKGGNVEEAFKVCDRMLSEGLSLDEITYTTLIDGWQSSTIT*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLRRLSIPKPCSLSIAVSRPLTHVTSTAQQQQELHNRNQQQQPPPPQSSNQSLLKWVSSVLSKQSLDPSKCKLFLPNLSPQEFDTLFFSIRSNVNPKTALKFFYFASQSCNFRFTVRSYCLLIRLLLFSNLLSPARLLLIRLIDGKMPVLYASNPSIRHIEIASQMVDLNVTSEPALGVQIADLLVHVYCTQFKNLGFGYAIDVFSIFSSKGIFPSLKTCNFLLNSLVKANEVQKGIEVFETMCRGVSPDVFLFSTAINAFCKRGRIEDAIGLFTKMEELGIAPNVVTYNNIIHGLCRNGRLYEAFHLKEKMVLREVEPSLITYSILINGLIKLEKFDDANFVLKEMSVRGFVPNYVVYNTLIDGYCKKGNISEALKIRDDMVSKGMSPNSVTFNSLIHGFCKSGQMDNAENALEEMLSRGLSINQGAYTSVIKWLCINSRFNSALHFTKEMLLRNLRPGDGLLTLLVSGLCKNGKQAEATELCFRLFEKGFTVNTVTSNALIHGMCEAGNLKEAGKLLMEMLQRGLILDKVTYNTLILGCCKDGKPEEGFKLKEDMIKRGIQPDNYTYNLLLHGLCSLGKMEEAIELWEECKRTVFGPDIYTYGVMIDGFCKADKIEEGETLFNEMISKKMELNPVVYNTLIRAYCKIGNTTAAFRLSNDMKSRGILPTSVTYSSLIHGLCNIGLIEDAKCLFDEMRKEGLLPNVACYTALIGGYCKLGQMDEAESVLQEMASINIHPNKITYTIMIGGYCKLGDMKEAAKLLNVMAEKGISPDSITYNVFMDGHCKGGNVEEAFKVCDRMLSEGLSLDEITYTTLIDGWQSSTITNQDNH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query833 2.2.26 [Sep-21-2011]
Q940A6838 Pentatricopeptide repeat- yes no 0.966 0.960 0.541 0.0
Q9FJE6907 Putative pentatricopeptid no no 0.852 0.782 0.309 4e-94
Q9LVQ5 1096 Pentatricopeptide repeat- no no 0.848 0.645 0.297 2e-92
Q9LSL9915 Pentatricopeptide repeat- no no 0.918 0.836 0.273 1e-87
Q9FIX3747 Pentatricopeptide repeat- no no 0.834 0.930 0.291 2e-87
Q6NQ83619 Pentatricopeptide repeat- no no 0.651 0.877 0.321 3e-85
Q0WKV3637 Pentatricopeptide repeat- no no 0.661 0.864 0.319 1e-83
Q9FIT7974 Pentatricopeptide repeat- no no 0.752 0.643 0.283 2e-82
Q9SXD1630 Pentatricopeptide repeat- no no 0.641 0.847 0.315 3e-82
Q9ASZ8621 Pentatricopeptide repeat- no no 0.661 0.887 0.309 5e-82
>sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 Back     alignment and function desciption
 Score =  859 bits (2219), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/826 (54%), Positives = 587/826 (71%), Gaps = 21/826 (2%)

Query: 1   MDLRRLSIPKPCSLS----IAVSRPLTHVTSTAQQQQELHNRNQQQQPPPPQSSNQSLLK 56
           MDLRRLS            IA SR   H +   QQ   +H  ++ ++     SS++ L +
Sbjct: 25  MDLRRLSRASYLFTRRLKFIAKSRKCFHTSRYLQQC--VHRPDKSEE----TSSDRHLHE 78

Query: 57  WVSSVLSKQSLDPSKCKLFLPNLSPQEFDTLFFSIRSNVNPKTALKFFYFASQSCNFRFT 116
            +SSVLSK+SLD  +CK  +  LSP EFD LF   RS VNPKTAL FF  AS S +F F+
Sbjct: 79  RLSSVLSKRSLDYEQCKQLITVLSPLEFDRLFPEFRSKVNPKTALDFFRLASDSFSFSFS 138

Query: 117 VRSYCLLIRLLLFSNLLSPARLLLIRLIDGKMPVLYASNPSIRHIEIASQMVDLNVTSEP 176
           +RSYCLLI LLL +NLLS AR++LIRLI+G +PVL       R + IA  M  L++  + 
Sbjct: 139 LRSYCLLIGLLLDANLLSAARVVLIRLINGNVPVLPCGLRDSR-VAIADAMASLSLCFDE 197

Query: 177 ALGVQIADLLVHVYCTQFKNLGFGYAIDVFSIFSSKGIFPSLKTCNFLLNSLVKANEVQK 236
            +  +++DLL+ VYCTQFK  G   A+DVF + ++KG+FPS  TCN LL SLV+ANE QK
Sbjct: 198 EIRRKMSDLLIEVYCTQFKRDGCYLALDVFPVLANKGMFPSKTTCNILLTSLVRANEFQK 257

Query: 237 GIEVFETMCRGVSPDVFLFSTAINAFCKRGRIEDAIGLFTKMEELGIAPNVVTYNNIIHG 296
             E F+ +C+GVSPDV+LF+TAINAFCK G++E+A+ LF+KMEE G+APNVVT+N +I G
Sbjct: 258 CCEAFDVVCKGVSPDVYLFTTAINAFCKGGKVEEAVKLFSKMEEAGVAPNVVTFNTVIDG 317

Query: 297 LCRNGRLYEAFHLKEKMVLREVEPSLITYSILINGLIKLEKFDDANFVLKEMSVRGFVPN 356
           L   GR  EAF  KEKMV R +EP+LITYSIL+ GL + ++  DA FVLKEM+ +GF PN
Sbjct: 318 LGMCGRYDEAFMFKEKMVERGMEPTLITYSILVKGLTRAKRIGDAYFVLKEMTKKGFPPN 377

Query: 357 YVVYNTLIDGYCKKGNISEALKIRDDMVSKGMSPNSVTFNSLIHGFCKSGQMDNAENALE 416
            +VYN LID + + G++++A++I+D MVSKG+S  S T+N+LI G+CK+GQ DNAE  L+
Sbjct: 378 VIVYNNLIDSFIEAGSLNKAIEIKDLMVSKGLSLTSSTYNTLIKGYCKNGQADNAERLLK 437

Query: 417 EMLSRGLSINQGAYTSVIKWLCINSRFNSALHFTKEMLLRNLRPGDGLLTLLVSGLCKNG 476
           EMLS G ++NQG++TSVI  LC +  F+SAL F  EMLLRN+ PG GLLT L+SGLCK+G
Sbjct: 438 EMLSIGFNVNQGSFTSVICLLCSHLMFDSALRFVGEMLLRNMSPGGGLLTTLISGLCKHG 497

Query: 477 KQAEATELCFRLFEKGFTVNTVTSNALIHGMCEAGNLKEAGKLLMEMLQRGLILDKVTYN 536
           K ++A EL F+   KGF V+T TSNAL+HG+CEAG L EA ++  E+L RG ++D+V+YN
Sbjct: 498 KHSKALELWFQFLNKGFVVDTRTSNALLHGLCEAGKLDEAFRIQKEILGRGCVMDRVSYN 557

Query: 537 TLILGCCKDGKPEEGFKLKEDMIKRGIQPDNYTYNLLLHGLCSLGKMEEAIELWEECKRT 596
           TLI GCC   K +E F   ++M+KRG++PDNYTY++L+ GL ++ K+EEAI+ W++CKR 
Sbjct: 558 TLISGCCGKKKLDEAFMFLDEMVKRGLKPDNYTYSILICGLFNMNKVEEAIQFWDDCKRN 617

Query: 597 VFGPDIYTYGVMIDGFCKADKIEEGETLFNEMISKKMELNPVVYNTLIRAYCKIGNTTAA 656
              PD+YTY VMIDG CKA++ EEG+  F+EM+SK ++ N VVYN LIRAYC+ G  + A
Sbjct: 618 GMLPDVYTYSVMIDGCCKAERTEEGQEFFDEMMSKNVQPNTVVYNHLIRAYCRSGRLSMA 677

Query: 657 FRLSNDMKSRGILPTSVTYSSLIHGLCNIGLIEDAKCLFDEMRKEGLLPNVACYTALIGG 716
             L  DMK +GI P S TY+SLI G+  I  +E+AK LF+EMR EGL PNV  YTALI G
Sbjct: 678 LELREDMKHKGISPNSATYTSLIKGMSIISRVEEAKLLFEEMRMEGLEPNVFHYTALIDG 737

Query: 717 YCKLGQMDEAESVLQEMASINIHPNKITYTIMIGGYCKLGDMKEAAKLLNVMAEKGISPD 776
           Y KLGQM + E +L+EM S N+HPNKITYT+MIGGY + G++ EA++LLN M EKGI PD
Sbjct: 738 YGKLGQMVKVECLLREMHSKNVHPNKITYTVMIGGYARDGNVTEASRLLNEMREKGIVPD 797

Query: 777 SITYNVFMDGHCKGGNVEEAFKVCDRMLSEGLSLDEITYTTLIDGW 822
           SITY  F+ G+ K G V EAFK            DE  Y  +I+GW
Sbjct: 798 SITYKEFIYGYLKQGGVLEAFK----------GSDEENYAAIIEGW 833





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 Back     alignment and function description
>sp|Q9LVQ5|PP432_ARATH Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=2 SV=2 Back     alignment and function description
>sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function description
>sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 Back     alignment and function description
>sp|Q0WKV3|PPR36_ARATH Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 Back     alignment and function description
>sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=2 SV=2 Back     alignment and function description
>sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query833
224071479836 predicted protein [Populus trichocarpa] 0.995 0.991 0.674 0.0
296085490826 unnamed protein product [Vitis vinifera] 0.990 0.998 0.655 0.0
359474768 1022 PREDICTED: pentatricopeptide repeat-cont 0.948 0.772 0.654 0.0
449462543822 PREDICTED: pentatricopeptide repeat-cont 0.986 1.0 0.601 0.0
255557743777 pentatricopeptide repeat-containing prot 0.779 0.835 0.689 0.0
449519270799 PREDICTED: LOW QUALITY PROTEIN: pentatri 0.959 1.0 0.574 0.0
223635621838 RecName: Full=Pentatricopeptide repeat-c 0.966 0.960 0.541 0.0
356560499836 PREDICTED: pentatricopeptide repeat-cont 0.990 0.986 0.534 0.0
3080374814 putative protein [Arabidopsis thaliana] 0.966 0.988 0.541 0.0
18415314825 pentatricopeptide repeat-containing prot 0.966 0.975 0.541 0.0
>gi|224071479|ref|XP_002303480.1| predicted protein [Populus trichocarpa] gi|222840912|gb|EEE78459.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1154 bits (2984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/836 (67%), Positives = 672/836 (80%), Gaps = 7/836 (0%)

Query: 3   LRRLSIPKPCSLSIAVSRPLTHVTSTAQQQQELHNRNQQQQPPP-----PQSSNQSLLKW 57
           +RRL+I KP  +   + RPLT +T+T Q+Q ++H +     P       PQ+ NQSLLK 
Sbjct: 1   MRRLTITKPIFIQSPLKRPLTCITTTLQKQHQIHPQAPPPPPLLQTQTNPQALNQSLLKR 60

Query: 58  VSSVLSKQSLDPSKCKLFLPNLSPQEFDTLFFSIRSNVNPKTALKFFYFASQSCNFRFTV 117
           VS +LS  SLD +KCK  +P+LSPQEFD+ F +++SNVNPKTAL FF+F S++C FRFT 
Sbjct: 61  VSLILSNPSLDCAKCKELVPHLSPQEFDSCFLALKSNVNPKTALNFFHFVSETCKFRFTA 120

Query: 118 RSYCLLIRLLLFSNLLSPARLLLIRLIDGKMPVLYASNPSIRHIEIASQMVDLNVTSEPA 177
           RSYC+LI LL+ ++LLSPARLLLIRLIDGK+P  YA N   RH EIA  M D N+  EP 
Sbjct: 121 RSYCVLIHLLVGNDLLSPARLLLIRLIDGKVPAFYARNFESRHFEIAQIMADFNLVFEPV 180

Query: 178 LGVQIADLLVHVYCTQFKNLGFGYAIDVFSIFSSKGIFPSLKTCNFLLNSLVKANEVQKG 237
           +GV+IADLLVHVY TQFK+LGFG+A DVFS+ + KG+FPSLKTC FLL+SLVKANE++K 
Sbjct: 181 IGVKIADLLVHVYSTQFKHLGFGFAADVFSLLAKKGLFPSLKTCTFLLSSLVKANELKKS 240

Query: 238 IEVFETMC-RGVSPDVFLFSTAINAFCKRGRIEDAIGLFTKMEELGIAPNVVTYNNIIHG 296
            EV++ +C  G+ PDV LFST INAFCK  R +DAIGLF+KME+LG+APNVVTYNNIIHG
Sbjct: 241 YEVYDFICLGGIIPDVHLFSTMINAFCKGHREDDAIGLFSKMEKLGVAPNVVTYNNIIHG 300

Query: 297 LCRNGRLYEAFHLKEKMVLREVEPSLITYSILINGLIKLEKFDDANFVLKEMSVRGFVPN 356
           LC++GRL EA+  KEKMV  +V PSLITYS+ INGLIKLEK D+AN VLKEMS  GFVPN
Sbjct: 301 LCKSGRLDEAYRFKEKMVKEKVSPSLITYSVFINGLIKLEKIDEANCVLKEMSELGFVPN 360

Query: 357 YVVYNTLIDGYCKKGNISEALKIRDDMVSKGMSPNSVTFNSLIHGFCKSGQMDNAENALE 416
            VVYNTLIDGYCK GNISEALKIRDDM+SKG+SPNSVT NSLI GFCKS Q+  AEN LE
Sbjct: 361 EVVYNTLIDGYCKMGNISEALKIRDDMLSKGISPNSVTLNSLIQGFCKSDQIGQAENVLE 420

Query: 417 EMLSRGLSINQGAYTSVIKWLCINSRFNSALHFTKEMLLRNLRPGDGLLTLLVSGLCKNG 476
           EM+ RGL INQG+++ VI WLC+  RF +ALHF +EMLLRNLRP DGLLT LVSGLCK G
Sbjct: 421 EMIGRGLPINQGSFSMVINWLCLKFRFVTALHFIREMLLRNLRPNDGLLTTLVSGLCKAG 480

Query: 477 KQAEATELCFRLFEKGFTVNTVTSNALIHGMCEAGNLKEAGKLLMEMLQRGLILDKVTYN 536
           KQ EA EL  RL  KGF  N VTSNALIHG+C+AGN++E  KLL +ML+RGL+ D++TYN
Sbjct: 481 KQGEAVELWCRLLGKGFVPNIVTSNALIHGLCKAGNMQETLKLLRDMLERGLVFDRITYN 540

Query: 537 TLILGCCKDGKPEEGFKLKEDMIKRGIQPDNYTYNLLLHGLCSLGKMEEAIELWEECKRT 596
           TLI GCCK+GK +EGF+LKE+M+K+GIQPD YT+NLLLHGLC+  K++EA  LW ECK+ 
Sbjct: 541 TLISGCCKEGKVKEGFELKEEMVKKGIQPDIYTFNLLLHGLCNADKIDEASRLWHECKKN 600

Query: 597 VFGPDIYTYGVMIDGFCKADKIEEGETLFNEMISKKMELNPVVYNTLIRAYCKIGNTTAA 656
            + P++YTYGVMIDG+CKA+K+EEGE L NE++SKK+ELN VVYN+LIRAYC  GN  AA
Sbjct: 601 GYVPNVYTYGVMIDGYCKANKVEEGENLLNELVSKKLELNSVVYNSLIRAYCINGNMNAA 660

Query: 657 FRLSNDMKSRGILPTSVTYSSLIHGLCNIGLIEDAKCLFDEMRKEGLLPNVACYTALIGG 716
           FRL +DMKSRG+L +  TYSSL+HGLCNIGL++DAK L DEMRKEGLLPNV CYT +IGG
Sbjct: 661 FRLRDDMKSRGVLLSCATYSSLMHGLCNIGLVDDAKHLLDEMRKEGLLPNVVCYTTIIGG 720

Query: 717 YCKLGQMDEAESVLQEMASINIHPNKITYTIMIGGYCKLGDMKEAAKLLNVMAEKGISPD 776
           Y KLGQM++   VLQEM+S NIHPNK TYTIMI G+CKLG  KEAAKLLN M EKGI PD
Sbjct: 721 YSKLGQMNKVNIVLQEMSSHNIHPNKFTYTIMIDGFCKLGKTKEAAKLLNEMTEKGILPD 780

Query: 777 SITYNVFMDGHCKGGNVEEAFKVCDRMLSEGLSLDEITYTTLIDG-WQSSTITNQD 831
           ++TYN F +G CK G VEEAFKVCD M S  + LDEITYTTLIDG  Q ST TNQ+
Sbjct: 781 AVTYNAFTNGLCKEGKVEEAFKVCDEMSSGAVCLDEITYTTLIDGCHQPSTATNQE 836




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296085490|emb|CBI29222.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359474768|ref|XP_002270963.2| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Vitis vinifera] Back     alignment and taxonomy information
>gi|449462543|ref|XP_004149000.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255557743|ref|XP_002519901.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540947|gb|EEF42505.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449519270|ref|XP_004166658.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|223635621|sp|Q940A6.2|PP325_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g19440, chloroplastic; Flags: Precursor Back     alignment and taxonomy information
>gi|356560499|ref|XP_003548529.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|3080374|emb|CAA18631.1| putative protein [Arabidopsis thaliana] gi|7268739|emb|CAB78946.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18415314|ref|NP_567587.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|334186696|ref|NP_001190771.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|15810161|gb|AAL07224.1| unknown protein [Arabidopsis thaliana] gi|332658782|gb|AEE84182.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332658783|gb|AEE84183.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query833
TAIR|locus:2168078907 AT5G59900 "AT5G59900" [Arabido 0.763 0.701 0.318 2.1e-90
TAIR|locus:2155730 915 AT5G65560 "AT5G65560" [Arabido 0.635 0.578 0.343 7.3e-84
TAIR|locus:2077061619 AT3G22470 "AT3G22470" [Arabido 0.665 0.894 0.321 8.2e-83
TAIR|locus:2164910747 EMB2745 "EMBRYO DEFECTIVE 2745 0.692 0.772 0.312 2.2e-82
TAIR|locus:2034760637 AT1G12300 [Arabidopsis thalian 0.665 0.869 0.319 9.4e-82
TAIR|locus:2195047621 AT1G12620 [Arabidopsis thalian 0.662 0.888 0.309 7.6e-80
TAIR|locus:1009023134644 AT1G12775 [Arabidopsis thalian 0.663 0.858 0.306 2e-79
TAIR|locus:2026192630 RPF2 "rna processing factor 2" 0.641 0.847 0.315 3.3e-79
TAIR|locus:2015494629 RPF3 "RNA processing factor 3" 0.663 0.879 0.320 4.2e-79
TAIR|locus:2083976754 MEE40 "maternal effect embryo 0.631 0.697 0.318 6.6e-79
TAIR|locus:2168078 AT5G59900 "AT5G59900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 875 (313.1 bits), Expect = 2.1e-90, Sum P(2) = 2.1e-90
 Identities = 205/644 (31%), Positives = 343/644 (53%)

Query:   180 VQIADLLVHVYCTQFKNLGFGYAIDVFSIFSSKGIFPSLKTCNFLLNSLVKANEVQKGIE 239
             V+    L+H    +F++  FG A+++F+   S GI P +     ++ SL +  ++ +  E
Sbjct:   192 VRTLSALLHGL-VKFRH--FGLAMELFNDMVSVGIRPDVYIYTGVIRSLCELKDLSRAKE 248

Query:   240 VFETM-CRGVSPDVFLFSTAINAFCKRGRIEDAIGLFTKMEELGIAPNVVTYNNIIHGLC 298
             +   M   G   ++  ++  I+  CK+ ++ +A+G+   +    + P+VVTY  +++GLC
Sbjct:   249 MIAHMEATGCDVNIVPYNVLIDGLCKKQKVWEAVGIKKDLAGKDLKPDVVTYCTLVYGLC 308

Query:   299 RNGRLYEAFHLKEKMVLREVEPSLITYSILINGLIKLEKFDDANFVLKEMSVRGFVPNYV 358
             +         + ++M+     PS    S L+ GL K  K ++A  ++K +   G  PN  
Sbjct:   309 KVQEFEIGLEMMDEMLCLRFSPSEAAVSSLVEGLRKRGKIEEALNLVKRVVDFGVSPNLF 368

Query:   359 VYNTLIDGYCKKGNISEALKIRDDMVSKGMSPNSVTFNSLIHGFCKSGQMDNAENALEEM 418
             VYN LID  CK     EA  + D M   G+ PN VT++ LI  FC+ G++D A + L EM
Sbjct:   369 VYNALIDSLCKGRKFHEAELLFDRMGKIGLRPNDVTYSILIDMFCRRGKLDTALSFLGEM 428

Query:   419 LSRGLSINQGAYTSVIKWLCINSRFNSALHFTKEMLLRNLRPGDGLLTLLVSGLCKNGKQ 478
             +  GL ++   Y S+I   C     ++A  F  EM+ + L P     T L+ G C  GK 
Sbjct:   429 VDTGLKLSVYPYNSLINGHCKFGDISAAEGFMAEMINKKLEPTVVTYTSLMGGYCSKGKI 488

Query:   479 AEATELCFRLFEKGFTVNTVTSNALIHGMCEAGNLKEAGKLLMEMLQRGLILDKVTYNTL 538
              +A  L   +  KG   +  T   L+ G+  AG +++A KL  EM +  +  ++VTYN +
Sbjct:   489 NKALRLYHEMTGKGIAPSIYTFTTLLSGLFRAGLIRDAVKLFNEMAEWNVKPNRVTYNVM 548

Query:   539 ILGCCKDGKPEEGFKLKEDMIKRGIQPDNYTYNLLLHGLCSLGKMEEAIELWEECKRTVF 598
             I G C++G   + F+  ++M ++GI PD Y+Y  L+HGLC  G+  EA    +   +   
Sbjct:   549 IEGYCEEGDMSKAFEFLKEMTEKGIVPDTYSYRPLIHGLCLTGQASEAKVFVDGLHKGNC 608

Query:   599 GPDIYTYGVMIDGFCKADKIEEGETLFNEMISKKMELNPVVYNTLIRAYCKIGNTTAAFR 658
               +   Y  ++ GFC+  K+EE  ++  EM+ + ++L+ V Y  LI    K  +    F 
Sbjct:   609 ELNEICYTGLLHGFCREGKLEEALSVCQEMVQRGVDLDLVCYGVLIDGSLKHKDRKLFFG 668

Query:   659 LSNDMKSRGILPTSVTYSSLIHGLCNIGLIEDAKCLFDEMRKEGLLPNVACYTALIGGYC 718
             L  +M  RG+ P  V Y+S+I      G  ++A  ++D M  EG +PN   YTA+I G C
Sbjct:   669 LLKEMHDRGLKPDDVIYTSMIDAKSKTGDFKEAFGIWDLMINEGCVPNEVTYTAVINGLC 728

Query:   719 KLGQMDEAESVLQEMASINIHPNKITYTIMIGGYCKLG--DMKEAAKLLNVMAEKGISPD 776
             K G ++EAE +  +M  ++  PN++TY   +    K G  DM++A +L N +  KG+  +
Sbjct:   729 KAGFVNEAEVLCSKMQPVSSVPNQVTYGCFLDILTK-GEVDMQKAVELHNAIL-KGLLAN 786

Query:   777 SITYNVFMDGHCKGGNVEEAFKVCDRMLSEGLSLDEITYTTLID 820
             + TYN+ + G C+ G +EEA ++  RM+ +G+S D ITYTT+I+
Sbjct:   787 TATYNMLIRGFCRQGRIEEASELITRMIGDGVSPDCITYTTMIN 830


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2155730 AT5G65560 "AT5G65560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077061 AT3G22470 "AT3G22470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034760 AT1G12300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195047 AT1G12620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023134 AT1G12775 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026192 RPF2 "rna processing factor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015494 RPF3 "RNA processing factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083976 MEE40 "maternal effect embryo arrest 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q940A6PP325_ARATHNo assigned EC number0.54110.96630.9606yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00001217001
SubName- Full=Chromosome chr2 scaffold_113, whole genome shotgun sequence; (893 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query833
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-29
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-28
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-28
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-22
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-22
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-20
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-20
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-19
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-19
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-19
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-18
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-18
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-16
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-15
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-15
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-15
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-12
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-10
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-10
pfam1285434 pfam12854, PPR_1, PPR repeat 4e-10
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 7e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-08
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-08
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-08
pfam1285434 pfam12854, PPR_1, PPR repeat 6e-08
pfam1285434 pfam12854, PPR_1, PPR repeat 9e-08
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-07
pfam0153531 pfam01535, PPR, PPR repeat 4e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 8e-07
pfam0153531 pfam01535, PPR, PPR repeat 1e-06
pfam0153531 pfam01535, PPR, PPR repeat 1e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-06
pfam0153531 pfam01535, PPR, PPR repeat 2e-06
pfam0153531 pfam01535, PPR, PPR repeat 3e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 4e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 9e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-05
pfam0153531 pfam01535, PPR, PPR repeat 2e-05
pfam0153531 pfam01535, PPR, PPR repeat 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-05
pfam0153531 pfam01535, PPR, PPR repeat 3e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 3e-05
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 8e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 1e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 3e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 4e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 4e-04
pfam0153531 pfam01535, PPR, PPR repeat 5e-04
pfam0153531 pfam01535, PPR, PPR repeat 5e-04
pfam0153531 pfam01535, PPR, PPR repeat 5e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 6e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 8e-04
pfam0153531 pfam01535, PPR, PPR repeat 8e-04
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 0.001
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.001
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.001
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.001
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 0.002
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.002
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.003
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.004
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  126 bits (317), Expect = 1e-29
 Identities = 123/594 (20%), Positives = 226/594 (38%), Gaps = 79/594 (13%)

Query: 256 STAINAFCKRGRIEDAIGLFTKMEELGIAPNVVTYNNIIHGLCRNGRLYEAFHLKEKMVL 315
           ++ + A C  G++E A+ L   M+EL +  +   Y  +   LC   R  E        V 
Sbjct: 55  NSQLRALCSHGQLEQALKLLESMQELRVPVDEDAYVALFR-LCEWKRAVEE----GSRVC 109

Query: 316 REVEPSLITYSI-----LINGLIKLEKFDDANFVLKEMSVRGFVPNYVVYNTLIDGYCKK 370
                S  +  +     +++  ++  +   A +V  +M  R    +   +N L+ GY K 
Sbjct: 110 SRALSSHPSLGVRLGNAMLSMFVRFGELVHAWYVFGKMPER----DLFSWNVLVGGYAKA 165

Query: 371 GNISEALKIRDDMVSKGMSPNSVTF----------------------------------- 395
           G   EAL +   M+  G+ P+  TF                                   
Sbjct: 166 GYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVV 225

Query: 396 NSLIHGFCKSGQMDNAENALEEMLSRGLSINQGAYTSVIKWLCINSRFNSALHFTKEMLL 455
           N+LI  + K G + +A    + M  R    +  ++ ++I     N      L     M  
Sbjct: 226 NALITMYVKCGDVVSARLVFDRMPRR----DCISWNAMISGYFENGECLEGLELFFTMRE 281

Query: 456 RNLRPGDGLLTLLVSGLCKNGKQAEATELCFRLFEKGFTVNTVTSNALIHGMCEAGNLKE 515
            ++ P    +T ++S     G +    E+   + + GF V+    N+LI      G+  E
Sbjct: 282 LSVDPDLMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGE 341

Query: 516 AGKLLMEMLQRGLILDKVTYNTLILGCCKDGKPEEGFKLKEDMIKRGIQPDNYTYNLLLH 575
           A K+   M  +    D V++  +I G  K+G P++  +    M +  + PD  T   +L 
Sbjct: 342 AEKVFSRMETK----DAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLS 397

Query: 576 GLCSLGKMEEAIELWEECKRTVFGPDIYTYGVMIDGFCKADKIEEGETLFNEMISKKMEL 635
               LG ++  ++L E  +R      +     +I+ + K   I++   +F+ +  K    
Sbjct: 398 ACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEK---- 453

Query: 636 NPVVYNTLIRAYCKIGNTTAAFRLSNDMKSRGILPTSVTYSSLIHGLCNIGLIEDAK--- 692
           + + + ++I           A      M    + P SVT  + +     IG +   K   
Sbjct: 454 DVISWTSIIAGLRLNNRCFEALIFFRQMLLT-LKPNSVTLIAALSACARIGALMCGKEIH 512

Query: 693 --CLFDEMRKEGLLPNVACYTALIGGYCKLGQMDEAESVLQEMASINIHPNKIT-YTIMI 749
              L   +  +G LPN     AL+  Y + G+M+ A          N H   +  + I++
Sbjct: 513 AHVLRTGIGFDGFLPN-----ALLDLYVRCGRMNYA------WNQFNSHEKDVVSWNILL 561

Query: 750 GGYCKLGDMKEAAKLLNVMAEKGISPDSITYNVFMDGHCKGGNVEEAFKVCDRM 803
            GY   G    A +L N M E G++PD +T+   +    + G V +  +    M
Sbjct: 562 TGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSM 615


Length = 857

>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 833
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.96
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.93
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.93
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.92
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.92
PRK11788389 tetratricopeptide repeat protein; Provisional 99.89
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.88
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.88
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.86
KOG2076895 consensus RNA polymerase III transcription factor 99.86
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.86
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.85
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.84
PRK14574 822 hmsH outer membrane protein; Provisional 99.83
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.83
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.82
PRK14574 822 hmsH outer membrane protein; Provisional 99.81
KOG2076 895 consensus RNA polymerase III transcription factor 99.81
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.79
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.78
KOG1915677 consensus Cell cycle control protein (crooked neck 99.74
KOG2003840 consensus TPR repeat-containing protein [General f 99.73
KOG2003840 consensus TPR repeat-containing protein [General f 99.73
KOG1915677 consensus Cell cycle control protein (crooked neck 99.7
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.64
KOG0547606 consensus Translocase of outer mitochondrial membr 99.63
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.6
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.58
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.58
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.58
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.57
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.57
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.56
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.55
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.54
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.54
KOG0547606 consensus Translocase of outer mitochondrial membr 99.53
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.53
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.53
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.52
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.51
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.51
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.47
KOG1126638 consensus DNA-binding cell division cycle control 99.46
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.46
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.44
KOG1126638 consensus DNA-binding cell division cycle control 99.44
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.43
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.43
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.43
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.43
KOG2376652 consensus Signal recognition particle, subunit Srp 99.4
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.39
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.38
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.36
KOG2376652 consensus Signal recognition particle, subunit Srp 99.36
PRK12370553 invasion protein regulator; Provisional 99.35
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.31
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.3
PF1304150 PPR_2: PPR repeat family 99.3
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.29
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.28
PF1304150 PPR_2: PPR repeat family 99.28
PRK12370553 invasion protein regulator; Provisional 99.28
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.25
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.25
KOG1129478 consensus TPR repeat-containing protein [General f 99.24
KOG1129478 consensus TPR repeat-containing protein [General f 99.24
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.22
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.22
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.22
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.18
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.18
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.16
PRK11189296 lipoprotein NlpI; Provisional 99.12
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.1
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.09
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.06
PRK11189296 lipoprotein NlpI; Provisional 99.05
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.04
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.0
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.99
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.99
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.97
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.94
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.94
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.92
PRK04841903 transcriptional regulator MalT; Provisional 98.89
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.86
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.85
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.8
PRK04841903 transcriptional regulator MalT; Provisional 98.78
PF1285434 PPR_1: PPR repeat 98.77
KOG1125579 consensus TPR repeat-containing protein [General f 98.76
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.73
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.7
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.68
PF1285434 PPR_1: PPR repeat 98.68
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.68
KOG1125579 consensus TPR repeat-containing protein [General f 98.66
PLN02789320 farnesyltranstransferase 98.61
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.56
PLN02789320 farnesyltranstransferase 98.56
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.55
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.48
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.46
PRK10370198 formate-dependent nitrite reductase complex subuni 98.46
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.44
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.4
KOG1128777 consensus Uncharacterized conserved protein, conta 98.4
PRK15359144 type III secretion system chaperone protein SscB; 98.39
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.38
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.38
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.36
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.35
PRK10370198 formate-dependent nitrite reductase complex subuni 98.3
PRK15359144 type III secretion system chaperone protein SscB; 98.28
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.27
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.26
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.24
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.24
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.24
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.17
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.17
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.15
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.1
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.99
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.96
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.94
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.93
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.88
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.87
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.79
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.78
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.75
KOG20411189 consensus WD40 repeat protein [General function pr 97.71
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.71
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.7
KOG0553304 consensus TPR repeat-containing protein [General f 97.68
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.65
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.65
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.64
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.63
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.63
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.59
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.56
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.56
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 97.56
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.54
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.52
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.51
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.47
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.44
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.41
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.4
KOG0553304 consensus TPR repeat-containing protein [General f 97.39
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.39
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.39
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.39
COG4700251 Uncharacterized protein conserved in bacteria cont 97.39
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.37
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.37
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.36
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.33
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.33
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.33
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.31
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.3
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.29
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.29
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.28
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.23
KOG20411189 consensus WD40 repeat protein [General function pr 97.21
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.16
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.14
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.14
COG4700251 Uncharacterized protein conserved in bacteria cont 97.08
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.07
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.07
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.03
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.03
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.01
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.01
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.01
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.99
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.99
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.99
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.97
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.93
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.92
COG3898 531 Uncharacterized membrane-bound protein [Function u 96.91
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.86
PF12688120 TPR_5: Tetratrico peptide repeat 96.82
PF12688120 TPR_5: Tetratrico peptide repeat 96.78
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.74
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.65
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.59
PRK10803263 tol-pal system protein YbgF; Provisional 96.53
PRK15331165 chaperone protein SicA; Provisional 96.47
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.44
PRK10803263 tol-pal system protein YbgF; Provisional 96.25
PF1337173 TPR_9: Tetratricopeptide repeat 96.22
PF1337173 TPR_9: Tetratricopeptide repeat 96.22
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.22
COG3898531 Uncharacterized membrane-bound protein [Function u 96.21
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.21
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.13
PRK15331165 chaperone protein SicA; Provisional 96.11
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.0
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.99
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.95
KOG1258577 consensus mRNA processing protein [RNA processing 95.9
PRK11906458 transcriptional regulator; Provisional 95.85
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.78
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 95.78
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.73
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.71
KOG1258577 consensus mRNA processing protein [RNA processing 95.62
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.46
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.45
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.44
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.27
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 95.16
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.13
KOG4555175 consensus TPR repeat-containing protein [Function 95.01
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.99
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.95
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.95
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.79
KOG4555175 consensus TPR repeat-containing protein [Function 94.72
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.62
smart00299140 CLH Clathrin heavy chain repeat homology. 94.53
KOG1585308 consensus Protein required for fusion of vesicles 94.49
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.43
KOG1585308 consensus Protein required for fusion of vesicles 94.43
PRK11906458 transcriptional regulator; Provisional 94.4
KOG3941406 consensus Intermediate in Toll signal transduction 94.37
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.34
KOG1550552 consensus Extracellular protein SEL-1 and related 94.29
PF13512142 TPR_18: Tetratricopeptide repeat 94.21
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 94.07
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 94.04
smart00299140 CLH Clathrin heavy chain repeat homology. 94.02
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 93.94
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 93.92
COG4105254 ComL DNA uptake lipoprotein [General function pred 93.88
KOG2610 491 consensus Uncharacterized conserved protein [Funct 93.87
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.84
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.82
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.8
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.78
COG4105254 ComL DNA uptake lipoprotein [General function pred 93.74
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.62
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.52
COG3629280 DnrI DNA-binding transcriptional activator of the 93.25
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.16
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.01
KOG1550552 consensus Extracellular protein SEL-1 and related 92.94
KOG3941 406 consensus Intermediate in Toll signal transduction 92.45
KOG1941 518 consensus Acetylcholine receptor-associated protei 92.26
KOG2062 929 consensus 26S proteasome regulatory complex, subun 92.07
PF1342844 TPR_14: Tetratricopeptide repeat 91.66
PF1342844 TPR_14: Tetratricopeptide repeat 91.56
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 91.11
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 91.06
PF13512142 TPR_18: Tetratricopeptide repeat 90.88
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 90.49
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 90.45
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.45
COG3629280 DnrI DNA-binding transcriptional activator of the 90.27
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 90.25
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.17
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 89.88
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 89.7
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 89.64
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.28
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 89.28
PF13170297 DUF4003: Protein of unknown function (DUF4003) 89.05
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 88.69
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 88.44
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 88.33
COG4649221 Uncharacterized protein conserved in bacteria [Fun 88.32
KOG1941 518 consensus Acetylcholine receptor-associated protei 88.29
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 88.29
PF1343134 TPR_17: Tetratricopeptide repeat 88.18
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 87.94
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 87.56
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 87.39
COG1747 711 Uncharacterized N-terminal domain of the transcrip 87.38
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 87.03
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 86.84
PF13170297 DUF4003: Protein of unknown function (DUF4003) 86.81
PF1343134 TPR_17: Tetratricopeptide repeat 86.46
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 86.44
KOG4648 536 consensus Uncharacterized conserved protein, conta 85.91
PRK09687280 putative lyase; Provisional 85.87
KOG4234271 consensus TPR repeat-containing protein [General f 85.33
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 85.12
COG2976207 Uncharacterized protein conserved in bacteria [Fun 84.65
COG2976207 Uncharacterized protein conserved in bacteria [Fun 84.4
KOG4570 418 consensus Uncharacterized conserved protein [Funct 84.3
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 84.28
KOG4648 536 consensus Uncharacterized conserved protein, conta 84.27
PF06552186 TOM20_plant: Plant specific mitochondrial import r 84.03
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 84.02
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 83.44
KOG4234271 consensus TPR repeat-containing protein [General f 83.19
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 83.12
COG1747 711 Uncharacterized N-terminal domain of the transcrip 82.94
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 82.01
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 81.67
PF06552186 TOM20_plant: Plant specific mitochondrial import r 80.85
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 80.76
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 80.42
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 80.32
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.6e-87  Score=791.98  Aligned_cols=680  Identities=19%  Similarity=0.270  Sum_probs=638.8

Q ss_pred             CCChhhHHHHHHhhhcCCChHHHHHHHHhhhhcCCCCCCHHHHHHHHHHHHhCCCchhHHHHHHHHHcCCCCccccCCCc
Q 003295           78 NLSPQEFDTLFFSIRSNVNPKTALKFFYFASQSCNFRFTVRSYCLLIRLLLFSNLLSPARLLLIRLIDGKMPVLYASNPS  157 (833)
Q Consensus        78 ~l~~~~~~~~~~~~~~~~~~~~a~~ff~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~  157 (833)
                      ..+++....++..+...+.+..|+.+|..+.. .++.++..+|..+++.+.+.+.+..|..++.++++.+.         
T Consensus        48 ~~~~~~~n~~i~~l~~~g~~~~A~~l~~~m~~-~g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~---------  117 (857)
T PLN03077         48 SSSTHDSNSQLRALCSHGQLEQALKLLESMQE-LRVPVDEDAYVALFRLCEWKRAVEEGSRVCSRALSSHP---------  117 (857)
T ss_pred             ccchhhHHHHHHHHHhCCCHHHHHHHHHHHHh-cCCCCChhHHHHHHHHHhhCCCHHHHHHHHHHHHHcCC---------
Confidence            33445556666667777889999999998865 36778889999999999999999999999999887651         


Q ss_pred             chHHHHHHHHhhhhcccCCcchhhhHHHHHHHHHHhhhccCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCChhHH
Q 003295          158 IRHIEIASQMVDLNVTSEPALGVQIADLLVHVYCTQFKNLGFGYAIDVFSIFSSKGIFPSLKTCNFLLNSLVKANEVQKG  237 (833)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~A~~~f~~~~~~~~~p~~~~~~~ll~~~~~~g~~~~A  237 (833)
                                         .......+.|+..|+   +.|+++.|.++|+.|.+    ||+++||.+|.+|++.|++++|
T Consensus       118 -------------------~~~~~~~n~li~~~~---~~g~~~~A~~~f~~m~~----~d~~~~n~li~~~~~~g~~~~A  171 (857)
T PLN03077        118 -------------------SLGVRLGNAMLSMFV---RFGELVHAWYVFGKMPE----RDLFSWNVLVGGYAKAGYFDEA  171 (857)
T ss_pred             -------------------CCCchHHHHHHHHHH---hCCChHHHHHHHhcCCC----CCeeEHHHHHHHHHhCCCHHHH
Confidence                               123345788899888   78999999999999964    6899999999999999999999


Q ss_pred             HHHHHHhh-cCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHcCCCCChhhHHHHHHHHHhcCChhHHHHHHHHHHhC
Q 003295          238 IEVFETMC-RGVSPDVFLFSTAINAFCKRGRIEDAIGLFTKMEELGIAPNVVTYNNIIHGLCRNGRLYEAFHLKEKMVLR  316 (833)
Q Consensus       238 ~~~~~~~~-~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~  316 (833)
                      +.+|++|. .|+.||.+||+.++++|++.++++.+.+++..|.+.|+.||+.+||+||.+|++.|++++|.++|++|.  
T Consensus       172 ~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~--  249 (857)
T PLN03077        172 LCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMP--  249 (857)
T ss_pred             HHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHcCCCcccchHhHHHHHHhcCCCHHHHHHHHhcCC--
Confidence            99999999 799999999999999999999999999999999999999999999999999999999999999999997  


Q ss_pred             CCCCChhhHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCChhhHHHHHHHHHHcCChHHHHHHHHHHHhCCCCCChhHHH
Q 003295          317 EVEPSLITYSILINGLIKLEKFDDANFVLKEMSVRGFVPNYVVYNTLIDGYCKKGNISEALKIRDDMVSKGMSPNSVTFN  396 (833)
Q Consensus       317 ~~~p~~~t~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~y~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~  396 (833)
                        .||.++||++|.+|++.|++++|.++|++|.+.|+.||..||+.++.++++.|+++.|.+++..|.+.|+.||..+|+
T Consensus       250 --~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~d~~~~n  327 (857)
T PLN03077        250 --RRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCN  327 (857)
T ss_pred             --CCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHhCCccchHHHH
Confidence              479999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcCChhHHHHHHHHHHHCCCCCCcccHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCChhhHHHHHHHHHhcC
Q 003295          397 SLIHGFCKSGQMDNAENALEEMLSRGLSINQGAYTSVIKWLCINSRFNSALHFTKEMLLRNLRPGDGLLTLLVSGLCKNG  476 (833)
Q Consensus       397 ~li~~~~~~g~~~~A~~~l~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g  476 (833)
                      +||.+|++.|++++|.++|++|.    .||..+|+.++.+|++.|++++|+++|++|...|+.||..+|+.++.+|++.|
T Consensus       328 ~Li~~y~k~g~~~~A~~vf~~m~----~~d~~s~n~li~~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g  403 (857)
T PLN03077        328 SLIQMYLSLGSWGEAEKVFSRME----TKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLG  403 (857)
T ss_pred             HHHHHHHhcCCHHHHHHHHhhCC----CCCeeeHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhccc
Confidence            99999999999999999999996    46899999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHhhCCCCCCHHHHHHHHHHHHhcCChhhHHHHHH
Q 003295          477 KQAEATELCFRLFEKGFTVNTVTSNALIHGMCEAGNLKEAGKLLMEMLQRGLILDKVTYNTLILGCCKDGKPEEGFKLKE  556 (833)
Q Consensus       477 ~~~~A~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~l~~m~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~  556 (833)
                      ++++|.++++.+.+.|+.++..+||.|+++|++.|++++|.++|++|.+.    |..+|+++|.+|++.|+.++|+.+|+
T Consensus       404 ~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~----d~vs~~~mi~~~~~~g~~~eA~~lf~  479 (857)
T PLN03077        404 DLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEK----DVISWTSIIAGLRLNNRCFEALIFFR  479 (857)
T ss_pred             hHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCCC----CeeeHHHHHHHHHHCCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999764    88999999999999999999999999


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHhhCCCCCCHhhHHHHHHHHHccCCHHHHHHHHHHHHHCCCccC
Q 003295          557 DMIKRGIQPDNYTYNLLLHGLCSLGKMEEAIELWEECKRTVFGPDIYTYGVMIDGFCKADKIEEGETLFNEMISKKMELN  636 (833)
Q Consensus       557 ~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~  636 (833)
                      +|.. ++.||..||+.++.+|++.|+.+.+.+++..+.+.|+.+|..++++|+++|++.|++++|.++|+++     .+|
T Consensus       480 ~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-----~~d  553 (857)
T PLN03077        480 QMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSH-----EKD  553 (857)
T ss_pred             HHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHHHHHHHHcCCHHHHHHHHHhc-----CCC
Confidence            9986 5999999999999999999999999999999999999999999999999999999999999999987     569


Q ss_pred             HHHHHHHHHHHHHcCChHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHH-HCCCCCChhHHHHHHH
Q 003295          637 PVVYNTLIRAYCKIGNTTAAFRLSNDMKSRGILPTSVTYSSLIHGLCNIGLIEDAKCLFDEMR-KEGLLPNVACYTALIG  715 (833)
Q Consensus       637 ~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~-~~g~~p~~~~~~~li~  715 (833)
                      ..+||++|.+|++.|+.++|+++|++|.+.|+.||..||+.++.+|++.|.+++|.++|++|. +.|+.|+..+|+++++
T Consensus       554 ~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~  633 (857)
T PLN03077        554 VVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVD  633 (857)
T ss_pred             hhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999999 5699999999999999


Q ss_pred             HHHhcCChhHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCC-CHHHHHHHHHHHhcCCCHH
Q 003295          716 GYCKLGQMDEAESVLQEMASINIHPNKITYTIMIGGYCKLGDMKEAAKLLNVMAEKGISP-DSITYNVFMDGHCKGGNVE  794 (833)
Q Consensus       716 ~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p-~~~~~~~l~~~~~~~g~~~  794 (833)
                      +|++.|++++|.+++++|.   +.||..+|++|+.+|..+|+.+.|....+++.+  +.| +...|..|.+.|...|+|+
T Consensus       634 ~l~r~G~~~eA~~~~~~m~---~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l~~--l~p~~~~~y~ll~n~ya~~g~~~  708 (857)
T PLN03077        634 LLGRAGKLTEAYNFINKMP---ITPDPAVWGALLNACRIHRHVELGELAAQHIFE--LDPNSVGYYILLCNLYADAGKWD  708 (857)
T ss_pred             HHHhCCCHHHHHHHHHHCC---CCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHh--hCCCCcchHHHHHHHHHHCCChH
Confidence            9999999999999999985   799999999999999999999999999999988  456 5677888899999999999


Q ss_pred             HHHHHHHHHHHCCCCCCH-HHHH
Q 003295          795 EAFKVCDRMLSEGLSLDE-ITYT  816 (833)
Q Consensus       795 ~A~~~~~~m~~~g~~p~~-~~~~  816 (833)
                      +|.++.+.|.+.|++++. .+|.
T Consensus       709 ~a~~vr~~M~~~g~~k~~g~s~i  731 (857)
T PLN03077        709 EVARVRKTMRENGLTVDPGCSWV  731 (857)
T ss_pred             HHHHHHHHHHHcCCCCCCCccEE
Confidence            999999999999999884 3443



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query833
4g24_A 501 Crystal Structure Of Proteinaceous Rnase P 1 (Prorp 6e-04
>pdb|4G24|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From A. Thaliana With Mn Length = 501 Back     alignment and structure

Iteration: 1

Score = 43.1 bits (100), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 45/207 (21%), Positives = 77/207 (37%), Gaps = 26/207 (12%) Query: 542 CCKDGKPEEGFKLKEDMIKRGIQPDNYTYNLLLHGLCSLGKMEEAIELWEECKRTVFGPD 601 C K G E +L ++ + G+Q Y YN+LL+ +CSL E + P Sbjct: 36 CSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLY-VCSLA---------EAATESSPNPG 85 Query: 602 IYTYGVMIDGFCKADKIEEGETLFNEMISKKMELNPVVYNTLIRAYCKIGNTTAAFRLSN 661 + G +F +MI K+ N + R + AF + Sbjct: 86 L----------------SRGFDIFKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVK 129 Query: 662 DMKSRGILPTSVTYSSLIHGLCNIGLIEDAKCLFDEMRKEGLLPNVACYTALIGGYCKLG 721 MK+ GI P +Y + G C G + A + M + ++P AL+ Sbjct: 130 QMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVESEVVPEEPELAALLKVSMDTK 189 Query: 722 QMDEAESVLQEMASINIHPNKITYTIM 748 D+ LQ + + +K T+ ++ Sbjct: 190 NADKVYKTLQRLRDLVRQVSKSTFDMI 216

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query833
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-19
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-19
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-18
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-17
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-16
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-16
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-15
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-15
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-14
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-13
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 8e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-06
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-07
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 7e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-05
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-04
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-05
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 8e-05
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 92.6 bits (228), Expect = 2e-19
 Identities = 25/177 (14%), Positives = 52/177 (29%), Gaps = 4/177 (2%)

Query: 512 NLKEAGKLLMEMLQRGLILDKVTYNTLILGCCKDGKPEEGFKL---KEDMIKRGIQPDNY 568
           +L        +  Q  L   +         C    +      L        ++       
Sbjct: 107 SLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLD 166

Query: 569 TYNLLLHGLCSLGKMEEAIELWEECKRTVFGPDIYTYGVMIDGFCKADKIEEG-ETLFNE 627
            YN ++ G    G  +E + +    K     PD+ +Y   +    + D+     E    +
Sbjct: 167 MYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQ 226

Query: 628 MISKKMELNPVVYNTLIRAYCKIGNTTAAFRLSNDMKSRGILPTSVTYSSLIHGLCN 684
           M  + ++L  +    L+    +     A  ++         LP  V  S L+  +  
Sbjct: 227 MSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYA 283


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query833
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.93
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.93
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.91
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.9
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.86
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.85
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.85
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.84
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.83
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.82
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.82
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.82
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.82
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.79
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.78
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.77
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.77
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.77
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.76
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.75
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.74
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.73
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.73
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.72
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.71
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.7
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.64
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.63
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.62
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.6
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.59
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.59
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.57
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.56
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.55
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.54
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.54
3u4t_A272 TPR repeat-containing protein; structural genomics 99.54
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.54
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.54
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.53
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.52
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.52
3u4t_A272 TPR repeat-containing protein; structural genomics 99.52
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.52
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.51
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.51
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.49
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.46
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.43
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.43
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.43
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.41
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.41
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.4
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.39
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.38
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.37
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.36
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.36
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.35
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.35
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.29
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.27
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.26
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.25
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.24
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.23
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.23
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.22
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.2
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.19
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.18
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.13
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.09
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.09
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.08
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.02
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.0
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.0
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.98
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.98
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.98
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.95
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.94
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.92
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.92
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.91
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.9
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.89
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.87
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.87
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.85
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.84
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.83
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.81
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.8
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.8
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.8
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.77
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.76
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.75
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.71
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 98.7
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.69
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.67
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.64
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.63
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.61
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.61
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.6
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.58
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.57
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.57
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.57
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.57
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.55
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.53
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.52
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.51
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.5
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.47
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.47
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.46
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.46
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.46
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.45
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.45
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.44
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.41
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.41
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.4
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.4
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.4
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.4
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.4
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.39
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.37
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.35
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.33
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.33
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.27
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.26
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.25
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.24
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.24
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.21
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.21
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.21
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.16
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.16
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.15
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.15
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.15
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.12
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.12
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.12
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.1
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.1
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.09
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.08
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.04
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.98
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.95
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.95
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.93
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.93
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.91
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.9
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.9
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.87
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.86
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.84
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.83
3k9i_A117 BH0479 protein; putative protein binding protein, 97.83
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.81
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.8
3k9i_A117 BH0479 protein; putative protein binding protein, 97.79
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.78
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.78
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.74
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.68
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.63
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.61
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.55
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.53
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.52
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.48
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.48
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.44
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.44
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.34
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.33
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.3
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.89
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.78
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.59
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.46
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.4
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.36
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.27
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.24
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.22
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.21
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.16
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.13
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.13
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.05
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.03
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.84
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.63
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.3
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.18
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.18
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.03
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.47
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.34
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.19
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.16
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.09
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.05
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.04
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.84
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 92.38
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 90.94
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 90.33
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 89.94
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.39
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 89.3
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 88.8
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 88.47
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 87.91
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 87.88
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 87.34
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 85.95
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 85.5
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 84.83
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 84.5
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 84.46
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 83.13
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 82.47
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 82.21
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 81.44
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 80.45
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=6.6e-41  Score=386.01  Aligned_cols=525  Identities=12%  Similarity=-0.023  Sum_probs=344.2

Q ss_pred             HHhcCChhHHHHHHHHhhcCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHcCCCCChhhHHHHHHHHHhcCChhHHH
Q 003295          228 LVKANEVQKGIEVFETMCRGVSPDVFLFSTAINAFCKRGRIEDAIGLFTKMEELGIAPNVVTYNNIIHGLCRNGRLYEAF  307 (833)
Q Consensus       228 ~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~  307 (833)
                      ..+.|.+..+...+..+   ..++...|+.++..|.+.|++++|..+|++|.+.  .||..+++.++.+|.+.|++++|.
T Consensus        63 ~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~p~~~~~~~l~~~~~~~g~~~~A~  137 (597)
T 2xpi_A           63 TSTDGSFLKERNAQNTD---SLSREDYLRLWRHDALMQQQYKCAAFVGEKVLDI--TGNPNDAFWLAQVYCCTGDYARAK  137 (597)
T ss_dssp             ----------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--HCCHHHHHHHHHHHHHTTCHHHHH
T ss_pred             ccccCccCCCCCccccc---hHHHHHHHHHHHHHHHHccCchHHHHHHHHHHhh--CCCchHHHHHHHHHHHcCcHHHHH
Confidence            44566666666666554   2367888999999999999999999999999864  578888889999999999999999


Q ss_pred             HHHHHHHhCCCCCChhhHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCChhhHHHHHHHHHHcCChHHHHHHHHHHHhCC
Q 003295          308 HLKEKMVLREVEPSLITYSILINGLIKLEKFDDANFVLKEMSVRGFVPNYVVYNTLIDGYCKKGNISEALKIRDDMVSKG  387 (833)
Q Consensus       308 ~~~~~m~~~~~~p~~~t~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~y~~li~~~~~~g~~~~A~~~~~~m~~~g  387 (833)
                      .+|+++...  +++..+++.++.+|.+.|++++|..+|+++...     ..    ...++.+.++           ...|
T Consensus       138 ~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~-----~~----~~~~~~~~~~-----------~~~~  195 (597)
T 2xpi_A          138 CLLTKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPF-----RK----DEKNANKLLM-----------QDGG  195 (597)
T ss_dssp             HHHHHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTT-----C--------------C-----------CCSS
T ss_pred             HHHHHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCc-----cc----cccccccccc-----------cccc
Confidence            999988643  678888999999999999999999988853221     10    0001111111           1123


Q ss_pred             CCCChhHHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCcccHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCChhhHHH
Q 003295          388 MSPNSVTFNSLIHGFCKSGQMDNAENALEEMLSRGLSINQGAYTSVIKWLCINSRFNSALHFTKEMLLRNLRPGDGLLTL  467 (833)
Q Consensus       388 ~~p~~~~~~~li~~~~~~g~~~~A~~~l~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~  467 (833)
                      ..++..+|+.++.+|.+.|++++|.++|++|.+.+.. +...+..++..+...+..+.+.                    
T Consensus       196 ~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~-~~~~~~~l~~~~~~~~~~~~~~--------------------  254 (597)
T 2xpi_A          196 IKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAK-CYEAFDQLVSNHLLTADEEWDL--------------------  254 (597)
T ss_dssp             CCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHTTCSCHHHHHHH--------------------
T ss_pred             cchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCch-hhHHHHHHHHhhcccchhHHHH--------------------
Confidence            3445566666666666666666666666666654311 2222222222221111111000                    


Q ss_pred             HHHHHHhcCCHHHHHHH-HHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHhhCCCCCCHHHHHHHHHHHHhcC
Q 003295          468 LVSGLCKNGKQAEATEL-CFRLFEKGFTVNTVTSNALIHGMCEAGNLKEAGKLLMEMLQRGLILDKVTYNTLILGCCKDG  546 (833)
Q Consensus       468 li~~~~~~g~~~~A~~~-~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~l~~m~~~g~~~~~~~~~~li~~~~~~g  546 (833)
                                   +..+ +..+...+......+|+.++..|.+.|++++|.++|+++.+.  .++..+|+.++.+|.+.|
T Consensus       255 -------------~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~~~~~~~g  319 (597)
T 2xpi_A          255 -------------VLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGL--EKSSDLLLCKADTLFVRS  319 (597)
T ss_dssp             -------------HHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTG--GGCHHHHHHHHHHHHHTT
T ss_pred             -------------HHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcC--CchHHHHHHHHHHHHHhc
Confidence                         0000 122222223334455666666777777777777777777655  357777777777777777


Q ss_pred             ChhhHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHhhCCCCCCHhhHHHHHHHHHccCCHHHHHHHHH
Q 003295          547 KPEEGFKLKEDMIKRGIQPDNYTYNLLLHGLCSLGKMEEAIELWEECKRTVFGPDIYTYGVMIDGFCKADKIEEGETLFN  626 (833)
Q Consensus       547 ~~~~A~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~  626 (833)
                      ++++|.++|+++.+.+.. +..+++.++.++.+.|++++|.++++++.+.. +.+..+++.++.+|.+.|++++|.++|+
T Consensus       320 ~~~~A~~~~~~~~~~~~~-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~  397 (597)
T 2xpi_A          320 RFIDVLAITTKILEIDPY-NLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARRYFS  397 (597)
T ss_dssp             CHHHHHHHHHHHHHHCTT-CCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHcCcc-cHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHHHHH
Confidence            777777777777766533 56667777777777777777777777776542 4456777777777777777777777777


Q ss_pred             HHHHCCCccCHHHHHHHHHHHHHcCChHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCC
Q 003295          627 EMISKKMELNPVVYNTLIRAYCKIGNTTAAFRLSNDMKSRGILPTSVTYSSLIHGLCNIGLIEDAKCLFDEMRKEGLLPN  706 (833)
Q Consensus       627 ~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~  706 (833)
                      ++.+..+. +..+|+.++.+|.+.|++++|+++|+++.+.+ +.+..+|..++.+|.+.|++++|.++|+++.+.. +.+
T Consensus       398 ~~~~~~~~-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~  474 (597)
T 2xpi_A          398 KSSTMDPQ-FGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYALF-QYD  474 (597)
T ss_dssp             HHHHHCTT-CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHC-CCC
T ss_pred             HHHHhCCC-CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCC
Confidence            77765433 66777777888888888888888887777664 3466777778888888888888888888877653 346


Q ss_pred             hhHHHHHHHHHHhcCChhHHHHHHHHHHhC----CCCCC--HHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHH
Q 003295          707 VACYTALIGGYCKLGQMDEAESVLQEMASI----NIHPN--KITYTIMIGGYCKLGDMKEAAKLLNVMAEKGISPDSITY  780 (833)
Q Consensus       707 ~~~~~~li~~~~~~g~~~~A~~~~~~m~~~----g~~p~--~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~  780 (833)
                      ..+|+.++..|.+.|++++|.++|+++.+.    +..|+  ..+|..++.+|.+.|++++|.+.++++.+.+ +.+..+|
T Consensus       475 ~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p~~~~~~  553 (597)
T 2xpi_A          475 PLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLS-TNDANVH  553 (597)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHS-SCCHHHH
T ss_pred             hHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhC-CCChHHH
Confidence            777888888888888888888888877764    55666  6778888888888888888888888887753 3367778


Q ss_pred             HHHHHHHhcCCCHHHHHHHHHHHHHCCCCCC-HHHHHHHHHhhc
Q 003295          781 NVFMDGHCKGGNVEEAFKVCDRMLSEGLSLD-EITYTTLIDGWQ  823 (833)
Q Consensus       781 ~~l~~~~~~~g~~~~A~~~~~~m~~~g~~p~-~~~~~~l~~~~~  823 (833)
                      ..++.+|.+.|++++|.++++++++  +.|+ ...|..+-..|.
T Consensus       554 ~~l~~~~~~~g~~~~A~~~~~~~l~--~~p~~~~~~~~l~~~~~  595 (597)
T 2xpi_A          554 TAIALVYLHKKIPGLAITHLHESLA--ISPNEIMASDLLKRALE  595 (597)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHHHHHH--HCTTCHHHHHHHHHTTC
T ss_pred             HHHHHHHHHhCCHHHHHHHHHHHHh--cCCCChHHHHHHHHHHh
Confidence            8888888888888888888888877  4555 556665555543



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 833
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-10
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-05
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 0.004
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 60.1 bits (144), Expect = 4e-10
 Identities = 53/395 (13%), Positives = 118/395 (29%), Gaps = 19/395 (4%)

Query: 367 YCKKGNISEALKIRDDMVSKGMSPNSV-TFNSLIHGFCKSGQMDNAENALEEMLSRGLSI 425
             + G+   A +    +  +   P++      L     +  ++D + +     + +   +
Sbjct: 9   EYQAGDFEAAERHCMQLWRQ--EPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-PL 65

Query: 426 NQGAYTSVIKWLCINSRFNSALHFTKEMLLRNLRPGDGLLTLLVSGLCKNGKQAEATELC 485
              AY+++        +   A+   +  L       DG + L  + +     +       
Sbjct: 66  LAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYV 125

Query: 486 FRLFEKGFTVNTVTSNALIHGMCEAGNLKEAGKLLMEMLQRGLILDKVTYNTLILGCCKD 545
             L          +    +          +A  L     Q       V ++ L       
Sbjct: 126 SALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPN---FAVAWSNLGCVFNAQ 182

Query: 546 GKPEEGFKLKEDMIKRGIQPDNY-TYNLLLHGLCSLGKMEEAIELWEECKRTVFGPDIYT 604
           G+        E  +   + P+    Y  L + L      + A+  +      +       
Sbjct: 183 GEIWLAIHHFEKAVT--LDPNFLDAYINLGNVLKEARIFDRAVAAYLRALS-LSPNHAVV 239

Query: 605 YGVMIDGFCKADKIEEGETLFNEMISKKMELNPVVYNTLIRAYCKIGNTTAAFRLSNDMK 664
           +G +   + +   I+     +   I  +    P  Y  L  A  + G+   A    N   
Sbjct: 240 HGNLACVYYEQGLIDLAIDTYRRAIELQPH-FPDAYCNLANALKEKGSVAEAEDCYNTAL 298

Query: 665 SRGILPTSVTYSSLIHGLCNIGLIEDAKCLFDEMRKEGLLPNVA-CYTALIGGYCKLGQM 723
                      + L +     G IE+A  L+ +  +  + P  A  ++ L     + G++
Sbjct: 299 RLCPTHADSLNN-LANIKREQGNIEEAVRLYRKALE--VFPEFAAAHSNLASVLQQQGKL 355

Query: 724 DEAESVLQEMASINIHPNKITYTIMIGG-YCKLGD 757
            EA    +E  +I I P        +G    ++ D
Sbjct: 356 QEALMHYKE--AIRISPTFADAYSNMGNTLKEMQD 388


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query833
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.91
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.54
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.52
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.16
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.12
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.1
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.09
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.05
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.03
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.0
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.96
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.91
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.91
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.54
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.49
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.48
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.44
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.4
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.39
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.39
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.35
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.31
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.31
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.23
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.2
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.17
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.14
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.02
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.02
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.98
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.96
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.94
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.84
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.75
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.73
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.73
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.7
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.69
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.68
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.66
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.6
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.59
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.51
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.46
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.44
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.38
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.35
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.25
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.14
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.9
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.84
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.62
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.16
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.08
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.79
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.48
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 92.32
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 89.72
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 85.48
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 83.14
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 81.28
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91  E-value=2.1e-20  Score=198.97  Aligned_cols=247  Identities=14%  Similarity=0.051  Sum_probs=153.3

Q ss_pred             HHHHHHhcCChhhHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHhhCCCCCCHhhHHHHHHHHHccCC
Q 003295          538 LILGCCKDGKPEEGFKLKEDMIKRGIQPDNYTYNLLLHGLCSLGKMEEAIELWEECKRTVFGPDIYTYGVMIDGFCKADK  617 (833)
Q Consensus       538 li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~  617 (833)
                      ........+....+...+......... +...+..+...+...|++++|...+++..+.. +.+...+..+...+...|+
T Consensus       141 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~  218 (388)
T d1w3ba_         141 LGNLLKALGRLEEAKACYLKAIETQPN-FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARI  218 (388)
T ss_dssp             HHHHHHTTSCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTC
T ss_pred             ccccccccchhhhhHHHHHHhhccCcc-hhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhcccc
Confidence            333444445555555555555444222 44455555555666666666666666555432 2234455566666666666


Q ss_pred             HHHHHHHHHHHHHCCCccCHHHHHHHHHHHHHcCChHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHH
Q 003295          618 IEEGETLFNEMISKKMELNPVVYNTLIRAYCKIGNTTAAFRLSNDMKSRGILPTSVTYSSLIHGLCNIGLIEDAKCLFDE  697 (833)
Q Consensus       618 ~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~  697 (833)
                      +++|...+++....... +...+..+...+.+.|++++|.+.|++..+.. +.+..++..+...+...|++++|.+.++.
T Consensus       219 ~~~A~~~~~~~~~~~~~-~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~  296 (388)
T d1w3ba_         219 FDRAVAAYLRALSLSPN-HAVVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNT  296 (388)
T ss_dssp             TTHHHHHHHHHHHHCTT-CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHH
T ss_pred             HHHHHHHHHHhHHHhhh-HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHh
Confidence            66666666666655433 55566666666667777777777777666653 33455666677777777777777777777


Q ss_pred             HHHCCCCCChhHHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCC-C
Q 003295          698 MRKEGLLPNVACYTALIGGYCKLGQMDEAESVLQEMASINIHPNKITYTIMIGGYCKLGDMKEAAKLLNVMAEKGISP-D  776 (833)
Q Consensus       698 m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p-~  776 (833)
                      ..... +.+...+..+...+.+.|++++|++.+++..+.. +.+..+|..++.+|.+.|++++|++.|+++++  +.| +
T Consensus       297 ~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~--l~P~~  372 (388)
T d1w3ba_         297 ALRLC-PTHADSLNNLANIKREQGNIEEAVRLYRKALEVF-PEFAAAHSNLASVLQQQGKLQEALMHYKEAIR--ISPTF  372 (388)
T ss_dssp             HHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSC-TTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHT--TCTTC
T ss_pred             hhccC-CccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH--hCCCC
Confidence            66642 4455666677777777777777777777776642 33456677777777777777777777777776  345 4


Q ss_pred             HHHHHHHHHHHhcCCC
Q 003295          777 SITYNVFMDGHCKGGN  792 (833)
Q Consensus       777 ~~~~~~l~~~~~~~g~  792 (833)
                      ..+|..|+.+|.+.||
T Consensus       373 ~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         373 ADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHHHcCC
Confidence            5667777777766664



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure