Citrus Sinensis ID: 003336

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------83
MVLWAGFDKLESEAGATRRVLLLGYRSGFQVWDVEEADNVHDLVSRYDGPVSFMQMLPRPITSKRSRDKFAEVRPLLVFCADGSRSCGTKVQDGLATACNGTSANYHDLGNGSSVPTVVHFYSLRSQSYVHMLKFRSPIYSVRCSSRVVAICQAAQVHCFDAATLEIEYAILTNPIVMGHPSAGGIGIGYGPLAVGPRWLAYSGSPVVVSNDGRVNPQHLMQSRSFSGFASNGSRVAHYAKESSKHLAAGIVNLGDLGYKKLSQYCSEFLPDSQNSLQSAIPGGKSNGTVNGHFPDADNVGMVIVRDIVSKNVIAQFRAHKSPISALCFDPSGILLVTASVQGHNINIFKIIPGILGTSSACDAGTSYVHLYRLQRGLTNAVIQDISFSDDSNWIMISSSRGTSHLFAINPLGGSVNFQPTDANFTTKHGAMAKSGVRWPPNLGLQMPNQQSLCASGPPVTLSVVSRIRNGNNGWRGTVSGAAAAATGRVSSLSGAIASSFHNCKGNSETYAAGSSLKIKNHLLVFSPSGCMIQYALRISTGLDVTMGVPGLGSAYDSVPEDDPRLVVEAIQKWNICQKQARREREDNIDIYGDNGTLDSNKIYPEEVKDGNFASTEANGVIEKTKVSPEDKHHLYISEAELQMHPPRIPLWAKPQSMMIKDFKMGEENFLKGEIEIERFPTRMIEARSKDLVPVFDYLQSPKFSQARVPTVGRNSNERLLHQRSGLSENGLLSRRSSSGSLDSVTVNGALAAEPNIGIEETSLDCPQMPVDTKGFVNNSVSPKTKTRHEIVNNSESLRVEAQLKFVNSKIEGLRMENHFEDEGDEFD
cEEEEEEEEEccccccccEEEEEEcccccEEEEEcccccEEEccccccccEEEEEEEEcccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEccccEEEEEEcccEEEEEEccEEEEEEcccccEEEEEEccccccccccccccccccccccccccEEEEcccccEEccccccccccccccccccccccccccEEEEEEcccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEEcccccccccccccccccEEEEEEEEcccccEEEEEEEEcccccEEEEEcccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEEEEEccccccccccccccccccccccccccEEEEEEEEEEEccccccHHcccccccccccccccccccccccccccccccccccccEEcccccccccccccccEEEEEEcccccccccccccEEEEEEccccccccccEEEEEEEccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccc
cEEEEEEccEccccccccEEEEEEEcccEEEEEEccccccEEEEEcccccEEEEEEcccccccccccccHHccccEEEEEEccccccccccccccccccccccccccccccccccccEEEEEEEccccEEEEEEccccEEEEEccccEEEEEEccEEEEEEcHHHHcEEEEEEcccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEEccccccccccccccccEEEEEEEEcccccEEEEEEEEcccccEEEEEEccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccHHEEEcccccccccccccccHHcccccccccccEEHHEccccccccccccccccccccEEEEEccccEEEEEEEcccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccEEEEEEEEEcccccccccccEEEEEEEcccccccccccEEEEEEccccEEEEcccccccHHHcccccccccccccccccccccccHccccccccccccccccccccHHHHcccccccccccccEEEccccccEcccccHHHEcccccccccccHHHEccccccccHHEHEEEccccccccHHHcccccccccc
MVLWAGfdkleseaGATRRVLLLGYRsgfqvwdveeadnvhdlvsrydgpvsfmqmlprpitskrsrdkfaevRPLLVFcadgsrscgtkvqdglatacngtsanyhdlgngssvptVVHFYSLRSQSYVHMLkfrspiysvrcsSRVVAICQAAQVHCFDAATLEIEYAILtnpivmghpsaggigigygplavgprwlaysgspvvvsndgrvnpqhlmqsrsfsgfasngsrvaHYAKESSKHLAAGIVNLGDLGYKKLSQYCSEFlpdsqnslqsaipggksngtvnghfpdadnvGMVIVRDIVSKNVIAQFrahkspisalcfdpsgILLVTASvqghninifkiipgilgtssacdagtsyVHLYRLQRGLtnaviqdisfsddsnwimisssrgtshlfainplggsvnfqptdanfttkhgamaksgvrwppnlglqmpnqqslcasgppvtLSVVSRIrngnngwrgtVSGAAAAATGRVSSLSGAIASsfhnckgnsetyaagsslkiknhllvfspsgcmIQYALRIStgldvtmgvpglgsaydsvpeddpRLVVEAIQKWNICQKQARRErednidiygdngtldsnkiypeevkdgnfasteangviektkvspedkhhLYISEAelqmhppriplwakpqsmmikDFKMGEEnflkgeieierfptrMIEArskdlvpvfdylqspkfsqarvptvgrnsnerllhqrsglsengllsrrsssgsldsvtvngalaaepnigieetsldcpqmpvdtkgfvnnsvspktktrheivnnsESLRVEAQLKFVNSKieglrmenhfedegdefd
mvlwagfdkleseagatRRVLLLGYRSGFQVWDVEEADNVHDLVsrydgpvsfmqmlprpitskrsrdkfAEVRPLLVFCADGSRSCGTKVQDGLATACNGTSANYHDLGNGSSVPTVVHFYSLRSQSYVHMLKFRSPIYSVRCSSRVVAICQAAQVHCFDAATLEIEYAILTNPIVMGHPSAGGIGIGYGPLAVGPRWLAYSGSPVVVSNDGRVNPQHLMQSRSFSGFASNGSRVAHYAKESSKHLAAGIVNLGDLGYKKLSQYCSEFLPDSQNSLQSAIPGGKSNGTVNGHFPDADNVGMVIVRDIVSKNVIAQFRAHKSPISALCFDPSGILLVTASVQGHNINIFKIIPGILGTSSACDAGTSYVHLYRLQRGLTNAVIQDISFSDDSNWIMISSSRGTSHLFAINPLGGSVNFQPTDANFTTKHGAMAKSGVRWPPNLGLQMPNQQSLCASGPPVTLSVVSRIRNGNNGWRGTVSGAAAAATGRVSSLSGAIASSFHNCKGNSETYAAGSSLKIKNHLLVFSPSGCMIQYALRISTGLDVTMGVPGLGSAYDSVPEDDPRLVVEAIQKWnicqkqarrerednidiygdngtldsnkiypEEVKDgnfasteangviektkvspedKHHLYISeaelqmhpprIPLWAKPQSMMIKDFKMGEENFLKGEIEIERFPTRMIEARSKDLVPVFDYlqspkfsqarvptvgrnsnerllhqrsglsengllsrrsssgsldsVTVNGALAAEPNIGIEETSLDCPQMPVDTKGfvnnsvspktktrheivnnseslrveaQLKFVnskieglrmenhfedegdefd
MVLWAGFDKLESEAGATRRVLLLGYRSGFQVWDVEEADNVHDLVSRYDGPVSFMQMLPRPITSKRSRDKFAEVRPLLVFCADGSRSCGTKVQDGLATACNGTSANYHDLGNGSSVPTVVHFYSLRSQSYVHMLKFRSPIYSVRCSSRVVAICQAAQVHCFDAATLEIEYAILTNPIVMGHPSAGGIGIGYGPLAVGPRWLAYSGSPVVVSNDGRVNPQHLMQSRSFSGFASNGSRVAHYAKESSKHLAAGIVNLGDLGYKKLSQYCSEFLPDSQNSLQSAIPGGKSNGTVNGHFPDADNVGMVIVRDIVSKNVIAQFRAHKSPISALCFDPSGILLVTASVQGHNINIFKIIPGILGTSSACDAGTSYVHLYRLQRGLTNAVIQDISFSDDSNWIMISSSRGTSHLFAINPLGGSVNFQPTDANFTTKHGAMAKSGVRWPPNLGLQMPNQQSLCASGPPVTLSVVSRIRNGNNGWrgtvsgaaaaatgrvssLSGAIASSFHNCKGNSETYAAGSSLKIKNHLLVFSPSGCMIQYALRISTGLDVTMGVPGLGSAYDSVPEDDPRLVVEAIQKWNICQKQARREREDNIDIYGDNGTLDSNKIYPEEVKDGNFASTEANGVIEKTKVSPEDKHHLYISEAELQMHPPRIPLWAKPQSMMIKDFKMGEENFLKGEIEIERFPTRMIEARSKDLVPVFDYLQSPKFSQARVPTVGRNSNERLLHQrsglsengllsrrsssgsldsVTVNGALAAEPNIGIEETSLDCPQMPVDTKGFVNNSVSPKTKTRHEIVNNSESLRVEAQLKFVNSKIEGLRMENHFEDEGDEFD
**LWAGFDKLESEAGATRRVLLLGYRSGFQVWDVEEADNVHDLVSRYDGPVSFMQMLP**********KFAEVRPLLVFCADGSRSCGTKVQDGLATACNGTSANYHDLGNGSSVPTVVHFYSLRSQSYVHMLKFRSPIYSVRCSSRVVAICQAAQVHCFDAATLEIEYAILTNPIVMGHPSAGGIGIGYGPLAVGPRWLAYSGSPVVVS**********************************KHLAAGIVNLGDLGYKKLSQYCSEFL*********************GHFPDADNVGMVIVRDIVSKNVIAQFRAHKSPISALCFDPSGILLVTASVQGHNINIFKIIPGILGTSSACDAGTSYVHLYRLQRGLTNAVIQDISFSDDSNWIMISSSRGTSHLFAINPLGGSVNFQPTDANFTTKH******GVRWP*************C***PPVTLSVVSRIRNGNNGWRGTVSGAAAAATGRVSSLSGAIASSFHNCKGNSETYAAGSSLKIKNHLLVFSPSGCMIQYALRISTGLDVTMGVPGLGSAYDSVPEDDPRLVVEAIQKWNICQKQA*****DNIDIYGDNGTL************************************LYISEA*L****PRIPLWAKPQSMMIKDFKMGEENFLKGEIEIERFPTRMIEARSKDLVPVFDYLQ********************************************************************************************************************************
MVLWAGFDKLESEAGATRRVLLLGYRSGFQVWDVEEADNVHDLVSRYDGPVSFMQMLPRPITSKRS**KFAEVRPLLVFCADGSR*****************************VPTVVHFYSLRSQSYVHMLKFRSPIYSVRCSSRVVAICQAAQVHCFDAATLEIEYAILTNPIVMGH**A***GIGYGPLAVGPRWLAYSGSPVV************************GSRVAHYAKESSKHLAAGIVNLGDLGYKKLSQYCSE***********************GHFPDADNVGMVIVRDIVSKNVIAQFRAHKSPISALCFDPSGILLVTASVQGHNINIFKIIPGIL**********SYVHLYRLQRGLTNAVIQDISFSDDSNWIMISSSRGTSHLFAIN****************************************QSLCASGPPVT******************************SLSGAIASSFHNCKGN**********KIKNHLLVFSPSGCMIQYALR****************************VVEAIQKWNICQ****************NG***************************************YISEAELQMHPPRIPLWAKPQSMMI**************IEIERFPTRMIEARSKDLVPVFDYLQS****************************************************************************************************AQLKFVNSKIEGLRM************
MVLWAGFDKLESEAGATRRVLLLGYRSGFQVWDVEEADNVHDLVSRYDGPVSFMQMLPRPITSKRSRDKFAEVRPLLVFCADGSRSCGTKVQDGLATACNGTSANYHDLGNGSSVPTVVHFYSLRSQSYVHMLKFRSPIYSVRCSSRVVAICQAAQVHCFDAATLEIEYAILTNPIVMGHPSAGGIGIGYGPLAVGPRWLAYSGSPVVVSNDGRVNPQHLMQSRSFSGFASNGSRVAHYAKESSKHLAAGIVNLGDLGYKKLSQYCSEFLPDSQNSLQSAIPGGKSNGTVNGHFPDADNVGMVIVRDIVSKNVIAQFRAHKSPISALCFDPSGILLVTASVQGHNINIFKIIPGILGTSSACDAGTSYVHLYRLQRGLTNAVIQDISFSDDSNWIMISSSRGTSHLFAINPLGGSVNFQPTDANFTTKHGAMAKSGVRWPPNLGLQMPNQQSLCASGPPVTLSVVSRIRNGNNGWRGTVSGAAAAATGRVSSLSGAIASSFHNCKGNSETYAAGSSLKIKNHLLVFSPSGCMIQYALRISTGLDVTMGVPGLGSAYDSVPEDDPRLVVEAIQKWNICQKQARREREDNIDIYGDNGTLDSNKIYPEEVKDGNFASTEANGVIEKTKVSPEDKHHLYISEAELQMHPPRIPLWAKPQSMMIKDFKMGEENFLKGEIEIERFPTRMIEARSKDLVPVFDYLQSPKFSQARVPTVGRNSNERLLHQRSGLSENGLLSRRSSSGSLDSVTVNGALAAEPNIGIEETSLDCPQMPVDTKGFVNNSVSPKTKTRHEIVNNSESLRVEAQLKFVNSKIEGLRMENHF********
MVLWAGFDKLESEAGATRRVLLLGYRSGFQVWDVEEADNVHDLVSRYDGPVSFMQMLPRPITSKRSRDKFAEVRPLLVFCADGS**************************NGSSVPTVVHFYSLRSQSYVHMLKFRSPIYSVRCSSRVVAICQAAQVHCFDAATLEIEYAILTNPIVMGHPSAGGIGIGYGPLAVGPRWLAYSGSPVVV**********************NGSRVAHYAKESSKHLAAGIVNLGDLGYKKLSQYCSEF***************************ADNVGMVIVRDIVSKNVIAQFRAHKSPISALCFDPSGILLVTASVQGHNINIFKIIPGILG*SS*C*AGTSYVHLYRLQRGLTNAVIQDISFSDDSNWIMISSSRGTSHLFAINPLGGSV***********************************SLCASGPPVTLSVVSRIRNGNNGWRGT*S********RVSSLSGAIASSFHNCKGNSETYAAGSSLKIKNHLLVFSPSGCMIQYALRISTG*******************DDPRLVVEAIQKWNICQKQARREREDNIDIYGDNGTLDSNKIYPE**KD*********************KHHLYISEAELQMHPPRIPLWAKPQSMMIKDFKMGEENFLKGEIEIERFPTRMIEARSKDLVPVFDYLQSPKFSQARVPTV*R*********R**L***********SGSLDSVTVNGALAAEPNIGIEETSLDCPQMPVDTKGFVNNSVSPKTKTRHEIVNNSESLRVEAQLKFVNSKIEGLRMENHFEDE*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLWAGFDKLESEAGATRRVLLLGYRSGFQVWDVEEADNVHDLVSRYDGPVSFMQMLPRPITSKRSRDKFAEVRPLLVFCADGSRSCGTKVQDGLATACNGTSANYHDLGNGSSVPTVVHFYSLRSQSYVHMLKFRSPIYSVRCSSRVVAICQAAQVHCFDAATLEIEYAILTNPIVMGHPSAGGIGIGYGPLAVGPRWLAYSGSPVVVSNDGRVNPQHLMQSRSFSGFASNGSRVAHYAKESSKHLAAGIVNLGDLGYKKLSQYCSEFLPDSQNSLQSAIPGGKSNGTVNGHFPDADNVGMVIVRDIVSKNVIAQFRAHKSPISALCFDPSGILLVTASVQGHNINIFKIIPGILGTSSACDAGTSYVHLYRLQRGLTNAVIQDISFSDDSNWIMISSSRGTSHLFAINPLGGSVNFQPTDANFTTKHGAMAKSGVRWPPNLGLQMPNQQSLCASGPPVTLSVVSRIRNGNNGWRGTVSGAAAAATGRVSSLSGAIASSFHNCKGNSETYAAGSSLKIKNHLLVFSPSGCMIQYALRISTGLDVTMGVPGLGSAYDSVPEDDPRLVVEAIQKWNICQKQARREREDNIDIYGDNGTLDSNKIYPEEVKDGNFASTEANGVIEKTKVSPEDKHHLYISEAELQMHPPRIPLWAKPQSMMIKDFKMGEENFLKGEIEIERFPTRMIEARSKDLVPVFDYLQSPKFSQARVPTVGRNSNERLLHQRSGLSENGLLSRRSSSGSLDSVTVNGALAAEPNIGIEETSLDCPQMPVDTKGFVNNSVSPKTKTRHEIVNNSESLRVEAQLKFVNSKIEGLRMENHFEDEGDEFD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query828 2.2.26 [Sep-21-2011]
Q9H6U6928 Breast carcinoma-amplifie yes no 0.421 0.376 0.292 1e-41
Q8CCN5928 Breast carcinoma-amplifie yes no 0.411 0.367 0.287 2e-41
Q8SY41 1122 Breast carcinoma-amplifie yes no 0.426 0.314 0.279 5e-30
Q7ZWU5435 WD repeat domain phosphoi N/A no 0.184 0.351 0.291 3e-09
Q75F47537 Autophagy-related protein yes no 0.311 0.480 0.247 1e-08
Q6BIL4562 Autophagy-related protein yes no 0.263 0.387 0.221 3e-08
P43601500 Autophagy-related protein yes no 0.323 0.536 0.241 5e-08
A7A258500 Autophagy-related protein N/A no 0.323 0.536 0.241 5e-08
Q5ZHN3436 WD repeat domain phosphoi no no 0.170 0.323 0.284 5e-08
Q54NA2372 Autophagy-related protein no no 0.124 0.276 0.316 6e-08
>sp|Q9H6U6|BCAS3_HUMAN Breast carcinoma-amplified sequence 3 OS=Homo sapiens GN=BCAS3 PE=1 SV=3 Back     alignment and function desciption
 Score =  172 bits (435), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 123/420 (29%), Positives = 198/420 (47%), Gaps = 71/420 (16%)

Query: 7   FDKLESEAGATRRVLLLGYRSGFQVWDVEEADNVHDLVSRYDGPVSFMQMLPRPITSKRS 66
           F ++ S       ++++GY  G QVW +  +    +L S   GP+   ++LP P    + 
Sbjct: 79  FHEIHSTGNEPPLLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQK 138

Query: 67  RDKFAEVRPLLVFCADGSRSCGTKVQDGLATACNGTSANYHDLGNGSSVPTVVHFYSLRS 126
            D FAE RPLL  C    +S G+          +GTS  Y            V  YSLR+
Sbjct: 139 CDNFAEKRPLLGVC----KSIGS----------SGTSPPY----------CCVDLYSLRT 174

Query: 127 QSYVHMLKFRSPIYSVRCSSRVVAICQAAQVHCFDAATLEIEYAILTNPIVMGHPSAGGI 186
              V  ++F++PIY + C+ R++ +    ++  FD+ T   ++ + +      +P  G  
Sbjct: 175 GEMVKSIQFKTPIYDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSC-----YPCPGP- 228

Query: 187 GIGYGPLAVGPRWLAYSGSPVVVSNDGRVNPQHLMQSRSFSGFASNGSRVAHYAK---ES 243
                P+A+G RWLAY+ + ++  +          QSR      + G  +  Y      +
Sbjct: 229 --NMNPIALGSRWLAYAENKLIRCH----------QSRG----GACGDNIQSYTATVISA 272

Query: 244 SKHLAAGIVNLGDLGYKKLSQYCSEFLPDSQNSLQSAIPGGKSNGTVNGHFP------DA 297
           +K L +G+  +G     K+    +  LP        AI    SN   +   P      D 
Sbjct: 273 AKTLKSGLTMVG-----KVVTQLTGTLPSGVTEDDVAI---HSNSRRSPLVPGIITVIDT 324

Query: 298 DNVG---MVIVRDIVSKNVIAQFRAHKSPISALCFDPSGILLVTASVQGHNINIFKIIPG 354
           + VG   +++  D  S  ++A F AH+ P+  + F+ SG+LLVT    GH+ ++F+I+  
Sbjct: 325 ETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTH 384

Query: 355 ILGTSSACDAGTSYVHLYRLQRGLTNAVIQDISFSDDSNWIMISSSRGTSHLFAINPLGG 414
              +SS C    +  HLY L RG T A +QDI FS D  W+++S+ RGTSH+F INP GG
Sbjct: 385 PW-SSSQC----AVHHLYTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPYGG 439

Homo sapiens (taxid: 9606)
>sp|Q8CCN5|BCAS3_MOUSE Breast carcinoma-amplified sequence 3 homolog OS=Mus musculus GN=Bcas3 PE=1 SV=2 Back     alignment and function description
>sp|Q8SY41|BCAS3_DROME Breast carcinoma-amplified sequence 3 homolog OS=Drosophila melanogaster GN=CG43154 PE=1 SV=1 Back     alignment and function description
>sp|Q7ZWU5|WIPI2_XENLA WD repeat domain phosphoinositide-interacting protein 2 OS=Xenopus laevis GN=wipi2 PE=2 SV=1 Back     alignment and function description
>sp|Q75F47|ATG18_ASHGO Autophagy-related protein 18 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG18 PE=3 SV=1 Back     alignment and function description
>sp|Q6BIL4|ATG18_DEBHA Autophagy-related protein 18 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG18 PE=3 SV=1 Back     alignment and function description
>sp|P43601|ATG18_YEAST Autophagy-related protein 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG18 PE=1 SV=1 Back     alignment and function description
>sp|A7A258|ATG18_YEAS7 Autophagy-related protein 18 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG18 PE=3 SV=1 Back     alignment and function description
>sp|Q5ZHN3|WIPI2_CHICK WD repeat domain phosphoinositide-interacting protein 2 OS=Gallus gallus GN=WIPI2 PE=2 SV=1 Back     alignment and function description
>sp|Q54NA2|ATG18_DICDI Autophagy-related protein 18 OS=Dictyostelium discoideum GN=atg18 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query828
255563665891 breast carcinoma amplified sequence, put 0.989 0.919 0.711 0.0
147808145893 hypothetical protein VITISV_005771 [Viti 0.990 0.918 0.696 0.0
225461122922 PREDICTED: uncharacterized protein LOC10 0.990 0.889 0.696 0.0
357452689914 Autophagy-related protein [Medicago trun 0.962 0.871 0.619 0.0
357452691901 Autophagy-related protein [Medicago trun 0.962 0.884 0.619 0.0
224126297742 predicted protein [Populus trichocarpa] 0.800 0.893 0.686 0.0
224117404702 predicted protein [Populus trichocarpa] 0.792 0.934 0.696 0.0
356545163900 PREDICTED: uncharacterized protein LOC10 0.975 0.897 0.596 0.0
356514980901 PREDICTED: uncharacterized protein LOC10 0.985 0.905 0.590 0.0
449468504907 PREDICTED: uncharacterized protein LOC10 0.974 0.889 0.590 0.0
>gi|255563665|ref|XP_002522834.1| breast carcinoma amplified sequence, putative [Ricinus communis] gi|223537918|gb|EEF39532.1| breast carcinoma amplified sequence, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1155 bits (2989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/834 (71%), Positives = 664/834 (79%), Gaps = 15/834 (1%)

Query: 2   VLWAGFDKLESEAGATRRVLLLGYRSGFQVWDVEEADNVHDLVSRYDGPVSFMQMLPRPI 61
           V WAGFDKL+ E G  RRVLLLGYRSGFQVWDVEEADNV DLVSR+DGPVSFMQ+LP+PI
Sbjct: 66  VHWAGFDKLDDE-GDVRRVLLLGYRSGFQVWDVEEADNVRDLVSRHDGPVSFMQLLPKPI 124

Query: 62  TSKRSRDKFAEVRPLLVFCADGSRSCGTKVQDGLATACNGTSANYHDLGNGSSVPTVVHF 121
            SKRS DKFAE RP+LV C DG+ S    + DGL + C G+  N H+ G+G+ VPT+V F
Sbjct: 125 ASKRSEDKFAESRPILVVCTDGTISGVNDISDGLPSQCYGSIPNCHESGSGNFVPTIVRF 184

Query: 122 YSLRSQSYVHMLKFRSPIYSVRCSSRVVAICQAAQVHCFDAATLEIEYAILTNPIVMGHP 181
           YSLRSQSY+HMLKFRS +YSVRCSSR+VAI QAAQ+HCFDA TLE EY ILTNPIV G+P
Sbjct: 185 YSLRSQSYIHMLKFRSIVYSVRCSSRIVAISQAAQIHCFDATTLEREYTILTNPIVTGYP 244

Query: 182 SAGGIGIGYGPLAVGPRWLAYSGSPVVVSNDGRVNPQHLMQSRSFSGFASNGSRVAHYAK 241
            +GG+G  YGPLAVGPRWLAYSGSPV +S+ GRV+PQHL  S SFSGF SNGS VAHYAK
Sbjct: 245 GSGGLG--YGPLAVGPRWLAYSGSPVAISSSGRVSPQHLTSSASFSGFNSNGSLVAHYAK 302

Query: 242 ESSKHLAAGIVNLGDLGYKKLSQYCSEFLPDSQNSLQSAIPGGKSNGTVNGHFPDADNVG 301
           ESSK LAAGIV LGD+GYKK S+YCSE LPDS +S QSA PG K+N TVNGH PDADNVG
Sbjct: 303 ESSKQLAAGIVMLGDMGYKKFSRYCSELLPDSHSSFQSANPGWKANSTVNGHLPDADNVG 362

Query: 302 MVIVRDIVSKNVIAQFRAHKSPISALCFDPSGILLVTASVQGHNINIFKIIPGILGTSSA 361
           MV+VRDIV K VIAQFRAH+SPISALCFDPSG LLVTASV GHNIN+FKI+PGI G+SSA
Sbjct: 363 MVVVRDIVGKLVIAQFRAHRSPISALCFDPSGTLLVTASVHGHNINVFKIMPGIQGSSSA 422

Query: 362 CDAGTSYVHLYRLQRGLTNAVIQDISFSDDSNWIMISSSRGTSHLFAINPLGGSVNFQPT 421
            DAG SY HLYRLQRG TNAVIQDISFSDDSNWIMISSSRGT+HLFAINP GG VNFQ  
Sbjct: 423 GDAGASYTHLYRLQRGFTNAVIQDISFSDDSNWIMISSSRGTNHLFAINPFGGPVNFQTL 482

Query: 422 DANFTTKH---GAMAKSGVRWPPNLGLQMPNQQSLCASGPPVTLSVVSRIRNGNNGWRGT 478
            AN++ K+   G M KS VRWP +LGLQM NQQSLCASGPPVTLSVVSRIRNGNNGW+G+
Sbjct: 483 IANYSAKNSESGVMTKSAVRWPSSLGLQMHNQQSLCASGPPVTLSVVSRIRNGNNGWKGS 542

Query: 479 VSGAAAAATGRVSSLSGAIASSFHNCKGNSETYAAGSSLKIKNHLLVFSPSGCMIQYALR 538
           V+GAAAAATGR+SSLSGAIASSFHNCKGN++ Y  G+ LK K HLLVFSPSGCMIQY LR
Sbjct: 543 VTGAAAAATGRLSSLSGAIASSFHNCKGNNDLYLDGTILKSKYHLLVFSPSGCMIQYVLR 602

Query: 539 ISTGLDVTMGVPGLGSAYDSVPEDDPRLVVEAIQKWNICQKQARREREDNIDIYGDNGTL 598
           IS G+D    VPGLG+A++SVPE D RLVVEAIQKWNICQK  RREREDN+DIYG+NG  
Sbjct: 603 ISAGIDSMAVVPGLGTAFESVPESDGRLVVEAIQKWNICQKLNRREREDNVDIYGENGIS 662

Query: 599 DSNKIYPEEVKDGNFASTEANGVIEKTKVSPEDKHHLYISEAELQMHPPRIPLWAKP--- 655
           DSNKIYPE  K GN    E  G   K K++PE+KHHLYISEAELQMH P   LWAKP   
Sbjct: 663 DSNKIYPEGKKKGNSVHPEGMGATIKEKINPEEKHHLYISEAELQMHQPHTALWAKPEIY 722

Query: 656 -QSMMIKDFKMGEENFLKGEIEIERFPTRMIEARSKDLVPVFDYLQSPKFSQARVPTVGR 714
            Q MM +  KM  EN + GEIE+ER PTR IEARSKDLVPVFDY +      ARVP +  
Sbjct: 723 FQPMMTEGIKMDGENAMLGEIEVERLPTRTIEARSKDLVPVFDYHR-----YARVPALDN 777

Query: 715 NSNERLLHQRSGLSENGLLSRRSSSGSLDSVTVNGALAAEPNIGIEETSLDCPQMPVDTK 774
           N N +  HQRS LSENG +S RSSS SLD +T  GA+AAE   G+EET  +  +MP +  
Sbjct: 778 NINVQPQHQRSVLSENGRISCRSSSCSLDCMTDCGAVAAERRNGVEETGWNDSRMPSEVM 837

Query: 775 GFVNNSVSPKTKTRHEIVNNSESLRVEAQLKFVNSKIEGLRMENHFEDEGDEFD 828
           G+VN+S   K  T  + VN+ +SLR EAQLK VNS   G RMENHFEDEGDEFD
Sbjct: 838 GYVNSSDGSKIDTPLDNVNSRDSLRTEAQLKLVNSNNGGPRMENHFEDEGDEFD 891

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147808145|emb|CAN75263.1| hypothetical protein VITISV_005771 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225461122|ref|XP_002279886.1| PREDICTED: uncharacterized protein LOC100265881 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357452689|ref|XP_003596621.1| Autophagy-related protein [Medicago truncatula] gi|355485669|gb|AES66872.1| Autophagy-related protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357452691|ref|XP_003596622.1| Autophagy-related protein [Medicago truncatula] gi|355485670|gb|AES66873.1| Autophagy-related protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224126297|ref|XP_002319804.1| predicted protein [Populus trichocarpa] gi|222858180|gb|EEE95727.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224117404|ref|XP_002317566.1| predicted protein [Populus trichocarpa] gi|222860631|gb|EEE98178.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356545163|ref|XP_003541014.1| PREDICTED: uncharacterized protein LOC100791837 [Glycine max] Back     alignment and taxonomy information
>gi|356514980|ref|XP_003526179.1| PREDICTED: uncharacterized protein LOC100778343 [Glycine max] Back     alignment and taxonomy information
>gi|449468504|ref|XP_004151961.1| PREDICTED: uncharacterized protein LOC101215158 [Cucumis sativus] gi|449527063|ref|XP_004170532.1| PREDICTED: uncharacterized LOC101215158 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query828
TAIR|locus:2020853959 ATG18G "AT1G03380" [Arabidopsi 0.824 0.712 0.401 5.1e-122
TAIR|locus:2157523763 G18F "AT5G54730" [Arabidopsis 0.323 0.351 0.508 1.9e-108
TAIR|locus:2199512927 ATG18H "AT1G54710" [Arabidopsi 0.681 0.608 0.414 3e-108
ZFIN|ZDB-GENE-040426-1257910 bcas3 "breast carcinoma amplif 0.253 0.230 0.334 7.1e-39
UNIPROTKB|F1P1V9803 BCAS3 "Uncharacterized protein 0.246 0.254 0.341 6.2e-37
RGD|1560788803 Bcas3 "breast carcinoma amplif 0.246 0.254 0.337 1.2e-35
UNIPROTKB|F1LSC9824 Bcas3 "Protein Bcas3" [Rattus 0.246 0.247 0.337 1.4e-35
UNIPROTKB|F1S209820 BCAS3 "Uncharacterized protein 0.246 0.248 0.329 1.8e-35
UNIPROTKB|Q9H6U6928 BCAS3 "Breast carcinoma-amplif 0.246 0.219 0.337 2e-35
MGI|MGI:2385848928 Bcas3 "breast carcinoma amplif 0.246 0.219 0.333 4.3e-35
TAIR|locus:2020853 ATG18G "AT1G03380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1200 (427.5 bits), Expect = 5.1e-122, P = 5.1e-122
 Identities = 291/725 (40%), Positives = 415/725 (57%)

Query:     2 VLWAGFDKLESEAGATRRVLLLGYRSGFQVWDVEEADNVHDLVSRYDGPVSFMQMLPRPI 61
             V WAGF  LE     TR VLLLGY++GFQV+DVE+A N ++LVS+  GPVSF+QM P P 
Sbjct:    59 VTWAGFGILELGQHVTRHVLLLGYQNGFQVFDVEDASNFNELVSKRGGPVSFLQMQPLPA 118

Query:    62 TSKRSRDKFAEVRPLLVFCADGSRSCGTKV-----QDGLATACNGTSANYHDLGNGSSVP 116
              S    + F    PLL+  A G  + GT +     Q+G + A +G+S +    G+  + P
Sbjct:   119 RSG-DHEGFWNSHPLLLVVA-GDETNGTGLGHSFSQNG-SLARDGSSDS--KAGDAINYP 173

Query:   117 TVVHFYSLRSQSYVHMLKFRSPIYSVRCSSRVVAICQAAQVHCFDAATLEIEYAILTNPI 176
             T V FYSLRS SYV++L+FRS +  +RCSSRVVA+  A Q++C DA TLE ++++LT P+
Sbjct:   174 TTVRFYSLRSHSYVYVLRFRSSVCMIRCSSRVVAVGLANQIYCVDALTLENKFSVLTYPV 233

Query:   177 VMG-HPSAGGIGIGYGPLAVGPRWLAYSGSPVVVSNDGRVNPQHLMQSRSFSGFASNG-- 233
                       + +GYGP+AVGPRWLAY+    +    GR++PQ    S S S  +S+G  
Sbjct:   234 PQPVRQGTTRVNVGYGPMAVGPRWLAYASKSSMTMKTGRLSPQTFTSSPSLSPSSSSGGS 293

Query:   234 SRVAHYAKESSKHLAAGIVNLGDLGYKKLSQYCSEFLPDSQNSLQSAIPGGKSNGTVNGH 293
             S +A YA ESSK LA G++NLGD+GYK LS+YC + LPD   S  S     K  G V+G 
Sbjct:   294 SFMARYAMESSKQLANGLINLGDMGYKTLSKYCQDMLPDGSTSPASPNAIWKVGG-VSGS 352

Query:   294 FPDADNVGMVIVRDIVSKNVIAQFRAHKSPISALCFDPSGILLVTASVQGHNINIFKIIP 353
               DA+N GMV V+D+VS  +++QF+AH SPISALCFDPSG LLVTASV G+NIN+F+I+P
Sbjct:   353 --DAENAGMVAVKDLVSGALVSQFKAHTSPISALCFDPSGTLLVTASVCGNNINVFQIMP 410

Query:   354 GILGTSS---ACDAGTSYVHLYRLQRGLTNAVIQDISFSDDSNWIMISSSRGTSHLFAIN 410
                  +    + +  +S+VHL++L RG+T+A++QDI FS  S W+ I SS+GT H+F +N
Sbjct:   411 SRSHNAPGDLSYEWESSHVHLFKLHRGITSAIVQDICFSQQSQWVAIISSKGTCHIFVLN 470

Query:   411 PLGGSVNFQPTDANFTTKHGAMAKSGVRWPPNLGLQMPNQQSLCASGPP--VTLSVVSRI 468
               G    FQP +    T+   +  S + W     L   NQQSL    PP  V LSVVSRI
Sbjct:   471 SSGSDAAFQPCEGEEPTR---LPASSLPWWFTQSLSS-NQQSL---SPPTAVALSVVSRI 523

Query:   469 RNGNNGWXXXXXXXXXXXXXXXXXLSGAIASSFHNCKGNSETYAAGSSLKIKNHLLVFSP 528
             +  + GW                  SGA+A+ FH  K  +      S      H+LV++P
Sbjct:   524 KYSSFGWLNTVSNATTAATGKVFVPSGAVAAVFH--KSVTHDLQLNSRTNALEHILVYTP 581

Query:   529 SGCMIQYALRISTGLDVTM-GVPGLGSAYDSVPEDDPRLVVEAIQKWNICQKQARRERED 587
             SG ++Q+ L  S   +    G+    +++  V EDD R+ VE IQ W++C++    E E+
Sbjct:   582 SGHVVQHELLPSVCTESPENGLRVQKTSHVQVQEDDLRVKVEPIQWWDVCRRSDWLETEE 641

Query:   588 NI--DIYGDNGTLD--SNKIYPEEVK----DGNFASTEANGVIEKTKVSPEDKHHLYISE 639
              +   I      L+  SN +   E      D N   +E +  ++     P ++ H Y+S 
Sbjct:   642 RLPKSITEKQYDLETVSNHLTSHEDACLSLDMNSHFSE-DKYLKSCSEKPPERSHCYLSN 700

Query:   640 AELQMHPPRIPLWAKPQ-SMMIKDFKMGEENFLKGEIEIERFPTRMIEARSKDLVPVFDY 698
              E+++    +P+W   + S  + D    + +   GE EIE+ P   +E + K L+PVFD+
Sbjct:   701 FEVKVTSGMLPVWQNSKISFHVMDSPR-DSSSTGGEFEIEKVPAHELEIKQKKLLPVFDH 759

Query:   699 LQSPK 703
               S K
Sbjct:   760 FHSTK 764
GO:0003674 "molecular_function" evidence=ND
GO:0042594 "response to starvation" evidence=IEP
TAIR|locus:2157523 G18F "AT5G54730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199512 ATG18H "AT1G54710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1257 bcas3 "breast carcinoma amplified sequence 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1V9 BCAS3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1560788 Bcas3 "breast carcinoma amplified sequence 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LSC9 Bcas3 "Protein Bcas3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S209 BCAS3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H6U6 BCAS3 "Breast carcinoma-amplified sequence 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2385848 Bcas3 "breast carcinoma amplified sequence 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00027420001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (881 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query828
pfam12490245 pfam12490, BCAS3, Breast carcinoma amplified seque 6e-85
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 0.001
smart0032040 smart00320, WD40, WD40 repeats 0.002
>gnl|CDD|221602 pfam12490, BCAS3, Breast carcinoma amplified sequence 3 Back     alignment and domain information 
 Score =  270 bits (692), Expect = 6e-85
 Identities = 112/247 (45%), Positives = 149/247 (60%), Gaps = 11/247 (4%)

Query: 457 GPPVTLSVVSRIRNGNNGWRGTVSGAAAAATGRVSSLSGAIASSFHNCKGNSETYAAGSS 516
            PPVTLSVVSRI+NGN+GW GTV+GAA++ATG+   +SGA+AS FHNC G +   A G  
Sbjct: 1   PPPVTLSVVSRIKNGNSGWLGTVTGAASSATGKPLVVSGAVASVFHNCSGKNSESADGIK 60

Query: 517 LKIKNHLLVFSPSGCMIQYALRISTGLDVTMGVPGLGSAYDSVPEDDP-RLVVEAIQKWN 575
              K+HLLVFSPSG +IQY LR S G D    +P  G   +S  ++   RL VE +Q+W+
Sbjct: 61  SNSKDHLLVFSPSGHLIQYLLRPSVGGDS-GEIPRNGVPSESQIDETELRLTVEPVQQWD 119

Query: 576 ICQKQARREREDNIDIYGDNGTLDS-NKIYPEEVKDGNFASTEANGVIEKTKVSPEDKHH 634
           +C++    ERE+N+   G+N  LD+  K+ PE  + GN     ++  + K   S E+K H
Sbjct: 120 VCRRSNWPEREENVAPLGENNPLDADAKVEPEVGRKGNSVHPISDSAVGKESTSSEEKDH 179

Query: 635 LYISEAELQMH-PPRIPLWAKPQSMMIKDFKMGE------ENFLKGEIEIERFPTRMIEA 687
           LY+S AE+Q H  P  PLW  P+       +            L GEIEIE+ PTR +E 
Sbjct: 180 LYLSNAEVQTHSGPHRPLWQGPK-FSFYVMQSPTGKELENSGSLSGEIEIEKLPTREVEI 238

Query: 688 RSKDLVP 694
           R KDLVP
Sbjct: 239 RRKDLVP 245

This domain family is found in eukaryotes, and is typically between 229 and 245 amino acids in length. The proteins in this family have been shown to be proto-oncogenes implicated in the development of breast cancer. Length = 245
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 828
PF12490251 BCAS3: Breast carcinoma amplified sequence 3 ; Int 100.0
KOG2109788 consensus WD40 repeat protein [General function pr 100.0
KOG2110391 consensus Uncharacterized conserved protein, conta 100.0
KOG2111346 consensus Uncharacterized conserved protein, conta 99.97
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.9
KOG0263707 consensus Transcription initiation factor TFIID, s 99.88
KOG0315311 consensus G-protein beta subunit-like protein (con 99.87
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.87
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.83
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.83
KOG0286343 consensus G-protein beta subunit [General function 99.82
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.82
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.81
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.8
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.8
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.8
PLN00181793 protein SPA1-RELATED; Provisional 99.79
KOG0266456 consensus WD40 repeat-containing protein [General 99.77
KOG0295406 consensus WD40 repeat-containing protein [Function 99.77
KOG0266456 consensus WD40 repeat-containing protein [General 99.76
KOG0315311 consensus G-protein beta subunit-like protein (con 99.76
KOG0295406 consensus WD40 repeat-containing protein [Function 99.75
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.74
KOG0263707 consensus Transcription initiation factor TFIID, s 99.73
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.72
PLN00181793 protein SPA1-RELATED; Provisional 99.72
KOG0286343 consensus G-protein beta subunit [General function 99.72
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.72
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.72
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.71
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.71
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.71
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.7
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.7
PTZ00421493 coronin; Provisional 99.7
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.7
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.69
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.69
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.69
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.68
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.68
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.68
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.68
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.67
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.67
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.66
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.65
KOG0643327 consensus Translation initiation factor 3, subunit 99.65
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.65
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.64
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.64
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.63
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.63
PTZ00420568 coronin; Provisional 99.63
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.62
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.62
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.62
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.62
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.62
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.61
KOG2055514 consensus WD40 repeat protein [General function pr 99.6
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.6
KOG0296399 consensus Angio-associated migratory cell protein 99.59
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.58
PTZ00420568 coronin; Provisional 99.58
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.57
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.57
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.56
KOG0645312 consensus WD40 repeat protein [General function pr 99.56
PTZ00421493 coronin; Provisional 99.56
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.55
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.53
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.52
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.52
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.52
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.51
KOG1539910 consensus WD repeat protein [General function pred 99.51
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.51
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.51
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.49
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.46
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.46
KOG1539910 consensus WD repeat protein [General function pred 99.46
KOG0645312 consensus WD40 repeat protein [General function pr 99.46
KOG0772641 consensus Uncharacterized conserved protein, conta 99.46
KOG0772641 consensus Uncharacterized conserved protein, conta 99.45
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.45
KOG0289506 consensus mRNA splicing factor [General function p 99.45
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.45
KOG0643327 consensus Translation initiation factor 3, subunit 99.43
KOG0293519 consensus WD40 repeat-containing protein [Function 99.42
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.41
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.4
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.4
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.39
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.39
KOG0641350 consensus WD40 repeat protein [General function pr 99.37
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.37
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.37
KOG1274 933 consensus WD40 repeat protein [General function pr 99.36
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.36
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.36
KOG0639705 consensus Transducin-like enhancer of split protei 99.35
KOG4283397 consensus Transcription-coupled repair protein CSA 99.34
KOG0267 825 consensus Microtubule severing protein katanin p80 99.33
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.33
KOG2096420 consensus WD40 repeat protein [General function pr 99.32
KOG0283712 consensus WD40 repeat-containing protein [Function 99.31
KOG2109788 consensus WD40 repeat protein [General function pr 99.31
KOG0301745 consensus Phospholipase A2-activating protein (con 99.28
KOG0270463 consensus WD40 repeat-containing protein [Function 99.27
KOG0289506 consensus mRNA splicing factor [General function p 99.26
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.26
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.26
KOG0283712 consensus WD40 repeat-containing protein [Function 99.25
KOG1273405 consensus WD40 repeat protein [General function pr 99.25
KOG2096420 consensus WD40 repeat protein [General function pr 99.25
KOG0267 825 consensus Microtubule severing protein katanin p80 99.23
KOG0301745 consensus Phospholipase A2-activating protein (con 99.23
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.23
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.23
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.23
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.23
KOG0296399 consensus Angio-associated migratory cell protein 99.22
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.22
KOG0293519 consensus WD40 repeat-containing protein [Function 99.21
KOG0294362 consensus WD40 repeat-containing protein [Function 99.2
KOG0639705 consensus Transducin-like enhancer of split protei 99.18
KOG2106626 consensus Uncharacterized conserved protein, conta 99.18
KOG0300481 consensus WD40 repeat-containing protein [Function 99.16
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.15
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.15
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.14
KOG0302440 consensus Ribosome Assembly protein [General funct 99.14
KOG0302440 consensus Ribosome Assembly protein [General funct 99.14
KOG4283397 consensus Transcription-coupled repair protein CSA 99.13
KOG4328498 consensus WD40 protein [Function unknown] 99.12
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.12
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.12
KOG2048691 consensus WD40 repeat protein [General function pr 99.11
KOG0646476 consensus WD40 repeat protein [General function pr 99.11
KOG0641350 consensus WD40 repeat protein [General function pr 99.11
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.1
KOG1274 933 consensus WD40 repeat protein [General function pr 99.1
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.1
KOG0646476 consensus WD40 repeat protein [General function pr 99.1
KOG0294362 consensus WD40 repeat-containing protein [Function 99.09
PRK11028330 6-phosphogluconolactonase; Provisional 99.08
PRK11028330 6-phosphogluconolactonase; Provisional 99.08
KOG2055514 consensus WD40 repeat protein [General function pr 99.05
PRK01742429 tolB translocation protein TolB; Provisional 99.04
KOG2048691 consensus WD40 repeat protein [General function pr 99.04
COG2319466 FOG: WD40 repeat [General function prediction only 99.04
KOG1188376 consensus WD40 repeat protein [General function pr 99.03
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.03
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.03
KOG0300481 consensus WD40 repeat-containing protein [Function 99.03
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.01
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.0
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.0
KOG2106626 consensus Uncharacterized conserved protein, conta 99.0
KOG4328498 consensus WD40 protein [Function unknown] 98.98
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 98.97
KOG0322323 consensus G-protein beta subunit-like protein GNB1 98.95
COG2319466 FOG: WD40 repeat [General function prediction only 98.94
KOG14451012 consensus Tumor-specific antigen (contains WD repe 98.93
PRK03629429 tolB translocation protein TolB; Provisional 98.92
KOG1273405 consensus WD40 repeat protein [General function pr 98.9
KOG2110391 consensus Uncharacterized conserved protein, conta 98.87
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 98.87
PRK05137435 tolB translocation protein TolB; Provisional 98.87
KOG2111346 consensus Uncharacterized conserved protein, conta 98.86
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 98.85
KOG0290364 consensus Conserved WD40 repeat-containing protein 98.85
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 98.81
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 98.77
KOG1963792 consensus WD40 repeat protein [General function pr 98.76
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 98.74
KOG1063764 consensus RNA polymerase II elongator complex, sub 98.74
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.74
KOG0303472 consensus Actin-binding protein Coronin, contains 98.74
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.73
KOG1063764 consensus RNA polymerase II elongator complex, sub 98.71
PRK04922433 tolB translocation protein TolB; Provisional 98.69
KOG0303472 consensus Actin-binding protein Coronin, contains 98.68
PRK02889427 tolB translocation protein TolB; Provisional 98.68
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 98.66
KOG0290364 consensus Conserved WD40 repeat-containing protein 98.65
KOG0270463 consensus WD40 repeat-containing protein [Function 98.65
KOG0771398 consensus Prolactin regulatory element-binding pro 98.62
KOG14451012 consensus Tumor-specific antigen (contains WD repe 98.6
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 98.59
KOG1963792 consensus WD40 repeat protein [General function pr 98.57
KOG15171387 consensus Guanine nucleotide binding protein MIP1 98.55
PRK01742429 tolB translocation protein TolB; Provisional 98.54
KOG0771398 consensus Prolactin regulatory element-binding pro 98.51
KOG15171387 consensus Guanine nucleotide binding protein MIP1 98.49
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 98.49
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.48
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 98.48
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 98.47
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.47
PRK04922433 tolB translocation protein TolB; Provisional 98.46
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.44
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 98.43
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.42
KOG0649325 consensus WD40 repeat protein [General function pr 98.41
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.41
PRK05137435 tolB translocation protein TolB; Provisional 98.39
PRK03629429 tolB translocation protein TolB; Provisional 98.38
PRK00178430 tolB translocation protein TolB; Provisional 98.38
KOG1188376 consensus WD40 repeat protein [General function pr 98.37
PRK02889427 tolB translocation protein TolB; Provisional 98.34
KOG0322323 consensus G-protein beta subunit-like protein GNB1 98.34
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 98.34
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 98.31
KOG0644 1113 consensus Uncharacterized conserved protein, conta 98.28
PRK04792448 tolB translocation protein TolB; Provisional 98.27
KOG2139445 consensus WD40 repeat protein [General function pr 98.24
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.23
KOG1310 758 consensus WD40 repeat protein [General function pr 98.22
KOG0644 1113 consensus Uncharacterized conserved protein, conta 98.22
PRK01029428 tolB translocation protein TolB; Provisional 98.2
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 98.19
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 98.18
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.15
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.13
KOG2321703 consensus WD40 repeat protein [General function pr 98.12
KOG0649325 consensus WD40 repeat protein [General function pr 98.02
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 97.98
PRK04792448 tolB translocation protein TolB; Provisional 97.97
PRK04043419 tolB translocation protein TolB; Provisional 97.94
PRK00178430 tolB translocation protein TolB; Provisional 97.94
KOG3881412 consensus Uncharacterized conserved protein [Funct 97.89
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 97.86
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.77
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.75
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.74
KOG2139445 consensus WD40 repeat protein [General function pr 97.73
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.72
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.69
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 97.62
KOG4227609 consensus WD40 repeat protein [General function pr 97.6
KOG4547541 consensus WD40 repeat-containing protein [General 97.59
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 97.58
COG4946668 Uncharacterized protein related to the periplasmic 97.58
KOG4227609 consensus WD40 repeat protein [General function pr 97.58
PRK01029428 tolB translocation protein TolB; Provisional 97.57
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.57
KOG2321703 consensus WD40 repeat protein [General function pr 97.57
KOG2315566 consensus Predicted translation initiation factor 97.56
KOG12401431 consensus Protein kinase containing WD40 repeats [ 97.54
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.49
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 97.49
KOG19121062 consensus WD40 repeat protein [General function pr 97.47
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 97.46
KOG1310 758 consensus WD40 repeat protein [General function pr 97.41
KOG4497447 consensus Uncharacterized conserved protein WDR8, 97.39
KOG12401431 consensus Protein kinase containing WD40 repeats [ 97.36
KOG1272545 consensus WD40-repeat-containing subunit of the 18 97.35
KOG2315566 consensus Predicted translation initiation factor 97.35
KOG4547541 consensus WD40 repeat-containing protein [General 97.32
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.31
KOG1409404 consensus Uncharacterized conserved protein, conta 97.3
KOG4497447 consensus Uncharacterized conserved protein WDR8, 97.3
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.29
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 97.24
KOG1334559 consensus WD40 repeat protein [General function pr 97.24
COG4946668 Uncharacterized protein related to the periplasmic 97.2
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 97.12
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.05
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 96.99
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 96.97
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 96.96
KOG4415247 consensus Uncharacterized conserved protein [Funct 96.83
KOG0280339 consensus Uncharacterized conserved protein [Amino 96.79
KOG2314698 consensus Translation initiation factor 3, subunit 96.72
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 96.71
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 96.66
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.62
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 96.52
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 96.38
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 96.31
PLN029191057 haloacid dehalogenase-like hydrolase family protei 96.3
KOG4532344 consensus WD40-like repeat containing protein [Gen 96.15
KOG41901034 consensus Uncharacterized conserved protein [Funct 96.14
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 96.06
KOG1334559 consensus WD40 repeat protein [General function pr 95.99
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.8
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 95.77
KOG4714319 consensus Nucleoporin [Nuclear structure] 95.65
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 95.61
KOG2695425 consensus WD40 repeat protein [General function pr 95.55
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 95.38
KOG4532344 consensus WD40-like repeat containing protein [Gen 95.33
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 95.32
KOG41901034 consensus Uncharacterized conserved protein [Funct 95.28
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 95.28
PRK04043419 tolB translocation protein TolB; Provisional 95.17
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.16
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 95.14
KOG0280339 consensus Uncharacterized conserved protein [Amino 95.12
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 95.05
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 95.01
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 94.92
smart0032040 WD40 WD40 repeats. Note that these repeats are per 94.65
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 94.64
KOG1912 1062 consensus WD40 repeat protein [General function pr 94.6
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 94.56
KOG2695425 consensus WD40 repeat protein [General function pr 94.31
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 94.09
COG0823425 TolB Periplasmic component of the Tol biopolymer t 94.02
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 93.87
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 93.86
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 93.81
KOG4714319 consensus Nucleoporin [Nuclear structure] 93.6
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 93.47
KOG2041 1189 consensus WD40 repeat protein [General function pr 93.43
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 93.37
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 93.31
KOG3621 726 consensus WD40 repeat-containing protein [General 93.28
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 92.99
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 92.42
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 92.37
KOG2314698 consensus Translation initiation factor 3, subunit 92.31
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 92.18
PRK02888635 nitrous-oxide reductase; Validated 92.05
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 92.03
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 90.82
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 90.5
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 90.09
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 89.93
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 89.89
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 89.83
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 89.82
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 89.31
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 89.07
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 88.68
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 88.39
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 88.23
COG0823425 TolB Periplasmic component of the Tol biopolymer t 87.87
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 87.62
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 87.5
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 87.2
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 87.18
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 86.95
KOG2395644 consensus Protein involved in vacuole import and d 86.81
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 84.98
KOG2041 1189 consensus WD40 repeat protein [General function pr 84.02
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 83.71
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 83.36
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 82.29
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 82.26
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 82.02
COG3391381 Uncharacterized conserved protein [Function unknow 81.99
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 81.98
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 81.85
PRK13616591 lipoprotein LpqB; Provisional 81.4
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 80.48
>PF12490 BCAS3: Breast carcinoma amplified sequence 3 ; InterPro: IPR022175 This domain family is found in eukaryotes, and is typically between 229 and 245 amino acids in length Back     alignment and domain information 
Probab=100.00  E-value=3e-56  Score=471.08  Aligned_cols=237  Identities=47%  Similarity=0.703  Sum_probs=208.9

Q ss_pred             CCceeeeeeEEEecCC-CCCCCcccCccccccC-CcCCCCCceeeeeeccCCCCcccccCCcccccccEEEEccCccEEE
Q 003336          457 GPPVTLSVVSRIRNGN-NGWRGTVSGAAAAATG-RVSSLSGAIASSFHNCKGNSETYAAGSSLKIKNHLLVFSPSGCMIQ  534 (828)
Q Consensus       457 ~~p~~ls~v~~i~~~~-~~~~~~v~~~a~~~~g-~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~~p~g~~~q  534 (828)
                      |+|++|++|+|||+++ +||.++|+++|++++| |.+.++||+|+.||+|.+.+..+..+...++++|||||+|+|+|||
T Consensus         1 P~Pv~l~~vsrIK~~~~~g~~~tv~~aassa~g~~~~~~sga~a~~f~~~~~~~~~~~~~~~~~~~~~LlV~spsG~Liq   80 (251)
T PF12490_consen    1 PPPVTLSVVSRIKQGNTLGWLNTVSNAASSATGGKPSSVSGAFASSFHNSKGSSSEPSDSSSSKAVESLLVFSPSGHLIQ   80 (251)
T ss_pred             CCCEEechHHhhcCCccccccccccccccchhcCCcccceeEEccccccCCCCcccccccccccccceEEEECCCCcEEE
Confidence            5799999999999999 8999999999999999 8899999999999999777766677776789999999999999999


Q ss_pred             EeeeeccCCCcccCcCCCCCCCCCC-CCCCceEEEeeecccccccccccccccc-cccccCCCCCccC-cccccccccCC
Q 003336          535 YALRISTGLDVTMGVPGLGSAYDSV-PEDDPRLVVEAIQKWNICQKQARRERED-NIDIYGDNGTLDS-NKIYPEEVKDG  611 (828)
Q Consensus       535 y~l~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~ve~~~~w~~~r~~~~~e~e~-~~~~~~~~~~~~~-~~~~~~~~~~~  611 (828)
                      |+|+|+.+.+++.+.++.++++++. +|+++||+|||+|||||||+++|+||++ +..+++++...+. ++|+.+..+++
T Consensus        81 y~L~p~~~~~~~~~~~~~~~~~~~~~~~~~l~l~vep~~~Wdl~R~~~w~e~~~d~~~~~~~~~~~~~~~~~~~~~~~~~  160 (251)
T PF12490_consen   81 YELRPSPGSDPTEGGSGNGPPSESQMDDTELRLVVEPVQQWDLCRRPNWPEREEDCVPPLPENNPLDSASKIDPSDCRKG  160 (251)
T ss_pred             EEEeeccccCcccccccccCccccccccCcceEEeeeccceeEeccccCCccchhccCCCCCCCHhhhhhhccccccccc
Confidence            9999999999988888899999888 6699999999999999999999999999 7777777665544 56777777776


Q ss_pred             C-cccCCCcccccccCCCCcCccceeeeeeeeeecCC-CcccccCceeccccccccC-----ccccCC--CeeEEeeccc
Q 003336          612 N-FASTEANGVIEKTKVSPEDKHHLYISEAELQMHPP-RIPLWAKPQSMMIKDFKMG-----EENFLK--GEIEIERFPT  682 (828)
Q Consensus       612 ~-~~~~~~~~~~~~~~~~~~e~~~~~ls~aE~~~~~~-~~plW~~~~~~~~~~~~~~-----~~~~~~--~e~eie~~~~  682 (828)
                      + +++.+...+ .+.+++++|+++|||||||||||++ |+||||||||.|+++....     ..+..+  ||||||++|+
T Consensus       161 ~~~~~~~~~~~-~~~~~~~~e~~~~wlS~vEi~th~~phrpLW~gpQf~F~~~~~~~~~~~~~s~~~~~~~e~EIE~~~~  239 (251)
T PF12490_consen  161 NSVNPSNDSYV-SKESDSPEERDHWWLSNVEIQTHSGPHRPLWMGPQFSFKTMSSPSSSELNISSSSGEAGEIEIEKIPT  239 (251)
T ss_pred             CCccccccccc-cccCCCcccccCcEEeeeeeEeccCCccccccCCcEEEEEecCCCCccccccccccccCceeeccccc
Confidence            5 666654333 7778889999999999999999999 6999999999999885542     445566  9999999999


Q ss_pred             cceecccCCccc
Q 003336          683 RMIEARSKDLVP  694 (828)
Q Consensus       683 ~~~~~~~~~l~p  694 (828)
                      |+||+|+|||||
T Consensus       240 ~~ve~r~k~l~p  251 (251)
T PF12490_consen  240 REVEIRRKDLLP  251 (251)
T ss_pred             cceeeeccccCC
Confidence            999999999998

The proteins in this family have been shown to be proto-oncogenes implicated in the development of breast cancer.
>KOG2109 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2109 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG4415 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query828
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 3e-21
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 8e-04
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355 Back     alignment and structure
 Score = 95.5 bits (237), Expect = 3e-21
 Identities = 25/122 (20%), Positives = 44/122 (36%), Gaps = 14/122 (11%)

Query: 290 VNGHFPDADNVGMVIVRDIVSKNVIAQFRAHKSPISALCFDPSGILLVTASVQGHNINIF 349
                  +       V+           +AH +PI  +  +    ++ T S  G  I +F
Sbjct: 164 TKLQSSGSATTQDQGVQQKAILGKGVLIKAHTNPIKMVRLNRKSDMVATCSQDGTIIRVF 223

Query: 350 KIIPGILGTSSACDAGTSYVHLYRLQRGLTNAVIQDISFSDDSNWIMISSSRGTSHLFAI 409
           K   G              V +   +RGL  A + D+ +S D + + + S + T H+F I
Sbjct: 224 KTEDG--------------VLVREFRRGLDRADVVDMKWSTDGSKLAVVSDKWTLHVFEI 269

Query: 410 NP 411
             
Sbjct: 270 FN 271
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query828
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.95
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.94
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.94
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.93
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.93
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.93
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.92
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.92
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.92
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.92
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.91
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.91
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.91
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.91
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.91
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.91
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.91
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.9
2pm7_B297 Protein transport protein SEC13, protein transport 99.9
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.9
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.9
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.9
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.9
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.89
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.89
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.89
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.89
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.89
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.89
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.89
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.88
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.88
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.88
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.88
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.88
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.88
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.87
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.87
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.87
3jrp_A379 Fusion protein of protein transport protein SEC13 99.87
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.87
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.87
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.87
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.87
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.87
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.86
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.86
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.86
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.86
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.86
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.86
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.85
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.85
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.85
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.85
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.85
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.85
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.85
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.85
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.85
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.85
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.85
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.84
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.84
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.84
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.84
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.84
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.84
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.84
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.83
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.83
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.83
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.83
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.83
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.83
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.83
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.83
2pm7_B297 Protein transport protein SEC13, protein transport 99.83
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.83
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.83
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.82
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.82
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.82
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.82
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.82
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.82
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.82
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.81
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.81
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.81
3jrp_A379 Fusion protein of protein transport protein SEC13 99.81
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.81
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.81
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.8
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.8
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.8
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.8
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.8
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.79
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.79
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.79
3jro_A753 Fusion protein of protein transport protein SEC13 99.79
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.78
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.78
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.78
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.78
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.77
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.77
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.77
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.77
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.76
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.76
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.76
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.75
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.75
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.74
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.74
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.74
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.74
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.73
3jro_A753 Fusion protein of protein transport protein SEC13 99.71
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.7
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.68
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.67
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.67
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.63
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.62
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.6
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.58
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.56
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.54
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.53
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.53
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.53
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.53
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.5
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.48
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.48
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.48
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.44
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.43
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.43
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.4
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.39
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.36
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.36
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.35
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.33
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.31
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.3
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.27
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.27
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.26
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.24
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.24
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.23
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.23
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.2
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.19
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.17
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.05
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.03
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.0
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.99
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.98
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 98.95
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.9
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.88
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 98.84
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.83
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 98.8
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.79
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.78
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.77
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.68
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.64
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.59
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.57
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.56
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.54
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.52
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.52
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.5
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.48
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.46
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.44
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.42
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.38
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.36
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.36
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.32
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.32
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.31
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.3
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 98.29
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.06
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.05
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.05
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.03
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.02
2qe8_A343 Uncharacterized protein; structural genomics, join 98.0
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 97.98
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 97.93
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.92
2ece_A462 462AA long hypothetical selenium-binding protein; 97.9
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 97.89
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.84
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 97.8
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.76
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.76
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.73
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.7
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.69
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 97.69
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 97.68
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.68
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.63
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.6
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.55
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 97.54
2ece_A462 462AA long hypothetical selenium-binding protein; 97.48
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.44
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 97.4
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.37
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 97.35
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.34
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.31
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 97.26
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.21
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.13
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.07
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 97.03
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 96.93
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.91
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 96.87
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 96.83
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.72
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 96.7
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.49
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.47
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.46
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 96.37
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 96.35
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.31
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 96.08
2qe8_A343 Uncharacterized protein; structural genomics, join 96.08
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.06
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 96.01
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 95.87
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 95.69
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 95.32
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.26
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 95.07
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.06
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 94.53
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 93.52
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 93.28
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 92.85
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 92.7
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 92.63
2fp8_A322 Strictosidine synthase; six bladed beta propeller 92.26
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 92.05
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 90.66
2p4o_A306 Hypothetical protein; putative lactonase, structur 90.6
3v65_B386 Low-density lipoprotein receptor-related protein; 90.51
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 89.54
3p5b_L400 Low density lipoprotein receptor variant; B-propel 87.62
4a2l_A795 BT_4663, two-component system sensor histidine kin 87.17
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 86.88
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 86.51
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 86.26
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 84.04
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 83.76
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 83.61
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 82.14
2fp8_A322 Strictosidine synthase; six bladed beta propeller 81.86
3v65_B386 Low-density lipoprotein receptor-related protein; 81.21
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 80.87
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
Probab=99.95  E-value=2.9e-26  Score=249.05  Aligned_cols=227  Identities=22%  Similarity=0.313  Sum_probs=177.2

Q ss_pred             CCCcEEEEEccCCeEEEEecCCCceeEeeeeecCCEEEEEEecCCCCcccccCccccCCCEEEEEeCCCCccCccccCCc
Q 003336           16 ATRRVLLLGYRSGFQVWDVEEADNVHDLVSRYDGPVSFMQMLPRPITSKRSRDKFAEVRPLLVFCADGSRSCGTKVQDGL   95 (828)
Q Consensus        16 ~~~~vLl~Gy~~G~qVWdv~~~~~~~ellS~hdG~V~~v~~lP~p~~~~~~~d~F~~~rPLLavv~~~~~~g~~~~~Dg~   95 (828)
                      +..++|+.|.++|++|||+++   ...+...+.+.+..+.+++.+              .++++++.+            
T Consensus        29 ~dg~~la~g~~~~~~iw~~~~---~~~~~~~~~~~~~~~~~~~~~--------------~~~~~~~~~------------   79 (355)
T 3vu4_A           29 QDQSCLILSTLKSFEIYNVHP---VAHIMSQEMRHLSKVRMLHRT--------------NYVAFVTGV------------   79 (355)
T ss_dssp             TTSSEEEEECSSEEEEEEETT---EEEEEEEECSCCCEEEECTTS--------------SEEEEECSS------------
T ss_pred             CCCCEEEEEcCCEEEEEecCC---cceeeeeecCCeEEEEEcCCC--------------CEEEEEECC------------
Confidence            347899999999999999986   344555555668888887642              366666542            


Q ss_pred             ccccCCCCCCCCCCCCCCcCCCEEEEEECCCCcEEEEEeCCCCEEEEEEcCCEEEEEeCCEEEEEECCCC-ceEEEEEcC
Q 003336           96 ATACNGTSANYHDLGNGSSVPTVVHFYSLRSQSYVHMLKFRSPIYSVRCSSRVVAICQAAQVHCFDAATL-EIEYAILTN  174 (828)
Q Consensus        96 ~~~~~g~~~~~h~~g~~~~~~~tVrlWDL~Tg~~V~tL~f~s~V~sV~~S~riLAVs~~~~I~IwDl~t~-~~l~tL~t~  174 (828)
                                          +++|++||+++++++.++.++.+|.+|+++++.++++.+++|++||+.+. +.+.++.+ 
T Consensus        80 --------------------d~~v~iWd~~~~~~~~~~~~~~~v~~v~~~~~~~~~~~~~~i~i~d~~~~~~~~~~~~~-  138 (355)
T 3vu4_A           80 --------------------KEVVHIWDDVKKQDVSRIKVDAPVKDLFLSREFIVVSYGDVISVFKFGNPWKRITDDIR-  138 (355)
T ss_dssp             --------------------TTEEEEEETTTTEEEEEEECSSCEEEEEECSSEEEEEETTEEEEEESSTTCCBSSCCEE-
T ss_pred             --------------------ccEEEEEECCCCcEEEEEECCCceEEEEEcCCEEEEEEcCEEEEEECCCCceeeEEecc-
Confidence                                16899999999999999999999999999999999999999999999987 55444332 


Q ss_pred             CCccCCCCCCCCCcccceeeeccceEEEeCCCceecCCCccCCcccccccccccccCCCcceeeeecccccceeceeEec
Q 003336          175 PIVMGHPSAGGIGIGYGPLAVGPRWLAYSGSPVVVSNDGRVNPQHLMQSRSFSGFASNGSRVAHYAKESSKHLAAGIVNL  254 (828)
Q Consensus       175 p~~~~~p~~~~~~~~~~piAlg~r~LAya~~~~~~s~~Grvsp~~l~~s~~~s~~~s~g~~Va~~A~~ssk~lasGl~~l  254 (828)
                      +  .            +.+++++.+||++                                                   
T Consensus       139 ~--~------------~~~~~s~~~la~~---------------------------------------------------  153 (355)
T 3vu4_A          139 F--G------------GVCEFSNGLLVYS---------------------------------------------------  153 (355)
T ss_dssp             E--E------------EEEEEETTEEEEE---------------------------------------------------
T ss_pred             C--C------------ceEEEEccEEEEe---------------------------------------------------
Confidence            1  0            1122222222221                                                   


Q ss_pred             cCccceeeccccccccCCCCCCcccccCCCCCCCccCCcccccCCCCeEEEEECCCCc---------------E-EEEec
Q 003336          255 GDLGYKKLSQYCSEFLPDSQNSLQSAIPGGKSNGTVNGHFPDADNVGMVIVRDIVSKN---------------V-IAQFR  318 (828)
Q Consensus       255 Gd~g~~~ls~y~~~~~p~~~~si~sa~~~~k~~g~~~g~~~s~~~dG~V~IwDl~s~~---------------~-i~~f~  318 (828)
                                                               ++..+|.|+|||+.+++               + +..+.
T Consensus       154 -----------------------------------------sg~~~g~v~iwd~~~~~~~~~~~~~~~~~~~~p~~~~~~  192 (355)
T 3vu4_A          154 -----------------------------------------NEFNLGQIHITKLQSSGSATTQDQGVQQKAILGKGVLIK  192 (355)
T ss_dssp             -----------------------------------------ESSCTTCEEEEECCC------------------CCEEEC
T ss_pred             -----------------------------------------CCCcCcEEEEEECCCCCccccccccccccccCcccEEEE
Confidence                                                     13457889999999865               2 78899


Q ss_pred             cCCCCeEEEEEcCCCCEEEEEecCCCEEEEEeCCCCCCCCCCccCCCCceeEEEEEecCCccccEEEEEEccCCCEEEEE
Q 003336          319 AHKSPISALCFDPSGILLVTASVQGHNINIFKIIPGILGTSSACDAGTSYVHLYRLQRGLTNAVIQDISFSDDSNWIMIS  398 (828)
Q Consensus       319 aH~~pIsaLaFSPdG~lLATaS~DGt~I~IWdi~~~~~~~~~~~~~~~~~~~l~~L~RG~t~a~I~sIaFSpDg~~LAs~  398 (828)
                      +|..+|.+|+|+|||++|||||.||+.|+|||+.++              ..+.++++|.....|.+++|+||+++||++
T Consensus       193 ~h~~~v~~~~~s~~g~~l~s~s~d~~~v~iwd~~~~--------------~~~~~~~~g~h~~~v~~~~~s~~~~~l~s~  258 (355)
T 3vu4_A          193 AHTNPIKMVRLNRKSDMVATCSQDGTIIRVFKTEDG--------------VLVREFRRGLDRADVVDMKWSTDGSKLAVV  258 (355)
T ss_dssp             CCSSCEEEEEECTTSSEEEEEETTCSEEEEEETTTC--------------CEEEEEECTTCCSCEEEEEECTTSCEEEEE
T ss_pred             ccCCceEEEEECCCCCEEEEEeCCCCEEEEEECCCC--------------cEEEEEEcCCCCCcEEEEEECCCCCEEEEE
Confidence            999999999999999999999999975899999876              567788767334579999999999999999


Q ss_pred             eCCCcEEEEecCCC
Q 003336          399 SSRGTSHLFAINPL  412 (828)
Q Consensus       399 S~DGTVhIwdl~~~  412 (828)
                      +.|++|+|||+...
T Consensus       259 s~d~~v~iw~~~~~  272 (355)
T 3vu4_A          259 SDKWTLHVFEIFND  272 (355)
T ss_dssp             ETTCEEEEEESSCC
T ss_pred             ECCCEEEEEEccCC
Confidence            99999999999764
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 828
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-05
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-05
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-04
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 0.001
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.001
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.003
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.003
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 45.1 bits (105), Expect = 2e-05
 Identities = 17/106 (16%), Positives = 29/106 (27%), Gaps = 15/106 (14%)

Query: 302 MVIVRDIVSKNVIAQFRAHKSPISALCFDPSGILLVTASVQGHNINIFKIIPGILGTSSA 361
              + D+        F  H+S I+A+CF P+G    T S                     
Sbjct: 207 SAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRA--------- 257

Query: 362 CDAGTSYVHLYRLQRGLTNAVIQDISFSDDSNWIMISSSRGTSHLF 407
                    L           I  +SFS     ++        +++
Sbjct: 258 ------DQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVW 297
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query828
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.91
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.91
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.89
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.89
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.87
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.87
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.86
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.84
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.83
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.83
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.83
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.83
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.82
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.8
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.8
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.8
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.79
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.78
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.78
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.78
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.77
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.77
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.76
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.75
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.73
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.7
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.68
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.68
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.66
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.63
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.62
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.59
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.52
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.48
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.34
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.31
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.3
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.3
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.3
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.29
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.24
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.09
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.84
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.8
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.79
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.76
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.63
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.31
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.22
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.15
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.94
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.72
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.6
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.47
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.19
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 96.97
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 96.45
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 96.42
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 96.05
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 95.83
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.68
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 95.6
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 95.55
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 94.88
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 94.79
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 94.22
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.38
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 92.65
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 92.61
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 92.28
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 91.75
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 89.43
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 86.95
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 86.25
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 85.91
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 84.94
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 84.04
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Actin interacting protein 1
species: Nematode (Caenorhabditis elegans) [TaxId: 6239]

Probab=99.91  E-value=7.8e-23  Score=215.47  Aligned_cols=240  Identities=10%  Similarity=0.121  Sum_probs=180.1

Q ss_pred             CCCcEEEEEccCCeEEEEecCCCceeEeeeeecCCEEEEEEecCCCCcccccCccccCCCEEEEEeCCCCccCccccCCc
Q 003336           16 ATRRVLLLGYRSGFQVWDVEEADNVHDLVSRYDGPVSFMQMLPRPITSKRSRDKFAEVRPLLVFCADGSRSCGTKVQDGL   95 (828)
Q Consensus        16 ~~~~vLl~Gy~~G~qVWdv~~~~~~~ellS~hdG~V~~v~~lP~p~~~~~~~d~F~~~rPLLavv~~~~~~g~~~~~Dg~   95 (828)
                      +....|+.+..+.+.|||+++ .+...++..|.++|.++++.|+.              .+||.++.             
T Consensus        27 ~~g~~l~~~~~~~v~i~~~~~-~~~~~~~~~H~~~v~~~~~sp~g--------------~~latg~~-------------   78 (311)
T d1nr0a1          27 PAGDKIQYCNGTSVYTVPVGS-LTDTEIYTEHSHQTTVAKTSPSG--------------YYCASGDV-------------   78 (311)
T ss_dssp             TTSSEEEEEETTEEEEEETTC-SSCCEEECCCSSCEEEEEECTTS--------------SEEEEEET-------------
T ss_pred             CCCCEEEEEeCCEEEEEECCC-CceeEEEcCCCCCEEEEEEeCCC--------------CeEecccc-------------
Confidence            446677778788899999987 46777888899999999999853              25654442             


Q ss_pred             ccccCCCCCCCCCCCCCCcCCCEEEEEECCCCcEE--EEEe-CCCCEEEEEEc--CCEEEEEeC---CEEEEEECCCCce
Q 003336           96 ATACNGTSANYHDLGNGSSVPTVVHFYSLRSQSYV--HMLK-FRSPIYSVRCS--SRVVAICQA---AQVHCFDAATLEI  167 (828)
Q Consensus        96 ~~~~~g~~~~~h~~g~~~~~~~tVrlWDL~Tg~~V--~tL~-f~s~V~sV~~S--~riLAVs~~---~~I~IwDl~t~~~  167 (828)
                                          +++|+|||+.+++.+  .+++ +..+|.+|+|+  +++|+++.+   ..++|||+.+++.
T Consensus        79 --------------------dg~i~iwd~~~~~~~~~~~~~~~~~~v~~v~~s~d~~~l~~~~~~~~~~~~v~~~~~~~~  138 (311)
T d1nr0a1          79 --------------------HGNVRIWDTTQTTHILKTTIPVFSGPVKDISWDSESKRIAAVGEGRERFGHVFLFDTGTS  138 (311)
T ss_dssp             --------------------TSEEEEEESSSTTCCEEEEEECSSSCEEEEEECTTSCEEEEEECCSSCSEEEEETTTCCB
T ss_pred             --------------------CceEeeeeeeccccccccccccccCccccccccccccccccccccccccccccccccccc
Confidence                                278999999998754  4454 46799999997  567776543   4599999999887


Q ss_pred             EEEEEcCCCccCCCCCCCCCcccceeeeccceEEEeCCCceecCCCccCCcccccccccccccCCCcceeeeecccccce
Q 003336          168 EYAILTNPIVMGHPSAGGIGIGYGPLAVGPRWLAYSGSPVVVSNDGRVNPQHLMQSRSFSGFASNGSRVAHYAKESSKHL  247 (828)
Q Consensus       168 l~tL~t~p~~~~~p~~~~~~~~~~piAlg~r~LAya~~~~~~s~~Grvsp~~l~~s~~~s~~~s~g~~Va~~A~~ssk~l  247 (828)
                      +.++..|..               ++    +.++|..                           ++..            
T Consensus       139 ~~~l~~h~~---------------~v----~~v~~~~---------------------------~~~~------------  160 (311)
T d1nr0a1         139 NGNLTGQAR---------------AM----NSVDFKP---------------------------SRPF------------  160 (311)
T ss_dssp             CBCCCCCSS---------------CE----EEEEECS---------------------------SSSC------------
T ss_pred             ccccccccc---------------cc----ccccccc---------------------------ccee------------
Confidence            666554421               01    1123321                           0000            


Q ss_pred             eceeEeccCccceeeccccccccCCCCCCcccccCCCCCCCccCCcccccCCCCeEEEEECCCCcEEEEeccCCCCeEEE
Q 003336          248 AAGIVNLGDLGYKKLSQYCSEFLPDSQNSLQSAIPGGKSNGTVNGHFPDADNVGMVIVRDIVSKNVIAQFRAHKSPISAL  327 (828)
Q Consensus       248 asGl~~lGd~g~~~ls~y~~~~~p~~~~si~sa~~~~k~~g~~~g~~~s~~~dG~V~IwDl~s~~~i~~f~aH~~pIsaL  327 (828)
                                                                   .+++++.+|.|+|||+.+++.+..+..|..+|.++
T Consensus       161 ---------------------------------------------~l~sgs~d~~i~i~d~~~~~~~~~~~~~~~~i~~v  195 (311)
T d1nr0a1         161 ---------------------------------------------RIISGSDDNTVAIFEGPPFKFKSTFGEHTKFVHSV  195 (311)
T ss_dssp             ---------------------------------------------EEEEEETTSCEEEEETTTBEEEEEECCCSSCEEEE
T ss_pred             ---------------------------------------------eeccccccccccccccccccccccccccccccccc
Confidence                                                         12345678999999999999999999999999999


Q ss_pred             EEcCCCCEEEEEecCCCEEEEEeCCCCCCCCCCccCCCCceeEEEEEec------CCccccEEEEEEccCCCEEEEEeCC
Q 003336          328 CFDPSGILLVTASVQGHNINIFKIIPGILGTSSACDAGTSYVHLYRLQR------GLTNAVIQDISFSDDSNWIMISSSR  401 (828)
Q Consensus       328 aFSPdG~lLATaS~DGt~I~IWdi~~~~~~~~~~~~~~~~~~~l~~L~R------G~t~a~I~sIaFSpDg~~LAs~S~D  401 (828)
                      +|+|+|++|++++.||. |+|||+..+              ..+..+..      |+. ..|.+|+|+||+++|++++.|
T Consensus       196 ~~~p~~~~l~~~~~d~~-v~~~d~~~~--------------~~~~~~~~~~~~~~~h~-~~V~~~~~s~~~~~l~tgs~D  259 (311)
T d1nr0a1         196 RYNPDGSLFASTGGDGT-IVLYNGVDG--------------TKTGVFEDDSLKNVAHS-GSVFGLTWSPDGTKIASASAD  259 (311)
T ss_dssp             EECTTSSEEEEEETTSC-EEEEETTTC--------------CEEEECBCTTSSSCSSS-SCEEEEEECTTSSEEEEEETT
T ss_pred             ccCcccccccccccccc-ccccccccc--------------ccccccccccccccccc-ccccccccCCCCCEEEEEeCC
Confidence            99999999999999998 899999875              23333322      232 359999999999999999999


Q ss_pred             CcEEEEecCCCCCceeeccCC
Q 003336          402 GTSHLFAINPLGGSVNFQPTD  422 (828)
Q Consensus       402 GTVhIwdl~~~gg~~~~~~H~  422 (828)
                      |+|+|||+.+......+..|.
T Consensus       260 g~v~iwd~~t~~~~~~l~~~~  280 (311)
T d1nr0a1         260 KTIKIWNVATLKVEKTIPVGT  280 (311)
T ss_dssp             SEEEEEETTTTEEEEEEECCS
T ss_pred             CeEEEEECCCCcEEEEEECCC
Confidence            999999998875555666553
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure