Citrus Sinensis ID: 003337
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 828 | 2.2.26 [Sep-21-2011] | |||||||
| Q8H7F6 | 293 | Monothiol glutaredoxin-S1 | no | no | 0.347 | 0.982 | 0.656 | 1e-109 | |
| Q6GM29 | 586 | Phosphatidylinositide pho | N/A | no | 0.579 | 0.819 | 0.358 | 1e-88 | |
| Q2QX01 | 285 | Monothiol glutaredoxin-S1 | no | no | 0.274 | 0.796 | 0.663 | 4e-86 | |
| A6QL88 | 587 | Phosphatidylinositide pho | yes | no | 0.576 | 0.812 | 0.360 | 4e-85 | |
| Q9ES21 | 587 | Phosphatidylinositide pho | yes | no | 0.579 | 0.817 | 0.352 | 7e-85 | |
| Q9NTJ5 | 587 | Phosphatidylinositide pho | yes | no | 0.636 | 0.897 | 0.336 | 9e-84 | |
| Q5R921 | 587 | Phosphatidylinositide pho | yes | no | 0.636 | 0.897 | 0.335 | 1e-83 | |
| Q9EP69 | 587 | Phosphatidylinositide pho | yes | no | 0.579 | 0.817 | 0.351 | 3e-83 | |
| A1L244 | 586 | Phosphatidylinositide pho | yes | no | 0.576 | 0.813 | 0.347 | 2e-82 | |
| A4VCH0 | 586 | Phosphatidylinositide pho | no | no | 0.640 | 0.904 | 0.320 | 3e-82 |
| >sp|Q8H7F6|GRS16_ARATH Monothiol glutaredoxin-S16, chloroplastic OS=Arabidopsis thaliana GN=GRXS16 PE=2 SV=2 | Back alignment and function desciption |
|---|
Score = 397 bits (1019), Expect = e-109, Method: Compositional matrix adjust.
Identities = 193/294 (65%), Positives = 234/294 (79%), Gaps = 6/294 (2%)
Query: 1 MATNTINLSLSPVPSLRLLSPYSPQNAPSLSFYSHFRPPIQLPSISHNTYKYTTATPRSL 60
MA TI+ SL S R++ P+ +N P ++ YS F P PS+S + RS
Sbjct: 1 MAAITISSSLHASASPRVVRPHVSRNTPVITLYSRFTPSFSFPSLSFTLRDTAPSRRRSF 60
Query: 61 VIVTAVKTLSDTELVAVPLTAEEFNSKFPSETGVYAVYDKNDELQFVGISRNIGASVFSH 120
I +AVK+L++TEL+ P+T + PS +GVYAVYDK+DELQFVGISRNI ASV +H
Sbjct: 61 FIASAVKSLTETELL--PITEAD---SIPSASGVYAVYDKSDELQFVGISRNIAASVSAH 115
Query: 121 LKSVPELCCSVKVGVVDDPDRTALTQAWKSWMEEHIQATGKIPPGNESGNNTWVRQPPKK 180
LKSVPELC SVKVG+V++PD+ LTQAWK W+EEHI+ TGK+PPGN+SGNNT+V+Q P+K
Sbjct: 116 LKSVPELCGSVKVGIVEEPDKAVLTQAWKLWIEEHIKVTGKVPPGNKSGNNTFVKQTPRK 175
Query: 181 KKPDLRLTPGHNVQLTVPLEELIDKLVKENKVVAFIKGSRSAPMCGFSQKVIGILESQGV 240
K D+RLTPG +V+LTVPLEELID+LVKE+KVVAFIKGSRSAP CGFSQ+V+GILESQGV
Sbjct: 176 KS-DIRLTPGRHVELTVPLEELIDRLVKESKVVAFIKGSRSAPQCGFSQRVVGILESQGV 234
Query: 241 DYESVDVLDEEYNNGLRETLKKYSNWPTFPQIFVNGELVGGCDILSSMYEKGRF 294
DYE+VDVLD+EYN+GLRETLK YSNWPTFPQIFV GELVGGCDIL+SMYE G
Sbjct: 235 DYETVDVLDDEYNHGLRETLKNYSNWPTFPQIFVKGELVGGCDILTSMYENGEL 288
|
May only reduce GSH-thiol disulfides, but not protein disulfides. Arabidopsis thaliana (taxid: 3702) |
| >sp|Q6GM29|SAC1_XENLA Phosphatidylinositide phosphatase SAC1 OS=Xenopus laevis GN=sacm1l PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q2QX01|GRS12_ORYSJ Monothiol glutaredoxin-S12, chloroplastic OS=Oryza sativa subsp. japonica GN=GRXS12 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|A6QL88|SAC1_BOVIN Phosphatidylinositide phosphatase SAC1 OS=Bos taurus GN=SACM1L PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9ES21|SAC1_RAT Phosphatidylinositide phosphatase SAC1 OS=Rattus norvegicus GN=Sacm1l PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9NTJ5|SAC1_HUMAN Phosphatidylinositide phosphatase SAC1 OS=Homo sapiens GN=SACM1L PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q5R921|SAC1_PONAB Phosphatidylinositide phosphatase SAC1 OS=Pongo abelii GN=SACM1L PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9EP69|SAC1_MOUSE Phosphatidylinositide phosphatase SAC1 OS=Mus musculus GN=Sacm1l PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|A1L244|SAC1A_DANRE Phosphatidylinositide phosphatase SAC1-A OS=Danio rerio GN=sacm1la PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|A4VCH0|SAC1B_DANRE Phosphatidylinositide phosphatase SAC1-B OS=Danio rerio GN=sacm1lb PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 828 | ||||||
| 255582662 | 585 | suppressor of actin, putative [Ricinus c | 0.647 | 0.916 | 0.770 | 0.0 | |
| 225439400 | 590 | PREDICTED: phosphatidylinositide phospha | 0.647 | 0.908 | 0.726 | 0.0 | |
| 359481161 | 578 | PREDICTED: phosphatidylinositide phospha | 0.647 | 0.927 | 0.736 | 0.0 | |
| 224140439 | 604 | predicted protein [Populus trichocarpa] | 0.643 | 0.882 | 0.722 | 0.0 | |
| 296083171 | 606 | unnamed protein product [Vitis vinifera] | 0.647 | 0.884 | 0.706 | 0.0 | |
| 449483505 | 590 | PREDICTED: phosphatidylinositide phospha | 0.647 | 0.908 | 0.709 | 0.0 | |
| 449439860 | 590 | PREDICTED: phosphatidylinositide phospha | 0.647 | 0.908 | 0.709 | 0.0 | |
| 30693541 | 588 | SAC domain-containing protein 8 [Arabido | 0.646 | 0.909 | 0.682 | 0.0 | |
| 297816444 | 597 | hypothetical protein ARALYDRAFT_485538 [ | 0.642 | 0.891 | 0.668 | 0.0 | |
| 356521032 | 585 | PREDICTED: phosphatidylinositide phospha | 0.646 | 0.914 | 0.699 | 0.0 |
| >gi|255582662|ref|XP_002532110.1| suppressor of actin, putative [Ricinus communis] gi|223528213|gb|EEF30272.1| suppressor of actin, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 933 bits (2412), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 439/570 (77%), Positives = 496/570 (87%), Gaps = 34/570 (5%)
Query: 292 GRFKLHDQLELLEFKDQYVIKSVESPDQGFSIDRRDGNIEPLNDEACSGSPSQTSTIYGV 351
GRFKL+DQLEL EF+D+YVIKSVESP++GFSI R DGNIEPLN++ SG+PS+ S IYGV
Sbjct: 15 GRFKLYDQLELHEFQDKYVIKSVESPNRGFSIGRSDGNIEPLNNDTISGTPSKPSIIYGV 74
Query: 352 AGTIRLLAGKYVLVITSRKEAGTFLGFPVFRVTSMKFLHCNEALKFSNYQEKKDEVYFMN 411
AGTIRL+AG Y+LVITSR+E G+FLGFPVFR+ SMKFL CNE+LKFS QEK+DE YFMN
Sbjct: 75 AGTIRLVAGTYILVITSREEVGSFLGFPVFRIVSMKFLSCNESLKFSTSQEKRDEAYFMN 134
Query: 412 LLKVVEATPGLYYSYETDITLNLQRRCKLAEGWMSKPIWKQADPRFVWNRNLLEELIE-- 469
LLK VE+TPGLYYSYETDITLNLQRRCKLAEGWM KPIWKQADPRFVWN+NLLEE IE
Sbjct: 135 LLKTVESTPGLYYSYETDITLNLQRRCKLAEGWMGKPIWKQADPRFVWNKNLLEEFIEYS 194
Query: 470 ----CKLKLNDSPAVITLLSRRCNRRLGTRMWRRGANLEGDTANFIETEQLLETEGFKSS 525
+LKL D PA ITL+SRRC RRLGTRMWRRGANLEGDTANFIETEQLLE GF+SS
Sbjct: 195 RFGAAQLKLKDKPATITLVSRRCTRRLGTRMWRRGANLEGDTANFIETEQLLELGGFRSS 254
Query: 526 LLQVRGSIPLLWEQIVDLSYKPRLKIINHDQTPKVVERHFHDLLQRYGEIVAVDLTDKHG 585
LLQ+RGSIPLLWEQIVDLSYKPR++IINH+QT KVVERHFHDLLQRYG +AVDLTDKHG
Sbjct: 255 LLQIRGSIPLLWEQIVDLSYKPRIRIINHEQTSKVVERHFHDLLQRYGGAIAVDLTDKHG 314
Query: 586 DEGQLSAAYAAEMQKLPNVRYVSFDFHHVCGTSNFDKLQVLYDQIQQEFDNQGYLLIDTE 645
+EG+LS+AYAAE+QKLPNVR++SFDFHHVCG SNFD LQ+LYDQI ++F NQGY ++D E
Sbjct: 315 EEGKLSSAYAAEVQKLPNVRFLSFDFHHVCGNSNFDNLQILYDQISEDFGNQGYFIVDPE 374
Query: 646 GNILEEQKGVIRSNCIDCLDRTNVTQSYLAQKSLSLQLQRIGILSCTKCISMFSEECGKF 705
GNILEEQKG+IRSNCIDCLDRTNVTQS+LAQKSL+LQLQRIG+L+ +CIS+F+E+ GKF
Sbjct: 375 GNILEEQKGIIRSNCIDCLDRTNVTQSFLAQKSLNLQLQRIGVLNSNECISIFTEDYGKF 434
Query: 706 RTLWAEQGDEISIEYAGTYALKGDLVRYGKQTISGLIRDGMSSLSRYYLNNFQDGVRQDA 765
RTLWAEQGDEIS+EYAGT+ALKGDLVRYGKQT+ G I+DGMS+LSRYYLNNFQDGVRQDA
Sbjct: 435 RTLWAEQGDEISLEYAGTHALKGDLVRYGKQTLGGAIKDGMSALSRYYLNNFQDGVRQDA 494
Query: 766 MDLISGHYTVNRNSPSPFQLNGFESFS----------------------------QYLSS 797
+DLISGHYT+NRN PSPFQLNGFESFS QYLS+
Sbjct: 495 LDLISGHYTINRNGPSPFQLNGFESFSYLPVASALVIGGLTLTTFTVQQAGRNAQQYLST 554
Query: 798 VVWAGVTAGVLALVKANGTQFCSRPRLCGL 827
V+WAGVTAGV+A+VKANG QFCSRPRLCGL
Sbjct: 555 VLWAGVTAGVMAVVKANGRQFCSRPRLCGL 584
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225439400|ref|XP_002263906.1| PREDICTED: phosphatidylinositide phosphatase SAC1-like isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359481161|ref|XP_003632584.1| PREDICTED: phosphatidylinositide phosphatase SAC1-like isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224140439|ref|XP_002323590.1| predicted protein [Populus trichocarpa] gi|222868220|gb|EEF05351.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|296083171|emb|CBI22807.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449483505|ref|XP_004156610.1| PREDICTED: phosphatidylinositide phosphatase SAC1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449439860|ref|XP_004137703.1| PREDICTED: phosphatidylinositide phosphatase SAC1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|30693541|ref|NP_190751.2| SAC domain-containing protein 8 [Arabidopsis thaliana] gi|1657619|gb|AAB18128.1| G5p [Arabidopsis thaliana] gi|3068710|gb|AAC14410.1| putative transmembrane protein G5p [Arabidopsis thaliana] gi|19347767|gb|AAL86335.1| putative transmembrane protein G5p [Arabidopsis thaliana] gi|22136712|gb|AAM91675.1| putative transmembrane protein G5p [Arabidopsis thaliana] gi|31415733|gb|AAP49841.1| SAC domain protein 8 [Arabidopsis thaliana] gi|332645328|gb|AEE78849.1| SAC domain-containing protein 8 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297816444|ref|XP_002876105.1| hypothetical protein ARALYDRAFT_485538 [Arabidopsis lyrata subsp. lyrata] gi|297321943|gb|EFH52364.1| hypothetical protein ARALYDRAFT_485538 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356521032|ref|XP_003529162.1| PREDICTED: phosphatidylinositide phosphatase SAC1-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 828 | ||||||
| TAIR|locus:2074398 | 588 | SAC8 "AT3G51830" [Arabidopsis | 0.413 | 0.581 | 0.712 | 3.1e-215 | |
| TAIR|locus:2081780 | 597 | RHD4 "AT3G51460" [Arabidopsis | 0.378 | 0.524 | 0.517 | 1.5e-134 | |
| TAIR|locus:2156907 | 593 | ATSAC1B "AT5G66020" [Arabidops | 0.375 | 0.524 | 0.507 | 2.2e-133 | |
| TAIR|locus:2042887 | 293 | CXIP2 "CAX-interacting protein | 0.345 | 0.976 | 0.650 | 7.4e-98 | |
| UNIPROTKB|Q6GM29 | 586 | sacm1l "Phosphatidylinositide | 0.398 | 0.563 | 0.411 | 1.8e-86 | |
| UNIPROTKB|I3LJB6 | 587 | LOC100739183 "Uncharacterized | 0.362 | 0.511 | 0.436 | 1.5e-83 | |
| UNIPROTKB|A6QL88 | 587 | SACM1L "Phosphatidylinositide | 0.364 | 0.514 | 0.442 | 1.5e-83 | |
| RGD|69223 | 587 | Sacm1l "SAC1 suppressor of act | 0.362 | 0.511 | 0.423 | 2.2e-82 | |
| UNIPROTKB|F1NK59 | 564 | SACM1L "Uncharacterized protei | 0.365 | 0.537 | 0.437 | 3.6e-82 | |
| UNIPROTKB|J9P4F0 | 587 | SACM1L "Uncharacterized protei | 0.362 | 0.511 | 0.427 | 5.8e-82 |
| TAIR|locus:2074398 SAC8 "AT3G51830" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1304 (464.1 bits), Expect = 3.1e-215, Sum P(3) = 3.1e-215
Identities = 245/344 (71%), Positives = 291/344 (84%)
Query: 476 DSPAVITLLSRRCNRRLGTRMWRRGANLEGDTANFIETEQLLETEGFKSSLLQVRGSIPL 535
+SPAV++++SRRC RRLGTRMWRRGANLEGD ANF+E+EQ++E GFK SLLQVRGSIPL
Sbjct: 209 NSPAVVSIMSRRCTRRLGTRMWRRGANLEGDAANFVESEQIVEINGFKFSLLQVRGSIPL 268
Query: 536 LWEQIVDLSYKPRLKIINHDQTPKVVERHFHDLLQRYGEIVAVDLTDKHGDEGQLSAAYA 595
LWEQIVDLSYKPRLKI H++TPKVV+RHFHDL QRYGEI+AVDLTD+HGDEG LS AYA
Sbjct: 269 LWEQIVDLSYKPRLKINKHEETPKVVQRHFHDLCQRYGEIMAVDLTDQHGDEGALSKAYA 328
Query: 596 AEMQKLPNVRYVSFDFHHVCGTSNFDKLQVLYDQIQQEFDNQGYLLIDTEGNILEEQKGV 655
EM+KLP+VRYVSFDFH VCGT+NFD L VLY+QI EF+ QGY L+D + NILEEQKGV
Sbjct: 329 TEMEKLPDVRYVSFDFHQVCGTTNFDNLGVLYEQIGDEFEKQGYFLVDADENILEEQKGV 388
Query: 656 IRSNCIDCLDRTNVTQSYLAQKSLSLQLQRIGILSCTKCISMFSEECGKFRTLWAEQGDE 715
IRSNCIDCLDRTNVTQS++ QKSL+LQLQRIG+ T+CIS F ++ KFRT+WAEQGDE
Sbjct: 389 IRSNCIDCLDRTNVTQSFMGQKSLNLQLQRIGVCDSTECISTFEDDYTKFRTIWAEQGDE 448
Query: 716 ISIEYAGTYALKGDLVRYGKQTISGLIRDGMSSLSRYYLNNFQDGVRQDAMDLISGHYTV 775
+S++YAGTYALKGDLVRYGKQT++G I+DG+S++SRYYLNNFQDGVRQDA+DLISG YTV
Sbjct: 449 VSLQYAGTYALKGDLVRYGKQTMTGAIKDGLSAMSRYYLNNFQDGVRQDALDLISGRYTV 508
Query: 776 NRNSPSPFQLNGFE-SFSQYLSSVVWAGVTAGVLALVKAN-GTQ 817
+SPS Q G + SF S+++ GVT + +A TQ
Sbjct: 509 GTHSPSQLQPIGSQPSFLPVASALLIGGVTVTSFTIHQAGRNTQ 552
|
|
| TAIR|locus:2081780 RHD4 "AT3G51460" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156907 ATSAC1B "AT5G66020" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2042887 CXIP2 "CAX-interacting protein 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6GM29 sacm1l "Phosphatidylinositide phosphatase SAC1" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LJB6 LOC100739183 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QL88 SACM1L "Phosphatidylinositide phosphatase SAC1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|69223 Sacm1l "SAC1 suppressor of actin mutations 1-like (yeast)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NK59 SACM1L "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P4F0 SACM1L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.3 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | fgenesh4_pg.C_LG_XVI001095 | hypothetical protein (604 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 828 | |||
| pfam02383 | 298 | pfam02383, Syja_N, SacI homology domain | 4e-97 | |
| COG5329 | 570 | COG5329, COG5329, Phosphoinositide polyphosphatase | 4e-95 | |
| cd03028 | 90 | cd03028, GRX_PICOT_like, Glutaredoxin (GRX) family | 7e-46 | |
| TIGR00365 | 97 | TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 | 9e-41 | |
| cd10457 | 74 | cd10457, GIY-YIG_AtGrxS16, GIY-YIG domain found in | 9e-39 | |
| COG0278 | 105 | COG0278, COG0278, Glutaredoxin-related protein [Po | 1e-38 | |
| cd10450 | 70 | cd10450, GIY-YIG_AtGrxS16_like, GIY-YIG domain fou | 4e-31 | |
| PTZ00062 | 204 | PTZ00062, PTZ00062, glutaredoxin; Provisional | 5e-28 | |
| cd02066 | 72 | cd02066, GRX_family, Glutaredoxin (GRX) family; co | 2e-26 | |
| PRK10824 | 115 | PRK10824, PRK10824, glutaredoxin-4; Provisional | 3e-24 | |
| pfam00462 | 60 | pfam00462, Glutaredoxin, Glutaredoxin | 7e-18 | |
| cd10458 | 76 | cd10458, GIY-YIG_NifU, GIY-YIG domain found in iro | 3e-15 | |
| cd03419 | 82 | cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) fam | 3e-13 | |
| TIGR02180 | 84 | TIGR02180, GRX_euk, Glutaredoxin | 5e-11 | |
| COG0695 | 80 | COG0695, GrxC, Glutaredoxin and related proteins [ | 5e-10 | |
| TIGR02181 | 79 | TIGR02181, GRX_bact, Glutaredoxin, GrxC family | 2e-09 | |
| cd03418 | 75 | cd03418, GRX_GRXb_1_3_like, Glutaredoxin (GRX) fam | 2e-08 | |
| PRK10638 | 83 | PRK10638, PRK10638, glutaredoxin 3; Provisional | 2e-06 | |
| cd03031 | 147 | cd03031, GRX_GRX_like, Glutaredoxin (GRX) family, | 7e-06 | |
| cd00719 | 69 | cd00719, GIY-YIG_SF, GIY-YIG nuclease domain super | 1e-05 | |
| TIGR02190 | 79 | TIGR02190, GlrX-dom, Glutaredoxin-family domain | 6e-05 | |
| cd03030 | 92 | cd03030, GRX_SH3BGR, Glutaredoxin (GRX) family, SH | 3e-04 | |
| cd03029 | 72 | cd03029, GRX_hybridPRX5, Glutaredoxin (GRX) family | 0.001 | |
| cd10434 | 81 | cd10434, GIY-YIG_UvrC_Cho, Catalytic GIY-YIG domai | 0.001 | |
| TIGR02189 | 99 | TIGR02189, GlrX-like_plant, Glutaredoxin-like fami | 0.004 |
| >gnl|CDD|217007 pfam02383, Syja_N, SacI homology domain | Back alignment and domain information |
|---|
Score = 304 bits (781), Expect = 4e-97
Identities = 117/302 (38%), Positives = 177/302 (58%), Gaps = 31/302 (10%)
Query: 348 IYGVAGTIRLLAGKYVLVITSRKEAGTFLGFPVFRVTSMKFLHCNEAL-KFSNYQEKKDE 406
IYG+ G IRLL G Y++VIT + GT G ++++TS++F+ N + + +++KDE
Sbjct: 1 IYGILGLIRLLGGSYLIVITKASKVGTIRGHTIYKITSVEFIPLNSSEYDSESDKKEKDE 60
Query: 407 VYFMNLLKVVEATPGLYYSYETDITLNLQRRCKLAEGWMSKPIWKQADPRFVWNRNLLEE 466
+++ LLK + ++ Y+SY+ D+T +LQRR + S P+WK+AD RFVWN LL+
Sbjct: 61 EHYLKLLKKLLSSGSFYFSYDYDLTNSLQRRGLSS----SSPLWKRADDRFVWNSYLLKP 116
Query: 467 LIECKLKLND---------------------SPAVITLLSRRCNRRLGTRMWRRGANLEG 505
LI+ + L+D +TL+SRR +R GTR RRG + +G
Sbjct: 117 LIDFRSDLSDWLLPLIQGFVEQRTISVNGEGKKVTLTLISRRSRKRAGTRYNRRGIDDDG 176
Query: 506 DTANFIETEQLLETE-GFKSSLLQVRGSIPLLWEQIVDLSYKPRLKII-NHDQTPKVVER 563
+ ANF+ETEQ++ + G S +Q+RGS+PL WEQ +L YKP++KI + + T ++
Sbjct: 177 NVANFVETEQIVSDDSGRIFSFVQIRGSVPLFWEQDPNLKYKPKIKITRSSEATQPAFDK 236
Query: 564 HFHDLLQRYGEIVAVDLTDKHGDEGQLSAAYAAEMQKL---PNVRYVSFDFHHVCGTSNF 620
HF DL++RYG I V+L DK G E +LS AY + L ++Y FDFH C F
Sbjct: 237 HFDDLIKRYGPIYIVNLLDKKGSEKKLSEAYEEAINYLNENKKIKYTWFDFHAECKGMKF 296
Query: 621 DK 622
D
Sbjct: 297 DN 298
|
This Pfam family represents a protein domain which shows homology to the yeast protein SacI. The SacI homology domain is most notably found at the amino terminal of the inositol 5'-phosphatase synaptojanin. Length = 298 |
| >gnl|CDD|227637 COG5329, COG5329, Phosphoinositide polyphosphatase (Sac family) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|239326 cd03028, GRX_PICOT_like, Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188046 TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >gnl|CDD|198404 cd10457, GIY-YIG_AtGrxS16, GIY-YIG domain found in CAXIP1-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223355 COG0278, COG0278, Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|198397 cd10450, GIY-YIG_AtGrxS16_like, GIY-YIG domain found in CAXIP1-like proteins, iron-sulfur cluster assembly proteins, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240250 PTZ00062, PTZ00062, glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239017 cd02066, GRX_family, Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|182759 PRK10824, PRK10824, glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215931 pfam00462, Glutaredoxin, Glutaredoxin | Back alignment and domain information |
|---|
| >gnl|CDD|198405 cd10458, GIY-YIG_NifU, GIY-YIG domain found in iron-sulfur cluster assembly proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239511 cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|233765 TIGR02180, GRX_euk, Glutaredoxin | Back alignment and domain information |
|---|
| >gnl|CDD|223767 COG0695, GrxC, Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233766 TIGR02181, GRX_bact, Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >gnl|CDD|239510 cd03418, GRX_GRXb_1_3_like, Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|182607 PRK10638, PRK10638, glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239329 cd03031, GRX_GRX_like, Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >gnl|CDD|198380 cd00719, GIY-YIG_SF, GIY-YIG nuclease domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|131245 TIGR02190, GlrX-dom, Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >gnl|CDD|239328 cd03030, GRX_SH3BGR, Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif | Back alignment and domain information |
|---|
| >gnl|CDD|239327 cd03029, GRX_hybridPRX5, Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >gnl|CDD|198381 cd10434, GIY-YIG_UvrC_Cho, Catalytic GIY-YIG domain of nucleotide excision repair endonucleases UvrC, Cho, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233771 TIGR02189, GlrX-like_plant, Glutaredoxin-like family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 828 | |||
| KOG1889 | 579 | consensus Putative phosphoinositide phosphatase [L | 100.0 | |
| COG5329 | 570 | Phosphoinositide polyphosphatase (Sac family) [Sig | 100.0 | |
| KOG1890 | 949 | consensus Phosphoinositide phosphatase SAC1 [Lipid | 100.0 | |
| KOG1888 | 868 | consensus Putative phosphoinositide phosphatase [L | 100.0 | |
| KOG0566 | 1080 | consensus Inositol-1,4,5-triphosphate 5-phosphatas | 100.0 | |
| PF02383 | 319 | Syja_N: SacI homology domain; InterPro: IPR002013 | 100.0 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 99.92 | |
| COG0278 | 105 | Glutaredoxin-related protein [Posttranslational mo | 99.92 | |
| KOG0911 | 227 | consensus Glutaredoxin-related protein [Posttransl | 99.92 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 99.91 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 99.88 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 99.87 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 99.84 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 99.83 | |
| KOG1752 | 104 | consensus Glutaredoxin and related proteins [Postt | 99.81 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 99.64 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 99.64 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 99.63 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 99.63 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 99.61 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 99.6 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 99.58 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 99.58 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 99.56 | |
| cd03031 | 147 | GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d | 99.56 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 99.52 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 99.52 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 99.46 | |
| cd03030 | 92 | GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 | 99.37 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 99.37 | |
| PRK12759 | 410 | bifunctional gluaredoxin/ribonucleoside-diphosphat | 99.34 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 99.2 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 99.18 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 98.84 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 98.77 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 98.49 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 98.46 | |
| PF04908 | 99 | SH3BGR: SH3-binding, glutamic acid-rich protein; I | 98.29 | |
| KOG2824 | 281 | consensus Glutaredoxin-related protein [Posttransl | 98.28 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 98.08 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 98.08 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 97.92 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 97.91 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 97.69 | |
| cd03036 | 111 | ArsC_like Arsenate Reductase (ArsC) family, unknow | 97.6 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 97.59 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 97.55 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 97.5 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 97.49 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 97.44 | |
| cd02977 | 105 | ArsC_family Arsenate Reductase (ArsC) family; comp | 97.39 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 97.39 | |
| PRK01655 | 131 | spxA transcriptional regulator Spx; Reviewed | 97.27 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 97.26 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 97.22 | |
| PF05768 | 81 | DUF836: Glutaredoxin-like domain (DUF836); InterPr | 97.2 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 97.06 | |
| cd02975 | 113 | PfPDO_like_N Pyrococcus furiosus protein disulfide | 97.03 | |
| TIGR01617 | 117 | arsC_related transcriptional regulator, Spx/MgsR f | 97.03 | |
| cd03032 | 115 | ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub | 96.99 | |
| PRK12559 | 131 | transcriptional regulator Spx; Provisional | 96.91 | |
| PHA02125 | 75 | thioredoxin-like protein | 96.88 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 96.85 | |
| PRK13344 | 132 | spxA transcriptional regulator Spx; Reviewed | 96.85 | |
| cd03054 | 72 | GST_N_Metaxin GST_N family, Metaxin subfamily; com | 96.81 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 96.79 | |
| cd03035 | 105 | ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s | 96.73 | |
| TIGR01295 | 122 | PedC_BrcD bacteriocin transport accessory protein, | 96.66 | |
| cd03053 | 76 | GST_N_Phi GST_N family, Class Phi subfamily; compo | 96.39 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 96.36 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 96.36 | |
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 96.32 | |
| cd03033 | 113 | ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p | 96.29 | |
| cd03058 | 74 | GST_N_Tau GST_N family, Class Tau subfamily; GSTs | 96.28 | |
| cd03052 | 73 | GST_N_GDAP1 GST_N family, Ganglioside-induced diff | 96.21 | |
| cd03076 | 73 | GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar | 96.09 | |
| cd02953 | 104 | DsbDgamma DsbD gamma family; DsbD gamma is the C-t | 96.07 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 96.04 | |
| PF13409 | 70 | GST_N_2: Glutathione S-transferase, N-terminal dom | 96.01 | |
| COG4545 | 85 | Glutaredoxin-related protein [Posttranslational mo | 95.8 | |
| cd03042 | 73 | GST_N_Zeta GST_N family, Class Zeta subfamily; GST | 95.77 | |
| cd03049 | 73 | GST_N_3 GST_N family, unknown subfamily 3; compose | 95.73 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 95.72 | |
| KOG3029 | 370 | consensus Glutathione S-transferase-related protei | 95.7 | |
| cd03080 | 75 | GST_N_Metaxin_like GST_N family, Metaxin subfamily | 95.68 | |
| PHA02278 | 103 | thioredoxin-like protein | 95.68 | |
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 95.49 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 95.46 | |
| cd03039 | 72 | GST_N_Sigma_like GST_N family, Class Sigma_like; c | 95.31 | |
| cd02989 | 113 | Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior | 95.29 | |
| TIGR00014 | 114 | arsC arsenate reductase (glutaredoxin). composed o | 95.19 | |
| cd02954 | 114 | DIM1 Dim1 family; Dim1 is also referred to as U5 s | 95.16 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 95.15 | |
| PTZ00051 | 98 | thioredoxin; Provisional | 95.14 | |
| PRK10387 | 210 | glutaredoxin 2; Provisional | 95.04 | |
| COG1393 | 117 | ArsC Arsenate reductase and related proteins, glut | 94.98 | |
| cd03034 | 112 | ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s | 94.94 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 94.93 | |
| cd02985 | 103 | TRX_CDSP32 TRX family, chloroplastic drought-induc | 94.79 | |
| TIGR01616 | 126 | nitro_assoc nitrogenase-associated protein. This m | 94.79 | |
| cd03038 | 84 | GST_N_etherase_LigE GST_N family, Beta etherase Li | 94.78 | |
| cd03050 | 76 | GST_N_Theta GST_N family, Class Theta subfamily; c | 94.64 | |
| cd02955 | 124 | SSP411 TRX domain, SSP411 protein family; members | 94.62 | |
| PRK10026 | 141 | arsenate reductase; Provisional | 94.48 | |
| PRK10853 | 118 | putative reductase; Provisional | 94.46 | |
| cd03048 | 81 | GST_N_Ure2p_like GST_N family, Ure2p-like subfamil | 94.39 | |
| cd02951 | 125 | SoxW SoxW family; SoxW is a bacterial periplasmic | 94.37 | |
| cd02994 | 101 | PDI_a_TMX PDIa family, TMX subfamily; composed of | 93.94 | |
| cd03044 | 75 | GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo | 93.91 | |
| cd03043 | 73 | GST_N_1 GST_N family, unknown subfamily 1; compose | 93.86 | |
| TIGR01068 | 101 | thioredoxin thioredoxin. Several proteins, such as | 93.64 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 93.45 | |
| KOG4023 | 108 | consensus Uncharacterized conserved protein [Funct | 93.42 | |
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 93.41 | |
| PRK13728 | 181 | conjugal transfer protein TrbB; Provisional | 93.31 | |
| cd02959 | 117 | ERp19 Endoplasmic reticulum protein 19 (ERp19) fam | 93.2 | |
| cd02957 | 113 | Phd_like Phosducin (Phd)-like family; composed of | 93.07 | |
| cd02963 | 111 | TRX_DnaJ TRX domain, DnaJ domain containing protei | 92.98 | |
| PF14595 | 129 | Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. | 92.87 | |
| cd02948 | 102 | TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus | 92.82 | |
| PF00085 | 103 | Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio | 92.79 | |
| cd03047 | 73 | GST_N_2 GST_N family, unknown subfamily 2; compose | 92.63 | |
| PF01541 | 80 | GIY-YIG: GIY-YIG catalytic domain; InterPro: IPR00 | 92.52 | |
| cd02984 | 97 | TRX_PICOT TRX domain, PICOT (for PKC-interacting c | 92.29 | |
| PLN02817 | 265 | glutathione dehydrogenase (ascorbate) | 92.23 | |
| KOG0910 | 150 | consensus Thioredoxin-like protein [Posttranslatio | 92.12 | |
| cd02956 | 96 | ybbN ybbN protein family; ybbN is a hypothetical p | 92.01 | |
| cd03057 | 77 | GST_N_Beta GST_N family, Class Beta subfamily; GST | 91.96 | |
| PF03960 | 110 | ArsC: ArsC family; InterPro: IPR006660 Several bac | 91.9 | |
| PRK09381 | 109 | trxA thioredoxin; Provisional | 91.83 | |
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 91.75 | |
| cd02962 | 152 | TMX2 TMX2 family; composed of proteins similar to | 91.71 | |
| cd03000 | 104 | PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o | 91.61 | |
| PRK10996 | 139 | thioredoxin 2; Provisional | 91.23 | |
| cd02996 | 108 | PDI_a_ERp44 PDIa family, endoplasmic reticulum pro | 91.17 | |
| cd02993 | 109 | PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat | 91.08 | |
| cd03003 | 101 | PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam | 91.08 | |
| cd02950 | 142 | TxlA TRX-like protein A (TxlA) family; TxlA was or | 91.03 | |
| PF13098 | 112 | Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ | 91.0 | |
| PRK10877 | 232 | protein disulfide isomerase II DsbC; Provisional | 90.84 | |
| cd02961 | 101 | PDI_a_family Protein Disulfide Isomerase (PDIa) fa | 90.83 | |
| cd03046 | 76 | GST_N_GTT1_like GST_N family, Saccharomyces cerevi | 90.57 | |
| KOG0406 | 231 | consensus Glutathione S-transferase [Posttranslati | 90.56 | |
| PRK15113 | 214 | glutathione S-transferase; Provisional | 90.48 | |
| cd03005 | 102 | PDI_a_ERp46 PDIa family, endoplasmic reticulum pro | 90.28 | |
| cd02965 | 111 | HyaE HyaE family; HyaE is also called HupG and Hox | 90.02 | |
| cd03065 | 120 | PDI_b_Calsequestrin_N PDIb family, Calsequestrin s | 89.71 | |
| PLN02378 | 213 | glutathione S-transferase DHAR1 | 89.47 | |
| cd03004 | 104 | PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam | 88.96 | |
| PF13899 | 82 | Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ | 88.88 | |
| cd02987 | 175 | Phd_like_Phd Phosducin (Phd)-like family, Phd subf | 88.47 | |
| cd02952 | 119 | TRP14_like Human TRX-related protein 14 (TRP14)-li | 88.44 | |
| TIGR01126 | 102 | pdi_dom protein disulfide-isomerase domain. This m | 88.44 | |
| PRK10545 | 286 | nucleotide excision repair endonuclease; Provision | 88.37 | |
| cd03078 | 73 | GST_N_Metaxin1_like GST_N family, Metaxin subfamil | 88.23 | |
| PF13728 | 215 | TraF: F plasmid transfer operon protein | 87.62 | |
| cd03001 | 103 | PDI_a_P5 PDIa family, P5 subfamily; composed of eu | 87.59 | |
| cd03002 | 109 | PDI_a_MPD1_like PDI family, MPD1-like subfamily; c | 87.33 | |
| KOG1422 | 221 | consensus Intracellular Cl- channel CLIC, contains | 87.02 | |
| cd02986 | 114 | DLP Dim1 family, Dim1-like protein (DLP) subfamily | 86.93 | |
| smart00465 | 84 | GIYc GIY-YIG type nucleases (URI domain). | 86.66 | |
| PLN02473 | 214 | glutathione S-transferase | 86.6 | |
| KOG4244 | 281 | consensus Failed axon connections (fax) protein/gl | 86.56 | |
| cd03006 | 113 | PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil | 86.33 | |
| cd02999 | 100 | PDI_a_ERp44_like PDIa family, endoplasmic reticulu | 86.19 | |
| TIGR01262 | 210 | maiA maleylacetoacetate isomerase. Maleylacetoacet | 86.18 | |
| cd02998 | 105 | PDI_a_ERp38 PDIa family, endoplasmic reticulum pro | 85.93 | |
| cd03020 | 197 | DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil | 85.85 | |
| TIGR02740 | 271 | TraF-like TraF-like protein. This protein is relat | 84.6 | |
| PF06953 | 123 | ArsD: Arsenical resistance operon trans-acting rep | 83.58 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 83.27 | |
| PTZ00443 | 224 | Thioredoxin domain-containing protein; Provisional | 82.71 | |
| PRK00293 | 571 | dipZ thiol:disulfide interchange protein precursor | 82.3 | |
| PRK15412 | 185 | thiol:disulfide interchange protein DsbE; Provisio | 82.29 | |
| cd02992 | 114 | PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas | 81.85 | |
| PF11009 | 105 | DUF2847: Protein of unknown function (DUF2847); In | 81.52 | |
| COG3019 | 149 | Predicted metal-binding protein [General function | 81.31 | |
| cd03008 | 146 | TryX_like_RdCVF Tryparedoxin (TryX)-like family, R | 81.26 | |
| TIGR00385 | 173 | dsbE periplasmic protein thiol:disulfide oxidoredu | 81.17 | |
| cd03079 | 74 | GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me | 80.9 | |
| COG3634 | 520 | AhpF Alkyl hydroperoxide reductase, large subunit | 80.73 | |
| TIGR02739 | 256 | TraF type-F conjugative transfer system pilin asse | 80.18 |
| >KOG1889 consensus Putative phosphoinositide phosphatase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-149 Score=1230.35 Aligned_cols=530 Identities=41% Similarity=0.727 Sum_probs=495.7
Q ss_pred ccchhhhhcccceEEEEeCCCCCcc-EEEECCCCceeccCCCCCCCCCCceeeEEEEEEEEEecCceEEEEEeCeeeeee
Q 003337 296 LHDQLELLEFKDQYVIKSVESPDQG-FSIDRRDGNIEPLNDEACSGSPSQTSTIYGVAGTIRLLAGKYVLVITSRKEAGT 374 (828)
Q Consensus 296 Ll~~l~L~~t~d~~~i~~~~~~~~~-L~Idr~~g~i~~~~~~~~~~~~~~~~~i~GilG~I~l~~~~YLivIt~~~~Vg~ 374 (828)
+++++++|+.||+|+|+|.|++.+. |.|||.+|.+++++....+-.......|+|++|.|+|..+.||+|||+++.+|.
T Consensus 1 ~~~~l~l~~~pe~~~~e~~dg~gd~~l~i~r~~~~~~~i~~~~~~v~~~~~~~i~gv~G~ikL~~~~ylivvt~~~~vg~ 80 (579)
T KOG1889|consen 1 IYENLKLYENPEQFVIEPADGGGDSCLTIDRVDGVMKVIDAVKKPVPSSVIRSIFGVLGMIKLLAGSYLIVVTEAESVGQ 80 (579)
T ss_pred CCcceEEEEccceEEEEecCCCCceEEEEeccCCceEeeccccccCcccceeeeeeeeeEEEEecCcEEEEEEehhhhcc
Confidence 4678999999999999998776554 999999999998765443322226789999999999999999999999999999
Q ss_pred eCCceEEEEEeEEEEecCCccccccchhhhhhHHHHHHHHhHhcCCceEEeecccccchhhhhhhcccCCCCCCccccCC
Q 003337 375 FLGFPVFRVTSMKFLHCNEALKFSNYQEKKDEVYFMNLLKVVEATPGLYYSYETDITLNLQRRCKLAEGWMSKPIWKQAD 454 (828)
Q Consensus 375 i~gh~Iy~I~~~~~ip~~~~~~~~~~~~~~~E~~~~~llk~~~~~~~fYFSytyDLT~slQr~~~~~~~~~~~~~~~~~d 454 (828)
+.||.||+|+++++||+... +++++|.+.|..|.+||+.++++++|||||+||||+|+||+++..++....++|+++|
T Consensus 81 ~~gh~i~~v~~~~iIp~k~~--~~~~~q~k~~~~~~~lL~~~lkt~~fyfSyt~dlT~slqrl~~~~~~~~~~~l~~~ad 158 (579)
T KOG1889|consen 81 FNGHVIYRITDFEIIPYKKT--NLTEEQIKMETEFSNLLSHVLKTGGFYFSYTYDLTNSLQRLHENADEGKALSLWRRAD 158 (579)
T ss_pred ccCcceEEEeeeeEEEeecC--CchHHHHHHHHHHHHHHHHHHhcCceEEEEEEccchHHHhhhhccccccccchhhhcc
Confidence 99999999999999999876 5667788888899999999999999999999999999999999888888888999999
Q ss_pred CcceecHHhhHHHHhcc------------------eeccCcceEEEEEeeeccccccccccccCCCCCCCcceeEeeeEE
Q 003337 455 PRFVWNRNLLEELIECK------------------LKLNDSPAVITLLSRRCNRRLGTRMWRRGANLEGDTANFIETEQL 516 (828)
Q Consensus 455 ~rF~WN~~l~~~l~~~~------------------~~i~~~~~~~~LISRRS~~raGTRy~~RGiD~~G~vANfVETEqI 516 (828)
+||+||.+|++.|++.. +.++++.+.++||||||+.||||||++||+|++||||||||||||
T Consensus 159 ~rFlwN~~ll~~~~~~~~~~~f~lpvi~Gf~~~~~~~i~~~tv~l~lIsRRs~~RaGtRyfrRG~D~~G~vaNfvETEQI 238 (579)
T KOG1889|consen 159 KRFLWNGYLLEDLIDNAKVDLFILPVIQGFIGSVDVGINGKTVDLTLISRRSIRRAGTRYFRRGSDEDGYVANFVETEQI 238 (579)
T ss_pred cceeecchhHHHHhcCccccchhhHHhhhhhheeeEeeccceEEEEEeehhhhhccceeEEecccCCcccccccceeeEE
Confidence 99999999999999874 557899999999999999999999999999999999999999999
Q ss_pred EEeCCeeEEEEEeecCCCcceeeeccCCCCCceeecCCCCcHHHHHHHHHHHHHhcCCceEeeCCCCCCchhhHHHHHHH
Q 003337 517 LETEGFKSSLLQVRGSIPLLWEQIVDLSYKPRLKIINHDQTPKVVERHFHDLLQRYGEIVAVDLTDKHGDEGQLSAAYAA 596 (828)
Q Consensus 517 v~~~~~~~SfvQiRGSVPlfW~Q~~~l~~kP~i~i~~~~~~~~a~~kHF~~L~~~YG~i~~VNLl~~kg~E~~L~~~y~~ 596 (828)
+..++..+||||+|||||+||+|++||+|||.+.+...+++..||.+||++|++.||++++|||+|+||+|++|.++||+
T Consensus 239 v~~~~~~~SFvQ~RGSiP~~W~qv~nL~YkP~~~l~~~~~~~~~~~rhF~~~~~~YG~~v~VNLvnqKG~E~~l~~~ye~ 318 (579)
T KOG1889|consen 239 VEYNGHTTSFVQTRGSIPFFWEQVPNLRYKPKPVLVPPENALAAFGRHFDELRKKYGDVVAVNLVNQKGREGPLKEGYEK 318 (579)
T ss_pred EEecCcEEEEEEeccCccchHHhcCCCccCCceeecChHHHHHHHHHHHHHHHHHhCCEEEEEeecccCcccchhhHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHhhCCC--CcccccchhhhhcCCccchHHHHHHHHHHHHhhcCeeeEcCCCceeeeeceEEeeeccccccchhHHHHHH
Q 003337 597 EMQKLPN--VRYVSFDFHHVCGTSNFDKLQVLYDQIQQEFDNQGYLLIDTEGNILEEQKGVIRSNCIDCLDRTNVTQSYL 674 (828)
Q Consensus 597 ~v~~l~~--i~y~~fDfh~~ck~~~~~~l~~L~~~i~~~l~~~g~f~~~~~g~~~~~Q~GV~RtNClDCLDRTNvvQs~i 674 (828)
.+.++++ |+|++||||+||++|+|+|+++|++++++.++++|||..+++|+.+..|+||||||||||||||||+|+++
T Consensus 319 ~~~~~~~~~irYv~FDFHkec~~m~wdrl~lll~~ie~~~~~~gy~~~~~~g~~~~~Q~gvvRTNCmDCLDRTNVvQs~l 398 (579)
T KOG1889|consen 319 VVRRLNNPPIRYVHFDFHKECGHMRWDRLSLLLEQIEQELEEFGYFLLDSNGKTVLEQTGVVRTNCMDCLDRTNVVQSML 398 (579)
T ss_pred HHHhcCCCCceEEEeehhhhccccchhhHHHHHHHHHHHHHhcCEEEEecCCceeeeecCeeeccchhhccchhHHHHHH
Confidence 9999988 99999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHcCcccCCcccccChhHHHHHHHHHHHhhHHHHHhhhCCcCccCCeEEeeccchhhhHHhHHHHHhHhhh
Q 003337 675 AQKSLSLQLQRIGILSCTKCISMFSEECGKFRTLWAEQGDEISIEYAGTYALKGDLVRYGKQTISGLIRDGMSSLSRYYL 754 (828)
Q Consensus 675 a~~~L~~qL~~lgi~~~~~~~~~~~~~~~~f~~lWadnGD~iS~~YaGT~Alktd~tr~Gkrt~~g~l~D~~~S~~Ryy~ 754 (828)
|+++|+.||+.+|++..++++++.+.|+..|+++||||||.||+|||||+||||||||+||||..|+++||+||++|||+
T Consensus 399 ar~~L~~qL~~~gVl~~~~~le~~~~f~~~fk~iWAdngD~iS~qYSGT~ALKtDFtR~G~RT~~Ga~~Dg~Ns~~RYyl 478 (579)
T KOG1889|consen 399 ARWSLQKQLRKLGVLHAGQKLEEADPFESIFKNLWADNGDYISIQYSGTGALKTDFTRTGKRTIVGALKDGWNSFRRYYL 478 (579)
T ss_pred HHHHHHHHHHhcCeeccccchhhcccHHHHHHHhhhcccchhhhhccCCcccccceeeccceeehhhhHhHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccCchhhhhHHHhhccCcccCCCC--CCCCccc-chhH--------HH-------------HHHHHHHHHHHHHHHHHH
Q 003337 755 NNFQDGVRQDAMDLISGHYTVNRNS--PSPFQLN-GFES--------FS-------------QYLSSVVWAGVTAGVLAL 810 (828)
Q Consensus 755 NnF~Dg~rQd~idL~lG~~~~~~~~--~~p~~~~-~~~~--------~~-------------~~~~~~~~~~~~~~~~~~ 810 (828)
|||.||.||||||||||+|.|..+. .+|++.. .|.. ++ .+++.+||.++++++..+
T Consensus 479 NNf~DG~rQDsiDL~lG~f~v~~s~s~~~pl~~~~~~~~~~~p~i~lva~~m~~is~l~~~~~l~~~l~w~~~~~~s~~~ 558 (579)
T KOG1889|consen 479 NNFADGTRQDSIDLFLGNFRVDVSRSDLSPLPLRRGLYILAAPIIFLVALSMFIISLLFSTPNLLYRLFWFAIMVVSIAV 558 (579)
T ss_pred hcccCccccchHHHhcCCcccccccccCCCcccccCceeehhhHHHHHHHHHHHHHHHhCCchHHHHHHHHHHHHHHHHh
Confidence 9999999999999999999776554 5676644 1111 11 678899999999999999
Q ss_pred HHhcCccccccCCCCCC
Q 003337 811 VKANGTQFCSRPRLCGL 827 (828)
Q Consensus 811 i~~~g~~~v~~P~l~~~ 827 (828)
|+.||.||||||||+.+
T Consensus 559 i~~~g~~fvnwPrl~~p 575 (579)
T KOG1889|consen 559 ILINGDQFVNWPRLVLP 575 (579)
T ss_pred heechHHhcCCccccCc
Confidence 99999999999999876
|
|
| >COG5329 Phosphoinositide polyphosphatase (Sac family) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1890 consensus Phosphoinositide phosphatase SAC1 [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1888 consensus Putative phosphoinositide phosphatase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0566 consensus Inositol-1,4,5-triphosphate 5-phosphatase (synaptojanin), INP51/INP52/INP53 family [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF02383 Syja_N: SacI homology domain; InterPro: IPR002013 Synaptic vesicles are recycled with remarkable speed and precision in nerve terminals | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG2824 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >PRK01655 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding | Back alignment and domain information |
|---|
| >TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family | Back alignment and domain information |
|---|
| >cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes | Back alignment and domain information |
|---|
| >PRK12559 transcriptional regulator Spx; Provisional | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >PRK13344 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative | Back alignment and domain information |
|---|
| >cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B | Back alignment and domain information |
|---|
| >COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs | Back alignment and domain information |
|---|
| >PHA02278 thioredoxin-like protein | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif | Back alignment and domain information |
|---|
| >TIGR00014 arsC arsenate reductase (glutaredoxin) | Back alignment and domain information |
|---|
| >cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >PTZ00051 thioredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK10387 glutaredoxin 2; Provisional | Back alignment and domain information |
|---|
| >COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif | Back alignment and domain information |
|---|
| >TIGR01616 nitro_assoc nitrogenase-associated protein | Back alignment and domain information |
|---|
| >cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif | Back alignment and domain information |
|---|
| >PRK10026 arsenate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10853 putative reductase; Provisional | Back alignment and domain information |
|---|
| >cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation | Back alignment and domain information |
|---|
| >cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX | Back alignment and domain information |
|---|
| >cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >TIGR01068 thioredoxin thioredoxin | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4023 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >PRK13728 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain | Back alignment and domain information |
|---|
| >cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions | Back alignment and domain information |
|---|
| >cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain | Back alignment and domain information |
|---|
| >PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A | Back alignment and domain information |
|---|
| >cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein | Back alignment and domain information |
|---|
| >PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >PF01541 GIY-YIG: GIY-YIG catalytic domain; InterPro: IPR000305 During the process of Escherichia coli nucleotide excision repair, DNA damage recognition and processing are achieved by the action of the uvrA, uvrB, and uvrC gene products [] | Back alignment and domain information |
|---|
| >cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >PLN02817 glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] | Back alignment and domain information |
|---|
| >PRK09381 trxA thioredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
| >cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library | Back alignment and domain information |
|---|
| >cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus | Back alignment and domain information |
|---|
| >PRK10996 thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases | Back alignment and domain information |
|---|
| >cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus | Back alignment and domain information |
|---|
| >PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A | Back alignment and domain information |
|---|
| >PRK10877 protein disulfide isomerase II DsbC; Provisional | Back alignment and domain information |
|---|
| >cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15113 glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO | Back alignment and domain information |
|---|
| >cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >PLN02378 glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A | Back alignment and domain information |
|---|
| >cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions | Back alignment and domain information |
|---|
| >cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 | Back alignment and domain information |
|---|
| >TIGR01126 pdi_dom protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >PRK10545 nucleotide excision repair endonuclease; Provisional | Back alignment and domain information |
|---|
| >cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi | Back alignment and domain information |
|---|
| >PF13728 TraF: F plasmid transfer operon protein | Back alignment and domain information |
|---|
| >cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 | Back alignment and domain information |
|---|
| >smart00465 GIYc GIY-YIG type nucleases (URI domain) | Back alignment and domain information |
|---|
| >PLN02473 glutathione S-transferase | Back alignment and domain information |
|---|
| >KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox | Back alignment and domain information |
|---|
| >cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 | Back alignment and domain information |
|---|
| >TIGR01262 maiA maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >TIGR02740 TraF-like TraF-like protein | Back alignment and domain information |
|---|
| >PF06953 ArsD: Arsenical resistance operon trans-acting repressor ArsD; InterPro: IPR010712 This family consists of several bacterial arsenical resistance operon trans-acting repressor ArsD proteins | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >PTZ00443 Thioredoxin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional | Back alignment and domain information |
|---|
| >PRK15412 thiol:disulfide interchange protein DsbE; Provisional | Back alignment and domain information |
|---|
| >cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein | Back alignment and domain information |
|---|
| >PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol | Back alignment and domain information |
|---|
| >COG3019 Predicted metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors | Back alignment and domain information |
|---|
| >TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily | Back alignment and domain information |
|---|
| >cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 828 | ||||
| 3lwt_X | 505 | Crystal Structure Of The Yeast Sac1: Implications F | 3e-64 | ||
| 2lku_A | 109 | Solution Structure Of Reduced Poplar Apo Grxs14 Len | 7e-23 | ||
| 3ipz_A | 109 | Crystal Structure Of Arabidopsis Monothiol Glutared | 3e-22 | ||
| 2wul_A | 118 | Crystal Structure Of The Human Glutaredoxin 5 With | 9e-22 | ||
| 2yan_A | 105 | Crystal Structure Of The Second Glutaredoxin Domain | 1e-19 | ||
| 2wci_A | 135 | Structure Of E. Coli Monothiol Glutaredoxin Grx4 Ho | 2e-19 | ||
| 1yka_A | 115 | Solution Structure Of Grx4, A Monothiol Glutaredoxi | 5e-19 | ||
| 3gx8_A | 121 | Structural And Biochemical Characterization Of Yeas | 6e-18 | ||
| 1wik_A | 109 | Solution Structure Of The Picot Homology 2 Domain O | 3e-17 | ||
| 3zyw_A | 111 | Crystal Structure Of The First Glutaredoxin Domain | 8e-15 | ||
| 1kte_A | 105 | Crystal Structure Of Thioltransferase At 2.2 Angstr | 4e-06 | ||
| 1jhb_A | 106 | Human Glutaredoxin In Fully Reduced Form, Nmr, 20 S | 2e-05 | ||
| 2cq9_A | 130 | Solution Structure Of Rsgi Ruh-044, An N-Terminal D | 3e-05 | ||
| 2ht9_A | 146 | The Structure Of Dimeric Human Glutaredoxin 2 Lengt | 3e-05 | ||
| 2klx_A | 89 | Solution Structure Of Glutaredoxin From Bartonella | 5e-05 | ||
| 3fz9_A | 112 | Crystal Structure Of Poplar Glutaredoxin S12 In Com | 8e-05 | ||
| 2fls_A | 132 | Crystal Structure Of Human Glutaredoxin 2 Complexed | 8e-05 | ||
| 1b4q_A | 105 | Solution Structure Of Human Thioltransferase Comple | 2e-04 | ||
| 2khp_A | 92 | Solution Structure Of Glutaredoxin From Brucella Me | 3e-04 | ||
| 3grx_A | 82 | Nmr Structure Of Escherichia Coli Glutaredoxin 3-Gl | 5e-04 | ||
| 3h8q_A | 114 | Crystal Structure Of Glutaredoxin Domain Of Human T | 6e-04 | ||
| 2e7p_A | 116 | Crystal Structure Of The Holo Form Of Glutaredoxin | 7e-04 | ||
| 1z7p_A | 117 | Solution Structure Of Reduced Glutaredoxin C1 From | 7e-04 |
| >pdb|3LWT|X Chain X, Crystal Structure Of The Yeast Sac1: Implications For Its Phosphoinositide Phosphatase Function Length = 505 | Back alignment and structure |
|
| >pdb|2LKU|A Chain A, Solution Structure Of Reduced Poplar Apo Grxs14 Length = 109 | Back alignment and structure |
| >pdb|3IPZ|A Chain A, Crystal Structure Of Arabidopsis Monothiol Glutaredoxin Atgr Length = 109 | Back alignment and structure |
| >pdb|2WUL|A Chain A, Crystal Structure Of The Human Glutaredoxin 5 With Bound Glutathione In An Fes Cluster Length = 118 | Back alignment and structure |
| >pdb|2YAN|A Chain A, Crystal Structure Of The Second Glutaredoxin Domain Of Human Txnl2 Length = 105 | Back alignment and structure |
| >pdb|2WCI|A Chain A, Structure Of E. Coli Monothiol Glutaredoxin Grx4 Homodimer Length = 135 | Back alignment and structure |
| >pdb|1YKA|A Chain A, Solution Structure Of Grx4, A Monothiol Glutaredoxin From E. Coli Length = 115 | Back alignment and structure |
| >pdb|3GX8|A Chain A, Structural And Biochemical Characterization Of Yeast Monothiol Glutaredoxin Grx5 Length = 121 | Back alignment and structure |
| >pdb|1WIK|A Chain A, Solution Structure Of The Picot Homology 2 Domain Of The Mouse Pkc-Interacting Cousin Of Thioredoxin Protein Length = 109 | Back alignment and structure |
| >pdb|3ZYW|A Chain A, Crystal Structure Of The First Glutaredoxin Domain Of Human Glutaredoxin 3 (Glrx3) Length = 111 | Back alignment and structure |
| >pdb|1KTE|A Chain A, Crystal Structure Of Thioltransferase At 2.2 Angstrom Resolution Length = 105 | Back alignment and structure |
| >pdb|1JHB|A Chain A, Human Glutaredoxin In Fully Reduced Form, Nmr, 20 Structures Length = 106 | Back alignment and structure |
| >pdb|2CQ9|A Chain A, Solution Structure Of Rsgi Ruh-044, An N-Terminal Domain Of Glutaredoxin 2 From Human Cdna Length = 130 | Back alignment and structure |
| >pdb|2HT9|A Chain A, The Structure Of Dimeric Human Glutaredoxin 2 Length = 146 | Back alignment and structure |
| >pdb|2KLX|A Chain A, Solution Structure Of Glutaredoxin From Bartonella Henselae Str. Houston Length = 89 | Back alignment and structure |
| >pdb|3FZ9|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12 In Complex With Glutathione Length = 112 | Back alignment and structure |
| >pdb|2FLS|A Chain A, Crystal Structure Of Human Glutaredoxin 2 Complexed With Glutathione Length = 132 | Back alignment and structure |
| >pdb|1B4Q|A Chain A, Solution Structure Of Human Thioltransferase Complex With Glutathione Length = 105 | Back alignment and structure |
| >pdb|2KHP|A Chain A, Solution Structure Of Glutaredoxin From Brucella Melitensis Length = 92 | Back alignment and structure |
| >pdb|3GRX|A Chain A, Nmr Structure Of Escherichia Coli Glutaredoxin 3-Glutathione Mixed Disulfide Complex, 20 Structures Length = 82 | Back alignment and structure |
| >pdb|3H8Q|A Chain A, Crystal Structure Of Glutaredoxin Domain Of Human Thioredoxin Reductase 3 Length = 114 | Back alignment and structure |
| >pdb|2E7P|A Chain A, Crystal Structure Of The Holo Form Of Glutaredoxin C1 From Populus Tremula X Tremuloides Length = 116 | Back alignment and structure |
| >pdb|1Z7P|A Chain A, Solution Structure Of Reduced Glutaredoxin C1 From Populus Tremula X Tremuloides Length = 117 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3lwt_X Phosphoinositide phosphatase SAC1; SAC3/FIG4, lipid metabol endoplasmic reticulum, hydrolase, membrane, transmembrane; 1.96A {Saccharomyces cerevisiae} Length = 505 | Back alignment and structure |
|---|
Score = 372 bits (956), Expect = e-120
Identities = 155/505 (30%), Positives = 239/505 (47%), Gaps = 51/505 (10%)
Query: 306 KDQYVIKSVESP---DQGFSIDRRDGNIEPLNDEACSGSPSQTSTIYGVAGTIRLLAGKY 362
D K E D + +D + L E + I + G I+L +Y
Sbjct: 12 ADGIFFKLAEGKGTNDAVIHLANQDQGVRVLGAEEFPVQ-GEVVKIASLMGFIKLKLNRY 70
Query: 363 VLVITSRKEAGTFLGFPVFRVTSMKFLHCNEALKFSNYQEKKDEVYFMNLLKVVEATPGL 422
++ + +E G F G +RV + N + +E ++ LL++
Sbjct: 71 AIIANTVEETGRFNGHVFYRVLQHSIVSTKF-----NSRIDSEEAEYIKLLELHLKNSTF 125
Query: 423 YYSYETDITLNLQRRCKLAEGWMSKPIWKQADPRFVWNRNLLEELIEC------------ 470
Y+SY D+T +LQR K+ WK AD RF WN L E+L
Sbjct: 126 YFSYTYDLTNSLQRNEKVG----PAASWKTADERFFWNHYLTEDLRNFAHQDPRIDSFIQ 181
Query: 471 ----------KLKLNDSPAVITLLSRRCNRRLGTRMWRRGANLEGDTANFIETEQLLETE 520
LN +P V+ L++RR R GTR +RRG + +G+ NF ETEQ+L E
Sbjct: 182 PVIYGYAKTVDAVLNATPIVLGLITRRSIFRAGTRYFRRGVDKDGNVGNFNETEQILLAE 241
Query: 521 GFKS------SLLQVRGSIPLLWEQIVDLSYKPRLKIINHDQTPKVVERHFHDLLQRYGE 574
+S S LQ RGS+P+ W +I +L YKP ++ + + ++HF + YG+
Sbjct: 242 NPESEKIHVFSFLQTRGSVPIYWAEINNLKYKP--NLVLGENSLDATKKHFDQQKELYGD 299
Query: 575 IVAVDLTDKHGDEGQLSAAYAAEMQKL--PNVRYVSFDFHHVCGTSNFDKLQVLYDQI-- 630
V+L ++ G E + Y + + L P + YV FDFHH C + ++++L D +
Sbjct: 300 NYLVNLVNQKGHELPVKEGYESVVHALNDPKIHYVYFDFHHECRKMQWHRVKLLIDHLEK 359
Query: 631 ----QQEFDNQGYLLIDTEGNILEEQKGVIRSNCIDCLDRTNVTQSYLAQKSLSLQLQRI 686
++F ++ I+ EQ V+R+NC+DCLDRTNV QS LAQ L + +
Sbjct: 360 LGLSNEDFFHKVIDSNGNTVEIVNEQHSVVRTNCMDCLDRTNVVQSVLAQWVLQKEFESA 419
Query: 687 GILSCTKCISMFSEECGKFRTLWAEQGDEISIEYAGTYALKGDLVRYGKQTISGLIRDGM 746
+++ + ++ LWA+ D +S+ Y+GT ALK D R GK+T G D +
Sbjct: 420 DVVATGSTWEDNAPLLTSYQNLWADNADAVSVAYSGTGALKTDFTRTGKRTRLGAFNDFL 479
Query: 747 SSLSRYYLNNFQDGVRQDAMDLISG 771
+S SRYY NN+ DG RQD+ DL G
Sbjct: 480 NSASRYYQNNWTDGPRQDSYDLFLG 504
|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} Length = 109 | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Length = 109 | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Length = 135 | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Length = 121 | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Length = 116 | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Length = 105 | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Length = 118 | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Length = 113 | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 130 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Length = 146 | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Length = 127 | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Length = 114 | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Length = 129 | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Length = 82 | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Length = 92 | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} Length = 99 | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Length = 362 | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Length = 89 | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Length = 92 | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Length = 89 | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Length = 93 | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Length = 85 | Back alignment and structure |
|---|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Length = 121 | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Length = 103 | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Length = 87 | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Length = 81 | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Length = 75 | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Length = 241 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 828 | |||
| 3lwt_X | 505 | Phosphoinositide phosphatase SAC1; SAC3/FIG4, lipi | 100.0 | |
| 2wul_A | 118 | Glutaredoxin related protein 5; chromosome 14 open | 99.93 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 99.88 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 99.88 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 99.88 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 99.87 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 99.81 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 99.8 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 99.8 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 99.8 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 99.79 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 99.74 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 99.73 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 99.69 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 99.68 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 99.67 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 99.66 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 99.64 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 99.61 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 99.6 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 99.6 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 99.6 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 99.56 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 99.55 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 99.51 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 99.43 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 99.42 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 99.4 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 99.38 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 99.34 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 99.26 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 99.25 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 99.21 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 99.17 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 99.11 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 99.02 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 98.99 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 98.8 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 98.62 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 98.56 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 98.44 | |
| 2axo_A | 270 | Hypothetical protein ATU2684; alpha beta protein., | 98.26 | |
| 1rw1_A | 114 | Conserved hypothetical protein YFFB; thioredoxin f | 98.22 | |
| 1z3e_A | 132 | Regulatory protein SPX; bacterial transcription re | 98.16 | |
| 2kok_A | 120 | Arsenate reductase; brucellosis, zoonotic, oxidore | 98.16 | |
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 97.97 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 97.67 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 97.59 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 97.49 | |
| 3gkx_A | 120 | Putative ARSC family related protein; ARSC family | 97.48 | |
| 3l78_A | 120 | Regulatory protein SPX; transcription, transcripti | 97.47 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 97.45 | |
| 3rdw_A | 121 | Putative arsenate reductase; structural genomics, | 97.43 | |
| 1s3c_A | 141 | Arsenate reductase; ARSC, arsenite, oxidoreductase | 97.38 | |
| 3f0i_A | 119 | Arsenate reductase; structural genomics, IDP01300, | 97.33 | |
| 3fz4_A | 120 | Putative arsenate reductase; APC61768, structural | 97.3 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 97.19 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 97.12 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 96.95 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 96.73 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 96.71 | |
| 3iv4_A | 112 | Putative oxidoreductase; APC23140, meticillin-resi | 96.67 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 96.67 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 96.65 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 96.6 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 96.53 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 96.52 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 96.5 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 96.45 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 96.43 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 96.35 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 96.3 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 96.3 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 96.29 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 96.25 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 96.24 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 96.24 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 96.22 | |
| 4f03_A | 253 | Glutathione transferase; GST fold; 1.80A {Phaneroc | 96.17 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 96.17 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 96.17 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 96.15 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 96.13 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 96.11 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 96.09 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 96.04 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 96.02 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 95.95 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 95.94 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 95.9 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 95.89 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 95.89 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 95.86 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 95.86 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 95.85 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 95.83 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 95.8 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 95.79 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 95.77 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 95.75 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 95.75 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 95.75 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 95.71 | |
| 1yd6_A | 99 | UVRC; DNA binding protein; 2.00A {Bacillus caldote | 95.66 | |
| 4g10_A | 265 | Glutathione S-transferase homolog; thioredoxin fol | 95.64 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 95.63 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 95.62 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 95.6 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 95.58 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 95.5 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 95.48 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 95.46 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 95.43 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 95.34 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 95.3 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 95.29 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 95.28 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 95.26 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 95.23 | |
| 3zzx_A | 105 | Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va | 95.22 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 95.2 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 95.18 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 95.16 | |
| 1yd0_A | 96 | Uvrabc system protein C; DNA binding protein; 1.50 | 95.16 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 95.15 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 95.1 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 95.08 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 95.06 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 95.05 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 95.03 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 95.02 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 95.01 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 95.0 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 94.95 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 94.92 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 94.9 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 94.89 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 94.82 | |
| 1eej_A | 216 | Thiol:disulfide interchange protein; oxidoreductas | 94.81 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 94.77 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 94.77 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 94.75 | |
| 1t3b_A | 211 | Thiol:disulfide interchange protein DSBC; oxidored | 94.72 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 94.71 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 94.68 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 94.66 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 94.66 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 94.66 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 94.6 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 94.58 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 94.58 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 94.58 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 94.58 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 94.56 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 94.53 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 94.52 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 94.48 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 94.48 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 94.45 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 94.45 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 94.43 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 94.41 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 94.41 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 94.4 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 94.39 | |
| 2dj0_A | 137 | Thioredoxin-related transmembrane protein 2; AVLA2 | 94.36 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 94.3 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 94.29 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 94.26 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 94.25 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 94.22 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 94.21 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 94.2 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 94.12 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 94.1 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 94.09 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 94.07 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 94.06 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 94.02 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 93.94 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 93.93 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 93.84 | |
| 3ph9_A | 151 | Anterior gradient protein 3 homolog; thioredoxin f | 93.83 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 93.83 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 93.73 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 93.73 | |
| 4glt_A | 225 | Glutathione S-transferase-like protein; structural | 93.7 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 93.66 | |
| 1wou_A | 123 | Thioredoxin -related protein, 14 kDa; electron tra | 93.65 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 93.63 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 93.61 | |
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 93.55 | |
| 3gyk_A | 175 | 27KDA outer membrane protein; APC61738.2, siliciba | 93.43 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 93.4 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 93.39 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 93.38 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 93.34 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 93.34 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 93.31 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 93.3 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 93.22 | |
| 1wmj_A | 130 | Thioredoxin H-type; structural genomics, program f | 93.15 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 93.14 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 93.13 | |
| 1qgv_A | 142 | Spliceosomal protein U5-15KD; snRNP, thioredoxin, | 93.0 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 92.89 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 92.83 | |
| 1z6n_A | 167 | Hypothetical protein PA1234; alpha-beta-alpha sand | 92.69 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 92.62 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 92.55 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 92.54 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 92.27 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 92.12 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 91.98 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 91.95 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 91.2 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 91.88 | |
| 3eur_A | 142 | Uncharacterized protein; PSI2,MCSG, conserved prot | 91.86 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 91.71 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 91.62 | |
| 3ewl_A | 142 | Uncharacterized conserved protein BF1870; alpha-be | 91.39 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 90.72 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 91.2 | |
| 2qgv_A | 140 | Hydrogenase-1 operon protein HYAE; alpha-beta prot | 91.18 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 91.08 | |
| 3or5_A | 165 | Thiol:disulfide interchange protein, thioredoxin p | 91.06 | |
| 4id0_A | 214 | Glutathione S-transferase-like protein YIBF; GST, | 91.0 | |
| 1z6m_A | 175 | Conserved hypothetical protein; structural genomic | 90.99 | |
| 3ira_A | 173 | Conserved protein; methanosarcina mazei,structural | 90.92 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 90.79 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 90.71 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 90.67 | |
| 4ikh_A | 244 | Glutathione S-transferase; enzyme function initiat | 90.66 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 90.66 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 90.58 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 90.56 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 90.51 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 90.35 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 90.34 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 90.28 | |
| 3gv1_A | 147 | Disulfide interchange protein; neisseria gonorrhoe | 90.03 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 89.8 | |
| 1o73_A | 144 | Tryparedoxin; electron transport, trypanosomatid, | 89.72 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 89.68 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 89.53 | |
| 1kng_A | 156 | Thiol:disulfide interchange protein CYCY; thioredo | 89.46 | |
| 2hyx_A | 352 | Protein DIPZ; thioredoxin fold, jelly-roll, struct | 89.39 | |
| 2qsi_A | 137 | Putative hydrogenase expression/formation protein; | 89.34 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 89.12 | |
| 3ha9_A | 165 | Uncharacterized thioredoxin-like protein; PSI, MCS | 89.02 | |
| 1mk0_A | 97 | Intron-associated endonuclease 1; alpha/beta fold, | 88.94 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 88.87 | |
| 2djj_A | 121 | PDI, protein disulfide-isomerase; thioredoxin fold | 88.58 | |
| 1v58_A | 241 | Thiol:disulfide interchange protein DSBG; reduced | 88.58 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 88.54 | |
| 1o8x_A | 146 | Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot | 88.42 | |
| 1sen_A | 164 | Thioredoxin-like protein P19; endoplasmic reticulu | 88.4 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 88.3 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 88.27 | |
| 2dlx_A | 153 | UBX domain-containing protein 7; UAS domain, prote | 88.27 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 88.0 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 87.98 | |
| 3evi_A | 118 | Phosducin-like protein 2; alpha beta, 3-layer(ABA) | 87.9 | |
| 3ga4_A | 178 | Dolichyl-diphosphooligosaccharide-protein glycosyl | 87.74 | |
| 4hz4_A | 217 | Glutathione-S-transferase; enzyme function initiat | 87.25 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 87.19 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 87.05 | |
| 1i5g_A | 144 | Tryparedoxin II; electron transport; HET: TS5; 1.4 | 86.85 | |
| 2b1k_A | 168 | Thiol:disulfide interchange protein DSBE; C-termin | 86.83 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 86.76 | |
| 2lrt_A | 152 | Uncharacterized protein; structural genomics, thio | 86.58 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 86.31 | |
| 3dml_A | 116 | Putative uncharacterized protein; thioredoxin, oxi | 86.21 | |
| 2trc_P | 217 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 86.07 | |
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 86.06 | |
| 2es7_A | 142 | Q8ZP25_salty, putative thiol-disulfide isomerase a | 85.81 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 85.73 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 85.65 | |
| 3ia1_A | 154 | THIO-disulfide isomerase/thioredoxin; oxidoreducta | 85.54 | |
| 3s9f_A | 165 | Tryparedoxin; thioredoxin fold, disulfide reductas | 85.54 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 85.41 | |
| 3h93_A | 192 | Thiol:disulfide interchange protein DSBA; disulfid | 84.89 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 84.87 | |
| 3f9u_A | 172 | Putative exported cytochrome C biogenesis-related; | 84.78 | |
| 3hd5_A | 195 | Thiol:disulfide interchange protein DSBA; protein | 84.44 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 84.32 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 84.3 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 84.29 | |
| 3kcm_A | 154 | Thioredoxin family protein; SGX, thioredoxin prote | 83.33 | |
| 1a0r_P | 245 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 82.55 | |
| 2dbc_A | 135 | PDCL2, unnamed protein product; phosducin-like pro | 82.22 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 81.99 | |
| 3raz_A | 151 | Thioredoxin-related protein; structural genomics, | 81.72 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 81.69 | |
| 2l5o_A | 153 | Putative thioredoxin; structural genomics, unknown | 81.04 | |
| 3ktb_A | 106 | Arsenical resistance operon trans-acting represso; | 80.97 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 80.88 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 80.68 |
| >3lwt_X Phosphoinositide phosphatase SAC1; SAC3/FIG4, lipid metabol endoplasmic reticulum, hydrolase, membrane, transmembrane; 1.96A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.8e-129 Score=1115.54 Aligned_cols=462 Identities=33% Similarity=0.577 Sum_probs=375.2
Q ss_pred hhhhhcccceEEEEeCCC---CCccEEEECCCCceeccCCCCCCCCCCceeeEEEEEEEEEecCceEEEEEeCeeeeeee
Q 003337 299 QLELLEFKDQYVIKSVES---PDQGFSIDRRDGNIEPLNDEACSGSPSQTSTIYGVAGTIRLLAGKYVLVITSRKEAGTF 375 (828)
Q Consensus 299 ~l~L~~t~d~~~i~~~~~---~~~~L~Idr~~g~i~~~~~~~~~~~~~~~~~i~GilG~I~l~~~~YLivIt~~~~Vg~i 375 (828)
.+...++||+|+|+|.++ .+..|.|||.+|++++.+..+. .....++.|+||+|+|+|.++.||+|||+++.||.|
T Consensus 5 ~~~~~~~~~~~~~~~~~~~~~~~~~l~i~r~~~~~~~~~~~~~-~~~~~~~~i~GilG~i~l~~~~YlivIT~~~~vg~i 83 (505)
T 3lwt_X 5 PIVYVQNADGIFFKLAEGKGTNDAVIHLANQDQGVRVLGAEEF-PVQGEVVKIASLMGFIKLKLNRYAIIANTVEETGRF 83 (505)
T ss_dssp CEEEEEETTEEEEEESSCCSSCCCEEEEETTTCCEEEECGGGS-CSSSCCEEESEEEEEEEETTEEEEEEEEEEEEEEEE
T ss_pred ceeEEECCCEEEEEECCCCCCCcceEEEEcCCCeEEecccccC-CCcCceeEEEEEEEEEEECCCcEEEEEEccEEEEEE
Confidence 345667999999999764 2334999999999999753221 133458899999999999999999999999999999
Q ss_pred CCceEEEEEeEEEEecCCccccccchhhhhhHHHHHHHHhHhcCCceEEeecccccchhhhhhhcccCCCCCCccccCCC
Q 003337 376 LGFPVFRVTSMKFLHCNEALKFSNYQEKKDEVYFMNLLKVVEATPGLYYSYETDITLNLQRRCKLAEGWMSKPIWKQADP 455 (828)
Q Consensus 376 ~gh~Iy~I~~~~~ip~~~~~~~~~~~~~~~E~~~~~llk~~~~~~~fYFSytyDLT~slQr~~~~~~~~~~~~~~~~~d~ 455 (828)
.||.||+|+++++||+..+. .++++|.+|+++|+.++++++|||||+||||+++|++..... .+.|+.+|+
T Consensus 84 ~gh~Iy~I~~~~~ipl~~~~-----~~~~~E~~yl~ll~~~l~s~~FYfS~~yDLT~slQ~~~~~~~----~~~~~~~d~ 154 (505)
T 3lwt_X 84 NGHVFYRVLQHSIVSTKFNS-----RIDSEEAEYIKLLELHLKNSTFYFSYTYDLTNSLQRNEKVGP----AASWKTADE 154 (505)
T ss_dssp TTEEEEEEEEEEEEESCTTC-----CCCHHHHHHHHHHHHHHHHCCCEECSSSCTTSCHHHHHHHCS----CCCGGGSCT
T ss_pred CCeEEEEEEEEEEEEecCcc-----ccChhHHHHHHHHHHHhcCCCEEEeCCcCCCcchhhccccCc----cccccCCCC
Confidence 99999999999999998542 356789999999999999999999999999999999875432 378999999
Q ss_pred cceecHHhhHHHHhcc----------------------eeccCcceEEEEEeeeccccccccccccCCCCCCCcceeEee
Q 003337 456 RFVWNRNLLEELIECK----------------------LKLNDSPAVITLLSRRCNRRLGTRMWRRGANLEGDTANFIET 513 (828)
Q Consensus 456 rF~WN~~l~~~l~~~~----------------------~~i~~~~~~~~LISRRS~~raGTRy~~RGiD~~G~vANfVET 513 (828)
||+||++|+++|++.. +.++++.+.++||||||++||||||++||||++|||||||||
T Consensus 155 ~F~WN~~l~~~l~~~~~~~~~~~~~~~piI~Gfv~~~~~~~~~~~~~~tLISRRS~~raGtRy~~RGidd~G~VANfVET 234 (505)
T 3lwt_X 155 RFFWNHYLTEDLRNFAHQDPRIDSFIQPVIYGYAKTVDAVLNATPIVLGLITRRSIFRAGTRYFRRGVDKDGNVGNFNET 234 (505)
T ss_dssp TTCTTTGGGHHHHHHHTTCGGGGGGCCCCBSSEEEEEEEEETTEEEEEEEEEEECCCCCSSSCCSSSBCTTSCCSCEEEE
T ss_pred ceechHHHHHHHHHhcccCcchhhhhhHhhcCceEEEEEEECCceEEEEEEEEEecccCCccccccCcCCCCCccceeeE
Confidence 9999999999998731 345789999999999999999999999999999999999999
Q ss_pred eEEEEeCC------eeEEEEEeecCCCcceeeeccCCCCCceeecCCCCcHHHHHHHHHHHHHhcCCceEeeCCCCCCch
Q 003337 514 EQLLETEG------FKSSLLQVRGSIPLLWEQIVDLSYKPRLKIINHDQTPKVVERHFHDLLQRYGEIVAVDLTDKHGDE 587 (828)
Q Consensus 514 EqIv~~~~------~~~SfvQiRGSVPlfW~Q~~~l~~kP~i~i~~~~~~~~a~~kHF~~L~~~YG~i~~VNLl~~kg~E 587 (828)
|||++.++ .++||||+||||||||+|.++++|||+|.+. +++.+||++||++|.++||+++|||||++|++|
T Consensus 235 EqIv~~~~~~~~~~~~~SfvQiRGSVPlfW~Q~~~l~~kP~i~i~--~~~~~a~~kHF~~L~~~YG~~~iVNLl~~k~~E 312 (505)
T 3lwt_X 235 EQILLAENPESEKIHVFSFLQTRGSVPIYWAEINNLKYKPNLVLG--ENSLDATKKHFDQQKELYGDNYLVNLVNQKGHE 312 (505)
T ss_dssp EEEEEEECTTTCCEEEEEEEEEEECCCSBSCCCCCSSSCCCCCCC--HHHHHHHHHHHHHHHHHHSEEEEEEECCCSSCC
T ss_pred EEEEEeCCCCCCCccEEEEEEeccccCceeeecCCcCcCCCeeec--CchHHHHHHHHHHHHHHhCCcEEEecccCCCch
Confidence 99999887 8999999999999999999999999999885 448999999999999999999999999999999
Q ss_pred hhHHHHHHHHHhhCCC--CcccccchhhhhcCCccchHHHHHHHHHHH-HhhcCeeeEc--CC---CceeeeeceEEeee
Q 003337 588 GQLSAAYAAEMQKLPN--VRYVSFDFHHVCGTSNFDKLQVLYDQIQQE-FDNQGYLLID--TE---GNILEEQKGVIRSN 659 (828)
Q Consensus 588 ~~L~~~y~~~v~~l~~--i~y~~fDfh~~ck~~~~~~l~~L~~~i~~~-l~~~g~f~~~--~~---g~~~~~Q~GV~RtN 659 (828)
.+|+++|+++|+.+++ |+|++||||++||+|+|++++.|++.+++. +.++|||+.+ .+ +++++.|+||+|||
T Consensus 313 ~~L~~~y~~~v~~l~~~~i~y~~fDfh~~~k~~~~~~v~~ll~~l~~~~~~~~g~f~~~~~~~g~~~~~~~~Q~GV~RtN 392 (505)
T 3lwt_X 313 LPVKEGYESVVHALNDPKIHYVYFDFHHECRKMQWHRVKLLIDHLEKLGLSNEDFFHKVIDSNGNTVEIVNEQHSVVRTN 392 (505)
T ss_dssp CHHHHHHHHHHHHHCCTTEEEEEECCCSSTTTHHHHHHHHHHHHHHHHTCCTTCSEEEEECTTSCEEEEEECCCEEEEEE
T ss_pred hHHHHHHHHHHHHhcccCCceEEecchHhhhccchhHHHHHHHHHHHhcccccCceEeeccCCCCccceeeccceEEEEe
Confidence 9999999999999876 999999999999999999999999999885 7899999863 34 36889999999999
Q ss_pred ccccccchhHHHHHHHHHHHHHHHHHcCcccCCcccccChhHHHHHHHHHHHhhHHHHHhhhCCcCccCCeEEeeccchh
Q 003337 660 CIDCLDRTNVTQSYLAQKSLSLQLQRIGILSCTKCISMFSEECGKFRTLWAEQGDEISIEYAGTYALKGDLVRYGKQTIS 739 (828)
Q Consensus 660 ClDCLDRTNvvQs~ia~~~L~~qL~~lgi~~~~~~~~~~~~~~~~f~~lWadnGD~iS~~YaGT~Alktd~tr~Gkrt~~ 739 (828)
||||||||||||++||+++|+.||+.+|++..++.++.+++|...|++||+||||+||+|||||+||||||||+|||++.
T Consensus 393 CiDCLDRTNvvQ~~i~~~~L~~qL~~lgi~~~~~~~~~~~~~~~~f~~lWadnGD~iS~qYaGT~Alkt~~tR~gk~~~~ 472 (505)
T 3lwt_X 393 CMDCLDRTNVVQSVLAQWVLQKEFESADVVATGSTWEDNAPLLTSYQNLWADNADAVSVAYSGTGALKTDFTRTGKRTRL 472 (505)
T ss_dssp TTSCHHHHHHHHHHHHHHHHHHHHHHTTSSCTTCCGGGCHHHHHHHHHHHHHHHHHHTTTCCCCC---------------
T ss_pred cccccccchHHHHHHHHHHHHHHHHHcCCCCCccccccCHHHHHHHHHHHHHhhHHHHHHhcCCccccCceeeceeechh
Confidence 99999999999999999999999999999988877888899999999999999999999999999999999999999999
Q ss_pred hhHHhHHHHHhHhhhcccCchhhhhHHHhhccC
Q 003337 740 GLIRDGMSSLSRYYLNNFQDGVRQDAMDLISGH 772 (828)
Q Consensus 740 g~l~D~~~S~~Ryy~NnF~Dg~rQd~idL~lG~ 772 (828)
|+++|+++|++|||+|||.|+.|||||||||||
T Consensus 473 g~l~D~~~S~~Ryy~NnF~D~~rQ~aidl~LGn 505 (505)
T 3lwt_X 473 GAFNDFLNSASRYYQNNWTDGPRQDSYDLFLGG 505 (505)
T ss_dssp ---------------------------------
T ss_pred hhHHHHHHhHhheeecccCcHHHHHHHHHHcCC
Confidence 999999999999999999999999999999996
|
| >2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 | Back alignment and structure |
|---|
| >1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A | Back alignment and structure |
|---|
| >2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} | Back alignment and structure |
|---|
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} | Back alignment and structure |
|---|
| >1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A | Back alignment and structure |
|---|
| >3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A | Back alignment and structure |
|---|
| >4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1yd6_A UVRC; DNA binding protein; 2.00A {Bacillus caldotenax} | Back alignment and structure |
|---|
| >4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
| >1yd0_A Uvrabc system protein C; DNA binding protein; 1.50A {Thermotoga maritima} PDB: 1ycz_A 1yd1_A 1yd4_A 1yd3_A 1yd2_A 1yd5_A | Back alignment and structure |
|---|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* | Back alignment and structure |
|---|
| >1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* | Back alignment and structure |
|---|
| >2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* | Back alignment and structure |
|---|
| >4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
| >3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* | Back alignment and structure |
|---|
| >1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* | Back alignment and structure |
|---|
| >1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* | Back alignment and structure |
|---|
| >1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* | Back alignment and structure |
|---|
| >4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A | Back alignment and structure |
|---|
| >3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* | Back alignment and structure |
|---|
| >3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1mk0_A Intron-associated endonuclease 1; alpha/beta fold, catalytic domain, DNA-binding surface, hydrolase; HET: CIT; 1.60A {Enterobacteria phage T4} SCOP: d.226.1.1 PDB: 1ln0_A | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... | Back alignment and structure |
|---|
| >2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A | Back alignment and structure |
|---|
| >1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A | Back alignment and structure |
|---|
| >1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* | Back alignment and structure |
|---|
| >4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* | Back alignment and structure |
|---|
| >1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A | Back alignment and structure |
|---|
| >2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A | Back alignment and structure |
|---|
| >3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* | Back alignment and structure |
|---|
| >2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 | Back alignment and structure |
|---|
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A | Back alignment and structure |
|---|
| >2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* | Back alignment and structure |
|---|
| >3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C | Back alignment and structure |
|---|
| >2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* | Back alignment and structure |
|---|
| >2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3ktb_A Arsenical resistance operon trans-acting represso; alpha-beta-alpha sandwich, helix-turn-helix, structural GENO PSI-2; 2.10A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 828 | ||||
| d1wika_ | 109 | c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (M | 1e-26 | |
| d1ktea_ | 105 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 3e-17 | |
| d1fova_ | 82 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 6e-16 | |
| d1nm3a1 | 74 | c.47.1.1 (A:166-239) C-terminal, Grx domain of Hyb | 1e-14 | |
| d1abaa_ | 87 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 5e-14 | |
| d1egoa_ | 85 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 7e-13 | |
| d1t1va_ | 93 | c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [Tax | 2e-12 | |
| d1r7ha_ | 74 | c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Cory | 2e-08 | |
| d1h75a_ | 76 | c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Esch | 9e-08 |
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Thioltransferase domain: Thioredoxin-like protein 2 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 102 bits (256), Expect = 1e-26
Identities = 36/97 (37%), Positives = 60/97 (61%), Gaps = 3/97 (3%)
Query: 199 LEELIDKLVKENKVVAFIKGSRSAPMCGFSQKVIGILESQGVDYESVDVLDEEYNNGLRE 258
+ L + V+ F+KG++ CGFS++++ IL S GV+YE+ D+ + +R+
Sbjct: 4 GSSGLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDI---LEDEEVRQ 60
Query: 259 TLKKYSNWPTFPQIFVNGELVGGCDILSSMYEKGRFK 295
LK +SNWPT+PQ++V G+LVGG DI+ + + G
Sbjct: 61 GLKTFSNWPTYPQLYVRGDLVGGLDIVKELKDNGELL 97
|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 105 | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Length = 82 | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Length = 74 | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Length = 87 | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Length = 85 | Back information, alignment and structure |
|---|
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 93 | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Length = 74 | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 828 | |||
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 99.9 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 99.8 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 99.77 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 99.68 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 99.6 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 99.59 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 99.56 | |
| d1t1va_ | 93 | SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.55 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 99.54 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 98.4 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 98.27 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 98.05 | |
| d1ttza_ | 75 | Hypothetical protein XCC2852 {Xanthomonas campestr | 98.01 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 97.48 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 97.47 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 97.33 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 97.24 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 97.24 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 97.22 | |
| d1a8la2 | 107 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 97.18 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 97.17 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 97.1 | |
| d1xfla_ | 114 | Thioredoxin {Thale cress (Arabidopsis thaliana) [T | 96.86 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 96.81 | |
| d1axda2 | 80 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 96.79 | |
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 96.65 | |
| d1fw1a2 | 83 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 96.64 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 96.54 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 96.53 | |
| d1ep7a_ | 112 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 96.4 | |
| d1ti3a_ | 113 | Thioredoxin {European aspen (Populus tremula), thi | 96.36 | |
| d1r26a_ | 113 | Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | 96.29 | |
| d1syra_ | 103 | Thioredoxin {Malarial parasite (Plasmodium falcipa | 96.25 | |
| d1zmaa1 | 115 | Bacterocin transport accessory protein Bta {Strept | 96.16 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 96.12 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 95.99 | |
| d1dbya_ | 107 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 95.98 | |
| d1jlva2 | 84 | Class delta GST {Mosquito (Anopheles dirus b), iso | 95.86 | |
| d1z3ea1 | 114 | Regulatory protein Spx {Bacillus subtilis [TaxId: | 95.84 | |
| d2ifqa1 | 105 | Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | 95.56 | |
| d1gh2a_ | 107 | Thioredoxin-like protein, N-terminal domain {Human | 95.51 | |
| d1rw1a_ | 114 | Hypothetical protein PA3664 (YffB) {Pseudomonas ae | 95.39 | |
| d1thxa_ | 108 | Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | 95.31 | |
| d1fb6a_ | 104 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 95.22 | |
| d1nw2a_ | 105 | Thioredoxin {Alicyclobacillus acidocaldarius, form | 95.1 | |
| d1woua_ | 119 | Putative 42-9-9 protein (thioredoxin containing pr | 94.95 | |
| d1qgva_ | 137 | spliceosomal protein U5-15Kd {Human (Homo sapiens) | 94.5 | |
| d1f9ma_ | 112 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 94.37 | |
| d2trxa_ | 108 | Thioredoxin {Escherichia coli [TaxId: 562]} | 94.21 | |
| d2a2ra2 | 77 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 94.01 | |
| d1mk0a_ | 97 | Homing endonuclease I-TevI {Bacteriophage T4 [TaxI | 93.97 | |
| d2cvda2 | 74 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 93.91 | |
| d1j9ba_ | 138 | Arsenate reductase ArsC {Escherichia coli [TaxId: | 93.65 | |
| d1xwaa_ | 111 | Thioredoxin {Fruit fly (Drosophila melanogaster) [ | 93.54 | |
| d1iloa_ | 77 | MTH985, a thioredoxin {Archaeon Methanobacterium t | 93.5 | |
| d1eeja1 | 156 | Disulfide bond isomerase, DsbC, C-terminal domain | 92.73 | |
| d1t3ba1 | 150 | Disulfide bond isomerase, DsbC, C-terminal domain | 91.88 | |
| d2b5ea4 | 119 | Protein disulfide isomerase, PDI {Baker's yeast (S | 91.57 | |
| d2hfda1 | 132 | Hydrogenase-1 operon protein HyaE {Escherichia col | 90.68 | |
| d2fwha1 | 117 | Thiol:disulfide interchange protein DsbD, C-termin | 90.62 | |
| d1z6na1 | 166 | Hypothetical protein PA1234 {Pseudomonas aeruginos | 89.77 | |
| d1lu4a_ | 134 | Soluble secreted antigen MPT53 {Mycobacterium tube | 89.55 | |
| d2dlxa1 | 147 | UBX domain-containing protein 7 {Human (Homo sapie | 89.45 | |
| d1gula2 | 77 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 88.74 | |
| d1okta2 | 85 | Pf GST {Malarial parasite (Plasmodium falciparum) | 87.8 | |
| d1b48a2 | 78 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 87.78 | |
| d1meka_ | 120 | Protein disulfide isomerase, PDI {Human (Homo sapi | 87.77 | |
| d2es7a1 | 119 | Hydrogenase-1 operon protein HyaE {Salmonella typh | 87.1 | |
| d2gsqa2 | 75 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 86.65 | |
| d1m0ua2 | 76 | Class sigma GST {Fruit fly (Drosophila melanogaste | 85.99 | |
| d1sena_ | 135 | Thioredoxin-like protein p19, TLP19 {Human (Homo s | 83.99 | |
| d1n2aa2 | 80 | Class beta GST {Escherichia coli [TaxId: 562]} | 83.68 | |
| d1a8ya1 | 124 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 81.13 |
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Thioltransferase domain: Thioredoxin-like protein 2 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.90 E-value=7.6e-25 Score=200.72 Aligned_cols=91 Identities=41% Similarity=0.907 Sum_probs=86.9
Q ss_pred HHHHHHhhcCcEEEEEecCCCCCCCCcHHHHHHHHHhCCCCeEEEEccCccCcHHHHHHHHHHhCCCCcceEEECCeEEE
Q 003337 201 ELIDKLVKENKVVAFIKGSRSAPMCGFSQKVIGILESQGVDYESVDVLDEEYNNGLRETLKKYSNWPTFPQIFVNGELVG 280 (828)
Q Consensus 201 ~~l~~li~~~~VvifsKgt~~~~~C~~C~~ak~lL~~~gv~y~~idI~~~~~~~~~~~~L~~~sg~~TvPqIfI~Ge~IG 280 (828)
..|++++++++|||||||||+.|+||||.+||++|++++++|+++|++++ ++.++.+.++++++|+|||||+|++||
T Consensus 6 ~~i~~~i~~~~VvvF~Kgt~~~p~Cp~c~~ak~lL~~~~i~~~~~~v~~~---~~~~~~l~~~t~~~TvPqIFi~g~~IG 82 (109)
T d1wika_ 6 SGLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILED---EEVRQGLKTFSNWPTYPQLYVRGDLVG 82 (109)
T ss_dssp CCHHHHHTTSSEEEEESSTTTCCCSSTHHHHHHHHHHTCSCEEEEESSSC---HHHHHHHHHHHSCCSSCEEECSSSEEE
T ss_pred HHHHHHHhcCCEEEEeCCCCCCCCChHHHHHHHHHHhcCCCceEEEeccc---HHHHHHHHHhcCCCCCCeEEECCEEEc
Confidence 34999999999999999999999999999999999999999999999887 689999999999999999999999999
Q ss_pred echhhhhHHhhccc
Q 003337 281 GCDILSSMYEKGRF 294 (828)
Q Consensus 281 G~del~~l~~sG~l 294 (828)
|+|||.+|+++|+|
T Consensus 83 G~ddl~~l~~~G~L 96 (109)
T d1wika_ 83 GLDIVKELKDNGEL 96 (109)
T ss_dssp CHHHHHHHHHHTCS
T ss_pred CHHHHHHHHHCCCH
Confidence 99999999999943
|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mk0a_ d.226.1.1 (A:) Homing endonuclease I-TevI {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|