Citrus Sinensis ID: 003356

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------
MYMAYGWPQVIPLEQGLCPSSQQIIYFKVNNGLLLIASPCHIELWSSSQHKVRLGKYKRDSESVQREGENLQAVWSPDTKLIAVVTSSLYLHIFKVQITEKSIQIGGKQPSGLFFIKISLVLNEQLPFAEKGLSVSNIVSDNKHMLLGLSDGSLYSISWKGEFYGAFELVHSSNDSSVAALSHHFPSNGLASVDTSGAFVSDHKFPISSAIIWLELCLPMRLLFVLYSNGQLMSCSVSKKGLKLAEFIKIDKELGSGDAVCASIAPEQQILAVGTRRGVVELYDLAESASLIRTVSLYDWGYSMDDTGPVSCIAWTPDNSAFAVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYGYRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHLNLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGLLWLGKIIVVCNYIDSSNTYELLFYPRYHLDQSSLLCRKSLLAKPIVMDVYEDYILVTYRPFDVHIFHVKLFGELTPSTTPDLQLSTVRELSIMTAKSHPAAMRFIPDQVPRECSLNNHVSTSSDMLAREPARCLILRANGELSLLDLDDGRERELTDSVELFWVTCGQLEEKTSLIEEVSWLDYGYRGMQVWYPSPGVDPYKQEDFLQLDPELEFDREVYPLGLLPNAGVVVGVSQRMSFSACTEFPCFEPTPQAQTILHCLLRHLLQRDKIEEALRLAQLSAEKPHFSHCLEWLLFTVFDAEISRYLTLHKPHRTSRNALLSNC
cccccccccEEEccccccccccEEEEEEccccEEEEEcccEEEEEEccccEEEEEEEEcccHHHHccccEEEEEEcccccEEEEEEcccEEEEEEEEEcccEEEEcccccccccEEEEEEccccEEcccccccEEEEEEEcccEEEEEEEcccEEEEEcccccccEEEEEEcccccccccccccccccccccccccccEEEcccccccccEEEEEEcccccEEEEEEEccEEEEEEEcccccccccEEEEEEcccccccEEEEEcccccEEEEEEcccEEEEEEccccccEEEEEEEccccccccccccEEEEEEcccccEEEEEEccccEEEEccccccEEEEccccccccccccccccccccccccccccccEEEEcccccEEEEEEcccccEEEEEEcccEEEEccccccccEEEEEEcccEEEEEEcccccccEEEEEccccccccccccEEEEEEcccccEEEEEccccEEEEEEccccEEEEccccccccEEEEEEEEEccEEEEEEEEcccccEEEEEEccccccccccEEEEEcccccEEEEccccEEEEEEcccEEEEEEEEEEccccccccccEEEEEEEEEEEccccccccEEEEcccccccccccccccccccccccccccEEEEEEcccccccccccccccEEEcccccEEEEccccccccccccccEEEEEEcccccEEEccccccccccccccccccccccccccEEEEEEEcccEEEEEEEEEEEEcccccccccEEcccccccHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccccccccccccccc
cccccccccEccccccccccccEEEEEccccEEEEEEEccEEEEEEccccEEEEEEEEEcHHHHHHccccEEEEEcccccEEEEEEcccEEEEEEEEEcccccccccccccccccccccccccEEEEcccccEEEEEEEccccEEEEEEcccEEEEEEEcccccccEEEEEEEccccHHHccccccccccEEEcccccccccccccccccEEEEEEcccccEEEEEEcccEEEEEEccccccccHHccccccccccccEEEEEEcccEEEEEEEccccEEEEEEEccccccccEEEEccccccccccccEEEEEEcccccEEEEEEccccEEEEEcccccHHcccccccccccccccccccccccccHHHcccEEEEEcccccEEEEEcccccccEEEEEEEEEccccccccccccEEEEEcccEEEEEEcccccccccEEEEccHHHHHccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEccHHHHHHHHcccEEEEccEEEEEEEEEccccEEEEEEEccccccccEEEEEEccccEEEEEEcccEEEEEEcccEEEEEEEEEccccccccccEEEEEEEEEEEEccccccccEEEEEccccccccccccccccccccccccccEEEEEEEccEEEEEEcccccHHHHHHcEEEEEEcccccccccccHHHHEEEEccccccEEEEccccccccccccHccccccccccccEcEEEEEcccEEEEEEccccEEEccccccEEEcccccHHHHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHccc
mymaygwpqvipleqglcpssqqIIYFKVnngllliaspchielwsssqhkvrlgkykrdsesvqregenlqavwspdtKLIAVVTSSLYLHIFKVQITEksiqiggkqpsgLFFIKISLVLneqlpfaekglsvsnivsdnkhmllglsdgslysisWKGEFYGAFELVhssndssvaalshhfpsnglasvdtsgafvsdhkfpiSSAIIWLELCLPMRLLFVLysngqlmscsvskkgLKLAEFIKIDkelgsgdavcasiapeqQILAVGTRRGVVELYDLAESASLIRTVSlydwgysmddtgpvsciawtpdnsafavgwksrgltvwsvSGCRLMSTIRQISlssisspivkpnqdckyeplmsgtsmmqwdeyGYRLYAIEEGSSERVLIFSFGKcclnrgvsgmtyaRQVIYGEDrllvvqsedtdelkilhlnlpvsyisqnwpvqhvaasKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGLLWLGKIIVVCNyidssntyellfypryhldqssLLCRKSllakpivmdvYEDYILvtyrpfdvHIFHVKlfgeltpsttpdlqlsTVRELSIMTakshpaamrfipdqvprecslnnhvstssdmlarEPARCLILRAngelslldlddgrereltDSVELFWVTCgqleektslieevswldygyrgmqvwypspgvdpykqedflqldpelefdrevyplgllpnagvVVGVsqrmsfsactefpcfeptpqAQTILHCLLRHLLQRDKIEEALRLAQLsaekphfsHCLEWLLFTVFDAEISRYLtlhkphrtsrnallsnc
MYMAYGWPQVIPLEQGLCPSSQQIIYFKVNNGLLLIASPCHIELWSSSQHKVRLGKYkrdsesvqregenlqavwspdtKLIAVVTSSLYLHIFKVQITEKSIQIGGKQPSGLFFIKISLVLNEQLPFAEKGLSVSNIVSDNKHMLLGLSDGSLYSISWKGEFYGAFELVHSSNDSSVAALSHHFPSNGLASVDTSGAFVSDHKFPISSAIIWLELCLPMRLLFVLYSNGQLMSCSVSKKGLKLAEFIKIDKELGSGDAVCASIAPEQQILAVGTRRGVVELYDLAESASLIRTVSLYDWGYSMDDTGPVSCIAWTPDNSAFAVGWKSRGLTVWSVSGCRLMSTIRQISlssisspivkpnqdCKYEPLMSGTSMMQWDEYGYRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHLNLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKiqskgllwlGKIIVVCNYIDSSNTYELLFYPRYHLDQSSLLCRKSLLAKPIVMDVYEDYILVTYRPFDVHIFHVKLFgeltpsttpdlqLSTVRELSIMTAKSHPAAMRFIPDQVPRECSLNNHVSTSSDMLAREPARCLILRANGELSLLDLDDGRERELTDSVELFWvtcgqleektsliEEVSWLDYGYRGMQVWYPSPGVDPYKQEDFLQLDPELEFDREVYPLGLLPNAGVVVGVSQRMSFSACTEFPCFEPTPQAQTILHCLLRHLLQRDKIEEALRLAQLSAEKPHFSHCLEWLLFTVFDAEISRYLtlhkphrtsrnallsnc
MYMAYGWPQVIPLEQGLCPSSQQIIYFKVNNGLLLIASPCHIELWSSSQHKVRLGKYKRDSESVQREGENLQAVWSPDTKLIAVVTSSLYLHIFKVQITEKSIQIGGKQPSGLFFIKISLVLNEQLPFAEKGLSVSNIVSDNKHMLLGLSDGSLYSISWKGEFYGAFELVHSSNDSSVAALSHHFPSNGLASVDTSGAFVSDHKFPISSAIIWLELCLPMRLLFVLYSNGQLMSCSVSKKGLKLAEFIKIDKELGSGDAVCASIAPEQQILAVGTRRGVVELYDLAESASLIRTVSLYDWGYSMDDTGPVSCIAWTPDNSAFAVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYGYRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHLNLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGLLWLGKIIVVCNYIDSSNTYELLFYPRYHLDQSSLLCRKSLLAKPIVMDVYEDYILVTYRPFDVHIFHVKLFGELTPSTTPDLQLSTVRELSIMTAKSHPAAMRFIPDQVPRECSLNNHVSTSSDMLAREPARCLILRANgelslldlddgrerelTDSVELFWVTCGQLEEKTSLIEEVSWLDYGYRGMQVWYPSPGVDPYKQEDFLQLDPELEFDREVYPLGLLPNAGVVVGVSQRMSFSACTEFPCFEPTPQAQTILHCLLRHLLQRDKIEEALRLAQLSAEKPHFSHCLEWLLFTVFDAEISRYLTLHKPHRTSRNALLSNC
**MAYGWPQVIPLEQGLCPSSQQIIYFKVNNGLLLIASPCHIELWSSSQHKV******************LQAVWSPDTKLIAVVTSSLYLHIFKVQITEKSIQIGGKQPSGLFFIKISLVLNEQLPFAEKGLSVSNIVSDNKHMLLGLSDGSLYSISWKGEFYGAFELVHSS****VAALSHHFPSNGLASVDTSGAFVSDHKFPISSAIIWLELCLPMRLLFVLYSNGQLMSCSVSKKGLKLAEFIKIDKELGSGDAVCASIAPEQQILAVGTRRGVVELYDLAESASLIRTVSLYDWGYSMDDTGPVSCIAWTPDNSAFAVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYGYRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHLNLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGLLWLGKIIVVCNYIDSSNTYELLFYPRYHLDQSSLLCRKSLLAKPIVMDVYEDYILVTYRPFDVHIFHVKLFGELTPSTTPDLQLSTVRELSIM**********FI************************PARCLILRANGELSLLDLDDGRERELTDSVELFWVTCGQLEEKTSLIEEVSWLDYGYRGMQVWYPSPGVDPYKQEDFLQLDPELEFDREVYPLGLLPNAGVVVGVSQRMSFSACTEFPCFEPTPQAQTILHCLLRHLLQRDKIEEALRLAQLSAEKPHFSHCLEWLLFTVFDAEISRYLTLH**************
MYMAYGWPQVIPLEQG*CPSSQQIIYFKVNNGLLLIASPCHIELWSSSQHKVRLGKYKRD***VQREGENLQAVWSPDTKLIAVVTSSLYLHIFKVQITEKS***************ISLVLNEQLPFAEKGLSVSNIVSDNKHMLLGLSDGSLYSISWKGEFYGAFELVHSSNDSSVAALSHHFPS*GLASVDTSGAFVSDHKFPISSAIIWLELCLPMRLLFVLYSNGQLMSCSVSKKGLKLAEFIKIDKELGSGDAVCASIAPEQQILAVGTRRGVVELYDLAESASLIRTVSLYDWGYSMDDTGPVSCIAWTPDNSAFAVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYGYRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHLNLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGLLWLGKIIVVCNYIDSSNTYELLFYPRYHLDQSSLLCRKSLLAKPIVMDVYEDYILVTYRPFDVHIFHVKLFGEL******DLQLSTVRELSIMTAKSHPAAMRFIPD********************REPARCLILRANGELSLLDLDDGRERELTDSVELFWVTCGQLEEKTSLIEEVSWLDYGYRGMQVWYPS******************EFDREVYPLGLLPNAGVVVGVSQRMSFSACTEFPCFEPTPQAQTILHCLLRHLLQRDKIEEALRLAQLSAEKPHFSHCLEWLLFTVFD************************
MYMAYGWPQVIPLEQGLCPSSQQIIYFKVNNGLLLIASPCHIELWSSS**********************LQAVWSPDTKLIAVVTSSLYLHIFKVQITEKSIQIGGKQPSGLFFIKISLVLNEQLPFAEKGLSVSNIVSDNKHMLLGLSDGSLYSISWKGEFYGAFELVHSSNDSSVAALSHHFPSNGLASVDTSGAFVSDHKFPISSAIIWLELCLPMRLLFVLYSNGQLMSCSVSKKGLKLAEFIKIDKELGSGDAVCASIAPEQQILAVGTRRGVVELYDLAESASLIRTVSLYDWGYSMDDTGPVSCIAWTPDNSAFAVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYGYRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHLNLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGLLWLGKIIVVCNYIDSSNTYELLFYPRYHLDQSSLLCRKSLLAKPIVMDVYEDYILVTYRPFDVHIFHVKLFGELTPSTTPDLQLSTVRELSIMTAKSHPAAMRFIPDQVPRECSLNNHVSTSSDMLAREPARCLILRANGELSLLDLDDGRERELTDSVELFWVTCGQLEEKTSLIEEVSWLDYGYRGMQVWYPSPGVDPYKQEDFLQLDPELEFDREVYPLGLLPNAGVVVGVSQRMSFSACTEFPCFEPTPQAQTILHCLLRHLLQRDKIEEALRLAQLSAEKPHFSHCLEWLLFTVFDAEISRYLTLHKPHRT*********
MYMAYGWPQVIPLEQGLCPSSQQIIYFKVNNGLLLIASPCHIELWSSSQHKVRLGKYKRDSESVQREGENLQAVWSPDTKLIAVVTSSLYLHIFKVQITEKSIQIGGKQPSGLFFIKISLVLNEQLPFAEKGLSVSNIVSDNKHMLLGLSDGSLYSISWKGEFYGAFELVHSSNDSSVAALSHHFPSNGLASVDTSGAFVSDHKFPISSAIIWLELCLPMRLLFVLYSNGQLMSCSVSKKGLKLAEFIKIDKELGSGDAVCASIAPEQQILAVGTRRGVVELYDLAESASLIRTVSLYDWGYSMDDTGPVSCIAWTPDNSAFAVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYGYRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHLNLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGLLWLGKIIVVCNYIDSSNTYELLFYPRYHLDQSSLLCRKSLLAKPIVMDVYEDYILVTYRPFDVHIFHVKLFGELTPSTTPDLQLSTVRELSIMTAKSHPAAMRFIPDQVPRECSLN***STSSDMLAREPARCLILRANGELSLLDLDDGRERELTDSVELFWVTCGQLEEKTSLIEEVSWLDYGYRGMQVWYPSPGVDPYKQEDFLQLDPELEFDREVYPLGLLPNAGVVVGVSQRMSFSACTEFPCFEPTPQAQTILHCLLRHLLQRDKIEEALRLAQLSAEKPHFSHCLEWLLFTVFDAEISRYLTLH**************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYMAYGWPQVIPLEQGLCPSSQQIIYFKVNNGLLLIASPCHIELWSSSQHKVRLGKYKRDSESVQREGENLQAVWSPDTKLIAVVTSSLYLHIFKVQITEKSIQIGGKQPSGLFFIKISLVLNEQLPFAEKGLSVSNIVSDNKHMLLGLSDGSLYSISWKGEFYGAFELVHSSNDSSVAALSHHFPSNGLASVDTSGAFVSDHKFPISSAIIWLELCLPMRLLFVLYSNGQLMSCSVSKKGLKLAEFIKIDKELGSGDAVCASIAPEQQILAVGTRRGVVELYDLAESASLIRTVSLYDWGYSMDDTGPVSCIAWTPDNSAFAVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYGYRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHLNLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGLLWLGKIIVVCNYIDSSNTYELLFYPRYHLDQSSLLCRKSLLAKPIVMDVYEDYILVTYRPFDVHIFHVKLFGELTPSTTPDLQLSTVRELSIMTAKSHPAAMRFIPDQVPRECSLNNHVSTSSDMLAREPARCLILRANGELSLLDLDDGRERELTDSVELFWVTCGQLEEKTSLIEEVSWLDYGYRGMQVWYPSPGVDPYKQEDFLQLDPELEFDREVYPLGLLPNAGVVVGVSQRMSFSACTEFPCFEPTPQAQTILHCLLRHLLQRDKIEEALRLAQLSAEKPHFSHCLEWLLFTVFDAEISRYLTLHKPHRTSRNALLSNC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query827 2.2.26 [Sep-21-2011]
Q69ZJ7 1422 Protein RIC1 homolog OS=M yes no 0.929 0.540 0.248 1e-48
Q4ADV7 1423 Protein RIC1 homolog OS=H no no 0.920 0.534 0.243 3e-47
Q9V3C5 1429 Protein RIC1 homolog OS=D yes no 0.888 0.514 0.230 5e-34
O42656 1052 Protein ric1 OS=Schizosac yes no 0.494 0.388 0.234 9e-13
Q09417 1470 Protein RIC1 homolog OS=C yes no 0.594 0.334 0.191 1e-11
>sp|Q69ZJ7|RIC1_MOUSE Protein RIC1 homolog OS=Mus musculus GN=Kiaa1432 PE=2 SV=2 Back     alignment and function desciption
 Score =  195 bits (496), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 230/927 (24%), Positives = 375/927 (40%), Gaps = 158/927 (17%)

Query: 1   MYMAYGWPQVIPLEQGLC-PSSQQIIYFKVNN----GLLLIASPCHIELWSSSQHKVRLG 55
           MY   GWP+ +     LC P S       V +        + +P  + +W S +  V + 
Sbjct: 1   MYFLSGWPKRL-----LCAPRSPAEAPLHVQSDPRRAFFAVLAPARLSIWYS-RPSVLIV 54

Query: 56  KYKRDSESVQREGENLQAVWSPDTKLIAVVTSSLYLHIFKVQ-------ITEKSIQIGGK 108
            YK  ++S  + G   QA W PD+ +IAV T++ Y+  F +        + E     G  
Sbjct: 55  TYKEPAKSSTQFGSYKQAEWRPDSTMIAVSTANGYILFFHITSSRGDKYLYEPVYPKGSP 114

Query: 109 QPSGLFFIK-------ISLVLNEQLPFAEKGLSVSNIVSDNKHMLLGLSDGSLYSISWKG 161
           Q  G+   K       ++L + + L      +S+ +++ D   +L+  SDG L+ I W+G
Sbjct: 115 QMKGIPHFKEEHCAPALNLEMKKILDLQAPIMSLQSVLED---LLVATSDGLLHLIHWEG 171

Query: 162 EFYGAFELVHSSNDSSVAALSHHFPSNGLASVDTSGAFVSDHKFPISSAIIWLELCLPMR 221
              G   +  S+   SV   S              G+F+      I      +E C  + 
Sbjct: 172 MTNGRKAINLSTVPFSVDLQSSRV-----------GSFLGFADVHIKD----MEYCATLD 216

Query: 222 LLFVLYSNGQLMSCSVSKKGLKLAEFIKIDKELGSGDAVCASIAPEQQILAVGTRRGVVE 281
              V++++G++   +         +   +  +    D  C ++  + +++A G   G V+
Sbjct: 217 GFAVVFNDGKVGFITPVSSRFTAEQLHGVWPQ-DVIDGTCVAVNNKYRLMAFGCASGCVQ 275

Query: 282 LYDLAESAS---LIRTVSLYDWGYS--MDDTGPVSCIAWTPDNSAFAVGWKSRGLTVWSV 336
           +Y +  +     L   + L    Y    + TG V  I W+PDNSA  V W+  GL++WSV
Sbjct: 276 VYTIDNTTGAMLLSHKLELTAKQYPDIWNKTGAVKLIRWSPDNSAVIVTWEYGGLSLWSV 335

Query: 337 SGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYGYRLYAIEEGSSER- 395
            G +L+ T+               +   K +PL   +  M W   GY L+ I    S+  
Sbjct: 336 FGAQLICTL--------GGDFAYRSDGTKKDPLKINS--MSWGAEGYHLWVISGLGSQHT 385

Query: 396 --------------VLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTD------ 435
                         +L+F F K  L          + ++ GEDRL +   E +       
Sbjct: 386 QIETDLRSTVKEPSILLFQFIKSVLTVNPCMSNQEQVLLQGEDRLYLNCGEASQAQNPKY 445

Query: 436 -----ELKILHLNLPV--------------------------SYISQNWPVQHVAASKDG 464
                E    H   P                           +Y+  NWP++  A  K G
Sbjct: 446 SSARAERMPRHEKSPFADGGLEAPGLSTLLGHRHWHVVQISSTYLESNWPIRFSAIDKLG 505

Query: 465 MFLAVAGLHGLILYDIRQKKWRVFGDITQEQK-IQSKGLLWLGKIIVVCNYIDSSNTYEL 523
             +AVAG  G   Y +  KKW++FG+ITQEQ  I + GL W    +V+  Y  S    EL
Sbjct: 506 QNIAVAGKFGFAHYSLLTKKWKLFGNITQEQNMIVTGGLAWWDDFMVLACYNLSDCQEEL 565

Query: 524 LFYPRY-HLDQSSLLCRKSLLAKPIVMDVYEDYILVTYRPFDVHIFHVKLFGELTPSTTP 582
             Y R  +LD +     K+ + + +++ V+ D ++V      + ++ ++   + + +TT 
Sbjct: 566 RIYLRTSNLDNAFAHVTKAPM-ETLLLSVFRDMVVVFRADCSICLYSIERKSDGS-NTTA 623

Query: 583 DLQLSTVRELSIMTAKSHPAAMRFIPDQVPRECSLNNHVSTSSDMLAREPARCLILRANG 642
            +Q+  ++E+S+     HP     +        S  N +S      AR+ A  ++L   G
Sbjct: 624 SVQV--LQEVSMSRYIPHPF---LVVSVTLTSVSTENGISLKMPQQARD-AESIMLNLAG 677

Query: 643 ELSLLDLDDG----RERE----------------LTDSVELFWVTCGQLEEKTSLIEEVS 682
           +L ++  D      RE++                L  SVE  W TC   ++K  L+E + 
Sbjct: 678 QLIMMQRDRSGPQIREKDSHPNQRKLLPFCPPVVLAQSVENVWTTCRANKQKRHLLEAL- 736

Query: 683 WLDYGYRGMQVWYPSPGVDPYKQEDFLQLDPELEFDREVYPLGLLPNAGVVVGV------ 736
           WL  G  GM+VW P    D  K   FL     L F   +YPL +L    +V+G       
Sbjct: 737 WLSCGGAGMKVWLPLFPRDHRKPHSFLSQRIMLPFHINIYPLAVLFEDALVLGAVNDTLL 796

Query: 737 --------SQRMSFSACTEFPCFEPTPQAQTILHCLLRHLLQRDKIEEALRLAQLSAEKP 788
                   S R        F   E T  +Q  LH +LR LL R+  E+AL LAQ  A  P
Sbjct: 797 YDSLYTRSSAREQLEVLFPFCVVERT--SQIYLHHILRQLLVRNLGEQALLLAQSCAALP 854

Query: 789 HFSHCLEWLLFTVFDAEISRYLTLHKP 815
           +F H LE +L  V + E +    +  P
Sbjct: 855 YFPHVLELMLHEVLEEEATSREPIPDP 881
Required for phosphorylation and localization of GJA1.
Mus musculus (taxid: 10090)
>sp|Q4ADV7|RIC1_HUMAN Protein RIC1 homolog OS=Homo sapiens GN=KIAA1432 PE=1 SV=2 Back     alignment and function description
>sp|Q9V3C5|RIC1_DROME Protein RIC1 homolog OS=Drosophila melanogaster GN=CG9063 PE=1 SV=1 Back     alignment and function description
>sp|O42656|RIC1_SCHPO Protein ric1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ric1 PE=1 SV=2 Back     alignment and function description
>sp|Q09417|RIC1_CAEEL Protein RIC1 homolog OS=Caenorhabditis elegans GN=R06F6.8 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query827
224064053 1122 predicted protein [Populus trichocarpa] 0.974 0.718 0.835 0.0
255541662 1124 conserved hypothetical protein [Ricinus 0.977 0.718 0.839 0.0
359489664 1126 PREDICTED: protein RIC1 homolog isoform 0.975 0.716 0.832 0.0
297745353 1124 unnamed protein product [Vitis vinifera] 0.973 0.716 0.831 0.0
356568415 1121 PREDICTED: protein RIC1 homolog isoform 0.970 0.716 0.805 0.0
147860649 1122 hypothetical protein VITISV_010293 [Viti 0.960 0.707 0.829 0.0
356531967 1121 PREDICTED: protein RIC1 homolog isoform 0.970 0.716 0.808 0.0
87162909 1123 WD40-like [Medicago truncatula] 0.977 0.719 0.804 0.0
449441620 1135 PREDICTED: protein RIC1 homolog [Cucumis 0.974 0.710 0.777 0.0
357507433 1168 RIC1-like protein [Medicago truncatula] 0.975 0.690 0.799 0.0
>gi|224064053|ref|XP_002301368.1| predicted protein [Populus trichocarpa] gi|222843094|gb|EEE80641.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1405 bits (3637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 675/808 (83%), Positives = 734/808 (90%), Gaps = 2/808 (0%)

Query: 1   MYMAYGWPQVIPLEQGLCPSSQQIIYFKVNNGLLLIASPCHIELWSSSQHKVRLGKYKRD 60
           MYMAYGWPQVIPLEQGLCPS Q+IIYFKV N L L+ SP  +ELWSSSQHKVRLGKYKRD
Sbjct: 1   MYMAYGWPQVIPLEQGLCPSQQRIIYFKVINRLFLVVSPSRLELWSSSQHKVRLGKYKRD 60

Query: 61  SESVQREGENLQAVWSPDTKLIAVVTSSLYLHIFKVQITEKSIQIGGKQPSGLFFIKISL 120
           +ES++REGEN+QAVWSPDTKLIA++T+S +LHIFKVQ +EK IQIGGKQPSGLF   I+L
Sbjct: 61  AESLEREGENIQAVWSPDTKLIAILTTSFFLHIFKVQFSEKRIQIGGKQPSGLFLANITL 120

Query: 121 VLNEQLPFAEKGLSVSNIVSDNKHMLLGLSDGSLYSISWKGEFYGAFELVHSSNDSSVAA 180
           VLNEQ+PFA+K L+VSN VSDNKHMLLGLS+GSLYSISWKGEFYGAFE+   S DSS  +
Sbjct: 121 VLNEQVPFADKELTVSNFVSDNKHMLLGLSNGSLYSISWKGEFYGAFEINPYSRDSSDTS 180

Query: 181 LSHHFPSNGLASVDTSGAFVSDHKFPISSAIIWLELCLPMRLLFVLYSNGQLMSCSVSKK 240
           +S H   NG AS   S   VS+H     +AI+ LELCLPMRLLFVLYS+GQL+SCSVSK+
Sbjct: 181 ISPHSLGNGFASGRASSGSVSNHNITRKTAIVQLELCLPMRLLFVLYSDGQLVSCSVSKR 240

Query: 241 GLKLAEFIKIDKELGSGDAVCASIAPEQQILAVGTRRGVVELYDLAESASLIRTVSLYDW 300
           GLK  E+IK +K+LGS DAVC S+A +QQILAVGTRRGVVELY+LAESASLIR+VSL DW
Sbjct: 241 GLKQVEYIKPEKKLGSDDAVCTSVASDQQILAVGTRRGVVELYNLAESASLIRSVSLSDW 300

Query: 301 GYSMDDTGPVSCIAWTPDNSAFAVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKP 360
           GYSMD+TGPVSCIAWTPDNSAFAVGWK RGLTVWSVSGCRLMSTIRQI L S+SSP VKP
Sbjct: 301 GYSMDETGPVSCIAWTPDNSAFAVGWKLRGLTVWSVSGCRLMSTIRQIGL-SLSSPKVKP 359

Query: 361 NQDCKYEPLMSGTSMMQWDEYGYRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVI 420
           NQ+CKYE LM+GTS+MQWDEYGY+LY IEE S ERV+ FSFGKCCL+RGVSGMTY RQVI
Sbjct: 360 NQECKYEALMNGTSLMQWDEYGYKLYVIEEESLERVIAFSFGKCCLSRGVSGMTYVRQVI 419

Query: 421 YGEDRLLVVQSEDTDELKILHLNLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDI 480
           YGEDRLLVVQSEDTDEL+ILHLNLPVSYISQNWPVQHVAASKDGM LAVAGLHGLILYDI
Sbjct: 420 YGEDRLLVVQSEDTDELRILHLNLPVSYISQNWPVQHVAASKDGMHLAVAGLHGLILYDI 479

Query: 481 RQKKWRVFGDITQEQKIQSKGLLWLGKIIVVCNYIDSSNTYELLFYPRYHLDQSSLLCRK 540
           + KKWRVFGDITQEQKIQ KGLLWLGKI+VVCNYIDSSNTYELLFYPRYHLDQSSLLCRK
Sbjct: 480 QLKKWRVFGDITQEQKIQCKGLLWLGKIVVVCNYIDSSNTYELLFYPRYHLDQSSLLCRK 539

Query: 541 SLLAKPIVMDVYEDYILVTYRPFDVHIFHVKLFGELTPSTTPDLQLSTVRELSIMTAKSH 600
            LLAKP+VMDVY+D+ILVTYRPFDVHIFHV+L GELTPS+TPDLQLSTVRELSIMTAKSH
Sbjct: 540 PLLAKPMVMDVYQDHILVTYRPFDVHIFHVRLLGELTPSSTPDLQLSTVRELSIMTAKSH 599

Query: 601 PAAMRFIPDQVPRECSLNNHVSTSSDMLAREPARCLILRANGELSLLDLDDGRERELTDS 660
           PAAMRFIPD++PRE + +NH+S SS+ L  EPARCLILR NGELSLLDLDDG ERELTDS
Sbjct: 600 PAAMRFIPDRLPRELASDNHIS-SSEFLDTEPARCLILRTNGELSLLDLDDGHERELTDS 658

Query: 661 VELFWVTCGQLEEKTSLIEEVSWLDYGYRGMQVWYPSPGVDPYKQEDFLQLDPELEFDRE 720
           VELFWVTCGQ EEK SLIEEVSWLDYG+RGMQVWYP PG DP+KQEDFLQLDPELEFDRE
Sbjct: 659 VELFWVTCGQSEEKASLIEEVSWLDYGHRGMQVWYPCPGADPFKQEDFLQLDPELEFDRE 718

Query: 721 VYPLGLLPNAGVVVGVSQRMSFSACTEFPCFEPTPQAQTILHCLLRHLLQRDKIEEALRL 780
           VYPLGLLPNAG+VVGVSQRMSFSACTEFPCFEP+PQAQTILHCLLRHLLQRDK EEALRL
Sbjct: 719 VYPLGLLPNAGLVVGVSQRMSFSACTEFPCFEPSPQAQTILHCLLRHLLQRDKTEEALRL 778

Query: 781 AQLSAEKPHFSHCLEWLLFTVFDAEISR 808
           AQLSAEKPHFSHCLE LLFTVFDAEISR
Sbjct: 779 AQLSAEKPHFSHCLELLLFTVFDAEISR 806

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255541662|ref|XP_002511895.1| conserved hypothetical protein [Ricinus communis] gi|223549075|gb|EEF50564.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|359489664|ref|XP_003633961.1| PREDICTED: protein RIC1 homolog isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297745353|emb|CBI40433.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356568415|ref|XP_003552406.1| PREDICTED: protein RIC1 homolog isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|147860649|emb|CAN81454.1| hypothetical protein VITISV_010293 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356531967|ref|XP_003534547.1| PREDICTED: protein RIC1 homolog isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|87162909|gb|ABD28704.1| WD40-like [Medicago truncatula] Back     alignment and taxonomy information
>gi|449441620|ref|XP_004138580.1| PREDICTED: protein RIC1 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|357507433|ref|XP_003624005.1| RIC1-like protein [Medicago truncatula] gi|355499020|gb|AES80223.1| RIC1-like protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query827
TAIR|locus:2146589 1127 AT5G28350 "AT5G28350" [Arabido 0.974 0.715 0.731 0.0
FB|FBgn0028500 1429 Rich "RIC1 homolog" [Drosophil 0.424 0.245 0.259 2.7e-34
UNIPROTKB|Q4ADV7 1423 KIAA1432 "Protein RIC1 homolog 0.343 0.199 0.269 4.9e-33
MGI|MGI:1924893 1422 C030046E11Rik "RIKEN cDNA C030 0.535 0.311 0.244 5.6e-16
UNIPROTKB|G4MP37 1118 MGG_05699 "Uncharacterized pro 0.331 0.245 0.219 2.3e-22
ASPGD|ASPL0000058751 1048 AN1283 [Emericella nidulans (t 0.413 0.326 0.250 7.5e-22
WB|WBGene00011071 1470 R06F6.8 [Caenorhabditis elegan 0.392 0.221 0.223 8.6e-18
POMBASE|SPAC1851.04c 1052 ric1 "Ypt/Rab-specific guanyl- 0.431 0.339 0.248 2.1e-12
TAIR|locus:2146589 AT5G28350 "AT5G28350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3097 (1095.3 bits), Expect = 0., P = 0.
 Identities = 591/808 (73%), Positives = 673/808 (83%)

Query:     1 MYMAYGWPQVIPLEQGLCPSSQQIIYFKVNNGLLLIASPCHIELWSSSQHKVRLGKYKRD 60
             MYMAYGWPQVIPL  G CPSSQ+++Y K+   LLL+ SP H+ELW SSQ +VRLGKY RD
Sbjct:     1 MYMAYGWPQVIPLLPGSCPSSQRVVYLKLAGRLLLVVSPSHLELWGSSQQRVRLGKYMRD 60

Query:    61 SESVQREGENLQAVWSPDTKLIAVVTSSLYLHIFKVQITEKSIQIGGKQPSGLFFIKISL 120
              +SV+ EGENLQAVWSPD KLIAV+TSS +LHI+K++ T+K ++ G +QPS L F  ISL
Sbjct:    61 DKSVREEGENLQAVWSPDAKLIAVLTSSFFLHIYKIKFTDKRVKPGERQPSELCFATISL 120

Query:   121 VLNEQLPFAEKGLSVSNIVSDNKHMLLGLSDGSLYSISWKGEFYGAFELVHSSNDSSVAA 180
             +L+EQ+PFA K LSVSN V D+K MLLGLSDGSLYSISWKGEF GAF +    +DS+   
Sbjct:   121 LLSEQVPFAGKDLSVSNFVRDSKTMLLGLSDGSLYSISWKGEFGGAFSIGSHPSDSNDDR 180

Query:   181 LSHHFPSNGLASVDTSGAFVSDHKFPISSAIIWLELCLPMRLLFVLYSNGQLMSCSVSKK 240
             L  +   NGL S   S    SD KF  + AI+ LELC   +LLFVL S+GQL+ CSV+KK
Sbjct:   181 LLSYTLGNGLVSGVASPTLASDDKFSTNPAIVQLELCTRSKLLFVLNSDGQLVVCSVNKK 240

Query:   241 GLKLAEFIKIDKELGSGDAVCASIAPEQQILAVGTRRGVVELYDLAESASLIRTVSLYDW 300
             GLK  E I+ +K++G GDAVCAS+A EQQILAVGTR+G+VELYDL+ S SL+RTVSL+DW
Sbjct:   241 GLKYTESIRAEKKVG-GDAVCASVASEQQILAVGTRKGMVELYDLSHSISLLRTVSLHDW 299

Query:   301 GYSMDDTGPVSCIAWTPDNSAFAVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKP 360
             GYS D TGPV+ IAWTPDNSAFAVGWKSRGL VWSVSGCRLMST+RQI L+S SSP + P
Sbjct:   300 GYSADYTGPVNNIAWTPDNSAFAVGWKSRGLAVWSVSGCRLMSTVRQIGLTSTSSPKINP 359

Query:   361 NQDCKYEPLMSGTSMMQWDEYGYRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVI 420
              QDCKYEPLMSGTS +QWDEYGYRL+A EE S +R+L FSFGKCCLNRGVSG TY RQV+
Sbjct:   360 KQDCKYEPLMSGTSAIQWDEYGYRLFATEEASYDRILAFSFGKCCLNRGVSGKTYVRQVM 419

Query:   421 YGEDRLLVVQSEDTDELKILHLNLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDI 480
             YG+DRLL+VQ+EDTDELK+LHL LPVSYISQNWPVQHVAAS+DG +LA AGLHGLILYDI
Sbjct:   420 YGDDRLLMVQAEDTDELKLLHLKLPVSYISQNWPVQHVAASEDGKYLAFAGLHGLILYDI 479

Query:   481 RQKKWRVFGDITQEQKIQSKGLLWLGKIIVVCNYIDSSNTYELLFYPRYHLDQSSLLCRK 540
             R KKWRVFGD++QEQ+I  KGLLWLGKI+V+CNYI++S TYELLFYPRYHLDQSSLLCRK
Sbjct:   480 RFKKWRVFGDVSQEQQIHCKGLLWLGKIVVICNYIEASETYELLFYPRYHLDQSSLLCRK 539

Query:   541 SLLAKPIVMDVYEDYILVTYRPFDVHIFHVKLFGELTPSTTPDLQLSTVRELSIMTAKSH 600
              LL KP+VMDVY+DYILV+Y PF +H++HVK++GELTPS+  DLQLSTVRELSIMTAKSH
Sbjct:   540 VLLGKPMVMDVYQDYILVSYLPFFIHVYHVKIYGELTPSSKADLQLSTVRELSIMTAKSH 599

Query:   601 PAAMRFIPDQVPRECSLNNHVSTSSDMLAREPARCLILRANXXXXXXXXXXXXXXXXTDS 660
             PAAM F+PDQ  RE  L+N  + SSD+  REP+RCLILR N                TDS
Sbjct:   600 PAAMGFVPDQHLREGELDND-NLSSDLSDREPSRCLILRGNGELSLLDLVDGRERELTDS 658

Query:   661 VELFWVTCGQLEEKTSLIEEVSWLDYGYRGMQVWYPSPGVDPYKQEDFLQLDPELEFDRE 720
             VELFWVTCGQ EEKT+L+EEVSWLDYG+RGMQVWYPS G DP+ QEDFLQLDPELEFDRE
Sbjct:   659 VELFWVTCGQSEEKTNLVEEVSWLDYGHRGMQVWYPSLGDDPFMQEDFLQLDPELEFDRE 718

Query:   721 VYPLGLLPNAGVVVGVSQRMSFSACTEFPCFEPTPQAQTILHCLLRHLLQRDKIEEALRL 780
             VYPLGLLPN GVVVGVSQRMSFSA  EF CFEPTPQAQTILHCLLRHLLQRDK EEAL L
Sbjct:   719 VYPLGLLPNVGVVVGVSQRMSFSASAEFACFEPTPQAQTILHCLLRHLLQRDKNEEALLL 778

Query:   781 AQLSAEKPHFSHCLEWLLFTVFDAEISR 808
             AQLSAEKPHFSHCLEWLLFTVFDAEISR
Sbjct:   779 AQLSAEKPHFSHCLEWLLFTVFDAEISR 806
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
GO:0005794 "Golgi apparatus" evidence=IDA
FB|FBgn0028500 Rich "RIC1 homolog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q4ADV7 KIAA1432 "Protein RIC1 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1924893 C030046E11Rik "RIKEN cDNA C030046E11 gene" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G4MP37 MGG_05699 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000058751 AN1283 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
WB|WBGene00011071 R06F6.8 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
POMBASE|SPAC1851.04c ric1 "Ypt/Rab-specific guanyl-nucleotide exchange factor (GEF) subunit Ric1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_LG_II0733
hypothetical protein (1123 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query827
pfam07064 251 pfam07064, RIC1, RIC1 1e-36
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-06
>gnl|CDD|219284 pfam07064, RIC1, RIC1 Back     alignment and domain information 
 Score =  138 bits (349), Expect = 1e-36
 Identities = 44/140 (31%), Positives = 61/140 (43%), Gaps = 2/140 (1%)

Query: 677 LIEEVSWLDYGYRGMQVWYPSPGVDPYKQEDFLQLDPELEFDREVYPLGLLPNAGVVVGV 736
            + +  WL  G  G+ VW P    D  +   F+     L    + YPL +L N G+V+G 
Sbjct: 1   HLRDSLWLFCGLSGLLVWLPVQPSDAVELPRFVSKRIMLP--LDFYPLSVLLNKGIVLGA 58

Query: 737 SQRMSFSACTEFPCFEPTPQAQTILHCLLRHLLQRDKIEEALRLAQLSAEKPHFSHCLEW 796
                    + FP      +    L  +LRHLL+R+  E+AL LAQ     P+F H LE 
Sbjct: 59  ESESVQRRDSSFPFLRFEIRTHLFLPYILRHLLKRNWGEQALYLAQHMRHLPYFPHVLEL 118

Query: 797 LLFTVFDAEISRYLTLHKPH 816
           LL TV D E+          
Sbjct: 119 LLHTVLDEEVDSSEQDSPRD 138

RIC1 has been identified in yeast as a Golgi protein involved in retrograde transport to the cis-Golgi network. It forms a heterodimer with Rgp1 and functions as a guanyl-nucleotide exchange factor. Length = 251
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 827
KOG2006 1023 consensus WD40 repeat protein [General function pr 100.0
KOG0291893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.98
PF07064 258 RIC1: RIC1; InterPro: IPR009771 This entry represe 99.98
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.97
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.97
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.96
KOG0286343 consensus G-protein beta subunit [General function 99.96
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.95
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.95
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.94
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.94
KOG0263707 consensus Transcription initiation factor TFIID, s 99.94
KOG0263707 consensus Transcription initiation factor TFIID, s 99.94
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.94
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.94
KOG0286343 consensus G-protein beta subunit [General function 99.94
KOG0645312 consensus WD40 repeat protein [General function pr 99.93
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.93
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.93
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.93
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.93
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.93
KOG0645312 consensus WD40 repeat protein [General function pr 99.92
KOG0315311 consensus G-protein beta subunit-like protein (con 99.92
KOG0315311 consensus G-protein beta subunit-like protein (con 99.92
KOG0295406 consensus WD40 repeat-containing protein [Function 99.91
KOG0296399 consensus Angio-associated migratory cell protein 99.91
KOG0266456 consensus WD40 repeat-containing protein [General 99.91
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.91
KOG0266456 consensus WD40 repeat-containing protein [General 99.91
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.9
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.9
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.9
KOG0295406 consensus WD40 repeat-containing protein [Function 99.9
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.9
PLN00181793 protein SPA1-RELATED; Provisional 99.9
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.89
KOG0293519 consensus WD40 repeat-containing protein [Function 99.89
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.88
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.88
PLN00181793 protein SPA1-RELATED; Provisional 99.88
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.88
KOG0293519 consensus WD40 repeat-containing protein [Function 99.87
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.87
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.87
KOG0296399 consensus Angio-associated migratory cell protein 99.87
KOG0643327 consensus Translation initiation factor 3, subunit 99.87
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.87
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.86
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.86
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.86
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.86
KOG2096420 consensus WD40 repeat protein [General function pr 99.85
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.85
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.85
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.85
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.85
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.84
PTZ00421493 coronin; Provisional 99.84
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.84
KOG0641350 consensus WD40 repeat protein [General function pr 99.84
KOG2048691 consensus WD40 repeat protein [General function pr 99.84
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.83
KOG2096420 consensus WD40 repeat protein [General function pr 99.83
KOG0283712 consensus WD40 repeat-containing protein [Function 99.83
KOG0643327 consensus Translation initiation factor 3, subunit 99.83
KOG1539910 consensus WD repeat protein [General function pred 99.82
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.82
KOG0772641 consensus Uncharacterized conserved protein, conta 99.82
KOG1274 933 consensus WD40 repeat protein [General function pr 99.82
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.81
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.81
KOG2106626 consensus Uncharacterized conserved protein, conta 99.81
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.8
PTZ00420568 coronin; Provisional 99.8
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.8
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.8
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.8
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.79
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.79
KOG0294362 consensus WD40 repeat-containing protein [Function 99.79
KOG0289506 consensus mRNA splicing factor [General function p 99.79
KOG2048691 consensus WD40 repeat protein [General function pr 99.79
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.79
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.79
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.79
PTZ00421493 coronin; Provisional 99.78
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.78
KOG1539910 consensus WD repeat protein [General function pred 99.78
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.77
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.77
KOG0283712 consensus WD40 repeat-containing protein [Function 99.77
KOG0641350 consensus WD40 repeat protein [General function pr 99.76
KOG0300481 consensus WD40 repeat-containing protein [Function 99.76
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.76
KOG0772641 consensus Uncharacterized conserved protein, conta 99.76
KOG2106626 consensus Uncharacterized conserved protein, conta 99.76
PTZ00420568 coronin; Provisional 99.75
KOG0639705 consensus Transducin-like enhancer of split protei 99.75
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.75
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.74
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.74
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.74
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.74
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.73
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.73
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.73
KOG2055514 consensus WD40 repeat protein [General function pr 99.72
KOG0289506 consensus mRNA splicing factor [General function p 99.72
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.72
KOG1274 933 consensus WD40 repeat protein [General function pr 99.71
KOG1273405 consensus WD40 repeat protein [General function pr 99.71
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.7
KOG0639705 consensus Transducin-like enhancer of split protei 99.7
KOG0294362 consensus WD40 repeat-containing protein [Function 99.7
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.7
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.7
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.7
KOG0269839 consensus WD40 repeat-containing protein [Function 99.69
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.68
KOG0646476 consensus WD40 repeat protein [General function pr 99.68
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.67
KOG1273405 consensus WD40 repeat protein [General function pr 99.67
KOG2055514 consensus WD40 repeat protein [General function pr 99.66
KOG0267 825 consensus Microtubule severing protein katanin p80 99.65
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.65
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.64
KOG0267 825 consensus Microtubule severing protein katanin p80 99.64
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.63
KOG4283397 consensus Transcription-coupled repair protein CSA 99.62
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.62
KOG0646476 consensus WD40 repeat protein [General function pr 99.61
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.61
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.61
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.6
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.6
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.58
KOG4283397 consensus Transcription-coupled repair protein CSA 99.58
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.57
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.56
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.55
KOG0300481 consensus WD40 repeat-containing protein [Function 99.55
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.53
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.52
KOG4328498 consensus WD40 protein [Function unknown] 99.5
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.49
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.47
KOG0270463 consensus WD40 repeat-containing protein [Function 99.47
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.47
KOG0302440 consensus Ribosome Assembly protein [General funct 99.46
KOG4328498 consensus WD40 protein [Function unknown] 99.46
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.45
KOG1963792 consensus WD40 repeat protein [General function pr 99.45
KOG0771398 consensus Prolactin regulatory element-binding pro 99.44
COG2319466 FOG: WD40 repeat [General function prediction only 99.44
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.43
KOG0303472 consensus Actin-binding protein Coronin, contains 99.43
PRK11028330 6-phosphogluconolactonase; Provisional 99.42
KOG0302440 consensus Ribosome Assembly protein [General funct 99.4
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.4
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.39
KOG0649325 consensus WD40 repeat protein [General function pr 99.39
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.39
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.38
KOG0303472 consensus Actin-binding protein Coronin, contains 99.38
KOG0771398 consensus Prolactin regulatory element-binding pro 99.38
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.38
KOG0270463 consensus WD40 repeat-containing protein [Function 99.37
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.34
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.33
KOG2110391 consensus Uncharacterized conserved protein, conta 99.33
COG2319466 FOG: WD40 repeat [General function prediction only 99.32
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.32
KOG1963792 consensus WD40 repeat protein [General function pr 99.31
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.3
KOG2111346 consensus Uncharacterized conserved protein, conta 99.3
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.3
PRK01742429 tolB translocation protein TolB; Provisional 99.3
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.29
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.27
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.25
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.25
PRK11028330 6-phosphogluconolactonase; Provisional 99.24
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.24
KOG1188376 consensus WD40 repeat protein [General function pr 99.19
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.19
KOG1188376 consensus WD40 repeat protein [General function pr 99.19
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.17
KOG4227609 consensus WD40 repeat protein [General function pr 99.16
KOG2110391 consensus Uncharacterized conserved protein, conta 99.15
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.12
PRK01742429 tolB translocation protein TolB; Provisional 99.1
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.1
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.08
KOG2139445 consensus WD40 repeat protein [General function pr 99.08
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.07
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.07
KOG0649325 consensus WD40 repeat protein [General function pr 99.05
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.04
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.04
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.03
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.03
PRK03629429 tolB translocation protein TolB; Provisional 99.03
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.02
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.01
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.01
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.0
KOG2111346 consensus Uncharacterized conserved protein, conta 99.0
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.0
KOG2139445 consensus WD40 repeat protein [General function pr 98.99
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.99
KOG4227609 consensus WD40 repeat protein [General function pr 98.98
KOG2321703 consensus WD40 repeat protein [General function pr 98.97
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.97
KOG0290364 consensus Conserved WD40 repeat-containing protein 98.94
PRK05137435 tolB translocation protein TolB; Provisional 98.92
KOG1310 758 consensus WD40 repeat protein [General function pr 98.91
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 98.9
PRK04922433 tolB translocation protein TolB; Provisional 98.87
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.85
KOG1272545 consensus WD40-repeat-containing subunit of the 18 98.84
PRK02889427 tolB translocation protein TolB; Provisional 98.81
KOG1272545 consensus WD40-repeat-containing subunit of the 18 98.8
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.78
PRK03629429 tolB translocation protein TolB; Provisional 98.78
KOG2315566 consensus Predicted translation initiation factor 98.77
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.76
PRK04922433 tolB translocation protein TolB; Provisional 98.75
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.72
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.72
PRK02889427 tolB translocation protein TolB; Provisional 98.7
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.67
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.66
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.66
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.66
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.63
KOG1310 758 consensus WD40 repeat protein [General function pr 98.61
PRK05137435 tolB translocation protein TolB; Provisional 98.61
KOG4547541 consensus WD40 repeat-containing protein [General 98.6
PRK04792448 tolB translocation protein TolB; Provisional 98.58
KOG1334559 consensus WD40 repeat protein [General function pr 98.57
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.53
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.53
KOG2321 703 consensus WD40 repeat protein [General function pr 98.51
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.5
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.5
PRK01029428 tolB translocation protein TolB; Provisional 98.49
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.49
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.48
PRK01029428 tolB translocation protein TolB; Provisional 98.46
KOG4547541 consensus WD40 repeat-containing protein [General 98.46
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.45
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.44
COG4946668 Uncharacterized protein related to the periplasmic 98.39
KOG1334559 consensus WD40 repeat protein [General function pr 98.38
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.38
PRK00178430 tolB translocation protein TolB; Provisional 98.35
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.33
COG4946668 Uncharacterized protein related to the periplasmic 98.32
PRK04792448 tolB translocation protein TolB; Provisional 98.3
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.29
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.29
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.25
KOG2315566 consensus Predicted translation initiation factor 98.25
KOG2314698 consensus Translation initiation factor 3, subunit 98.21
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.19
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.17
PRK00178430 tolB translocation protein TolB; Provisional 98.14
KOG1409404 consensus Uncharacterized conserved protein, conta 98.05
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.05
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.05
PRK04043419 tolB translocation protein TolB; Provisional 97.99
KOG0280339 consensus Uncharacterized conserved protein [Amino 97.97
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.97
KOG41901034 consensus Uncharacterized conserved protein [Funct 97.97
KOG2314698 consensus Translation initiation factor 3, subunit 97.97
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.96
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 97.94
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 97.91
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.89
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 97.86
KOG1912 1062 consensus WD40 repeat protein [General function pr 97.86
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.85
KOG1409404 consensus Uncharacterized conserved protein, conta 97.8
PRK04043419 tolB translocation protein TolB; Provisional 97.74
KOG0280339 consensus Uncharacterized conserved protein [Amino 97.71
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.67
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.66
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.63
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.55
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 97.51
KOG3621726 consensus WD40 repeat-containing protein [General 97.5
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.5
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.47
KOG4714319 consensus Nucleoporin [Nuclear structure] 97.46
KOG4532344 consensus WD40-like repeat containing protein [Gen 97.45
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.45
KOG41901034 consensus Uncharacterized conserved protein [Funct 97.45
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 97.38
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 97.35
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.27
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.25
KOG4714319 consensus Nucleoporin [Nuclear structure] 97.23
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.21
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.21
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.16
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.12
KOG2695425 consensus WD40 repeat protein [General function pr 97.08
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.97
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 96.87
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 96.85
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.72
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.67
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 96.66
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.56
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 96.51
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.41
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 96.4
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 96.27
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.22
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 96.19
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 96.15
KOG2695425 consensus WD40 repeat protein [General function pr 96.13
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.06
KOG3621 726 consensus WD40 repeat-containing protein [General 96.0
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 95.99
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 95.96
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 95.94
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 95.86
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 95.79
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 95.63
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 95.57
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.55
PRK02888635 nitrous-oxide reductase; Validated 95.53
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 95.46
smart0032040 WD40 WD40 repeats. Note that these repeats are per 95.4
COG0823425 TolB Periplasmic component of the Tol biopolymer t 95.37
KOG18971096 consensus Damage-specific DNA binding complex, sub 95.16
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 95.12
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 94.95
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 94.87
PF15390671 DUF4613: Domain of unknown function (DUF4613) 94.84
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 94.74
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 94.63
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 94.37
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 94.36
KOG1008 783 consensus Uncharacterized conserved protein, conta 94.17
COG0823425 TolB Periplasmic component of the Tol biopolymer t 93.96
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 93.74
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 93.6
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 93.13
KOG18981205 consensus Splicing factor 3b, subunit 3 [RNA proce 92.99
COG3391381 Uncharacterized conserved protein [Function unknow 92.32
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 91.96
PRK02888635 nitrous-oxide reductase; Validated 91.62
PRK13616591 lipoprotein LpqB; Provisional 91.31
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 91.3
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 91.3
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 91.01
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 90.91
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 90.62
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 90.62
KOG2444238 consensus WD40 repeat protein [General function pr 90.6
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 90.11
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 89.42
COG3204316 Uncharacterized protein conserved in bacteria [Fun 89.29
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 88.79
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 88.75
PRK13616591 lipoprotein LpqB; Provisional 88.19
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 87.12
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 87.1
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 87.07
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 87.01
KOG2377 657 consensus Uncharacterized conserved protein [Funct 86.81
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 86.41
KOG18971096 consensus Damage-specific DNA binding complex, sub 86.12
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 86.09
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 85.88
PF11635753 Med16: Mediator complex subunit 16; InterPro: IPR0 85.33
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 84.7
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 84.67
KOG2444238 consensus WD40 repeat protein [General function pr 83.9
KOG4659 1899 consensus Uncharacterized conserved protein (Rhs f 83.27
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 83.18
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 82.93
KOG2377657 consensus Uncharacterized conserved protein [Funct 82.48
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 82.28
COG3391381 Uncharacterized conserved protein [Function unknow 82.06
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 81.29
PHA02713557 hypothetical protein; Provisional 80.89
>KOG2006 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1e-60  Score=534.32  Aligned_cols=562  Identities=31%  Similarity=0.448  Sum_probs=421.8

Q ss_pred             eCCcEEEEeeccCccccceeeccceecCCCCcEEEEEcCCCCEEEEEecCCeEEEEEcCCCCcceEEEEeecCCCCCCCC
Q 003356          228 SNGQLMSCSVSKKGLKLAEFIKIDKELGSGDAVCASIAPEQQILAVGTRRGVVELYDLAESASLIRTVSLYDWGYSMDDT  307 (827)
Q Consensus       228 ~dG~~~~~~~~~~~~~~~~~~~~~~~~~h~~~v~va~sp~~~lla~g~~dg~v~vw~~~~~~~~~~~l~~~~~~~~~~h~  307 (827)
                      .||+......+....+.-....... .--++++|++++..+.++|+|...|.+.+|+...-...........    ++++
T Consensus       121 sD~q~a~~~~n~~~~~~t~~i~~~~-~l~~DAvc~SV~~e~~lla~G~~~g~v~~y~~~~~~ssl~~s~~~~----~~~t  195 (1023)
T KOG2006|consen  121 SDGQAAQLLLNHQGFKYTESIGAWK-PLGGDAVCCSVNHEFQLLAYGTPVGEVLLYSIDEANSSLVFSNRDD----DTLT  195 (1023)
T ss_pred             ccchhhhhhcccccchhhhhhhhhc-cccccceeeeccchhhhheecccccceeehhhhhhccceeeecccC----cccc
Confidence            7777655544443322222222211 2347899999999999999999999999999876222222211111    2255


Q ss_pred             CCeEEEEECCCCCEEEEEEcCCcEEEEeccCCeeEEEeccccccceeeeeecCCCCCCccceeecceeEEEccCCceEEE
Q 003356          308 GPVSCIAWTPDNSAFAVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYGYRLYA  387 (827)
Q Consensus       308 ~~V~~l~~spDg~~Lasg~~Dg~v~vWs~~~~~l~~tl~~~~~~~v~s~~~sp~~~~~~~~l~sg~~i~~W~~~~~~l~~  387 (827)
                      -++..+.|.|+++.+|.++..|...+|+..++..+.+..........+..|+|......+.-.++.....|...+..++.
T Consensus       196 i~~~~~~~~p~~~~~av~~~~g~ls~wS~~g~~~ms~v~~~~~ts~~~~~f~~~~~l~e~~~~s~~~~~q~~e~~~~L~~  275 (1023)
T KOG2006|consen  196 VPDNNSSWRPDQNGFAVTWEKGFLAFWSNQGNILMLPVKKLELTSKVVLKFNPLIIMKGEPTFSKVGAIQWEEVGIVLFP  275 (1023)
T ss_pred             ccccccCcCCccceeeeeecccceEEecccccccccchhhhhccchhhhccCcceeeecccccCccchhhccceeeeeec
Confidence            58899999999999999999999999999999887766554334455566666554444455556677788887777766


Q ss_pred             EecCCcceEEEEecceeeeecccCCCeeeeEEEEcCCeEEEEecCC---CCcceEEEeeeceeeccCCCcEEEEEEcCCC
Q 003356          388 IEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSED---TDELKILHLNLPVSYISQNWPVQHVAASKDG  464 (827)
Q Consensus       388 ~~~~~~~~v~~~~~~~~~~s~~~d~~~~~w~~~~~~~~~~~~~~~d---~~~~~w~~~~~p~~~~~~~~~I~~va~SpdG  464 (827)
                      ........+..+.....+.   .+++........++..+++....+   .+...|.++++|.+|...+|||++++.++||
T Consensus       276 ~~~~~~~~~~~~~s~sc~~---~S~~~~~~~~l~~d~~~l~~~~~~~s~~~~~~w~~~~~P~~y~ssnwpiry~s~~~dg  352 (1023)
T KOG2006|consen  276 HGEQILTISDFKVSKSCLV---ESKTIVCRAQLMGDSHDLVSKATDVSITDIEKWDHLALPLTYTSSNWPIRYVSIDYDG  352 (1023)
T ss_pred             ccccccchhheeecccccc---cccceeechhhccchhhhhhhhccccccchhhhheeecccccccccCceeEEeecCCc
Confidence            5433222221111111111   122332333344444444444334   4456899999999999999999999999999


Q ss_pred             CEEEEEeCCceEEEEcCCCeEEeeCCccceEEEEEEE-EEEeCCEEEEEEEeeCCCcEEEEEeeCC-CCCccceEEEEec
Q 003356          465 MFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKG-LLWLGKIIVVCNYIDSSNTYELLFYPRY-HLDQSSLLCRKSL  542 (827)
Q Consensus       465 ~~lavag~dg~iiwd~~t~~w~~f~~~~~e~~~~v~g-l~W~~~~li~~~~~~~~~~~~lrly~~~-~l~~~~~~~~~~l  542 (827)
                      +++|+||.-|.++|+..+++||.|+++.||+.+.|+| |.|++++++.||+.+.+..+++++|+++ ++|++. .+....
T Consensus       353 ~~lavAgl~gla~y~~~~~~Wk~f~~~sqEq~i~vtg~liW~~~f~v~~~~~~~~~~~~L~fy~~~~~~dn~~-a~k~~~  431 (1023)
T KOG2006|consen  353 KHLAVAGLHGLARYSLSSKRWKLFGDESQEQNINVTGGLIWWDDFVVHGCVEEGNRTFELYFYPRDYNLDNNL-AHKSAA  431 (1023)
T ss_pred             cEEEEeecccceEEEeecceeecCCccchhhceecceeeEEecceEEEEEEeecCceeeeEecccccccchhh-ccchhh
Confidence            9999999999999999999999999999999999984 9999999999999999999999999998 777754 343333


Q ss_pred             CCccEEEEccCCEEEEEEcCceEEEEEEEEecccCCCCCCceEEEEEEEEeeccCCCCCceEEEccCCCccccccCCCCC
Q 003356          543 LAKPIVMDVYEDYILVTYRPFDVHIFHVKLFGELTPSTTPDLQLSTVRELSIMTAKSHPAAMRFIPDQVPRECSLNNHVS  622 (827)
Q Consensus       543 ~~~~~~l~~~~~~llV~~~~~~i~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~i~~~~~~~~~~~~~~~  622 (827)
                      ......+.+.++.++|.++|+.+.+|.+..+.      ...+.+.-+.+++++.+++||+||++++.+.++..-.. ..+
T Consensus       432 ~~~~~d~v~~~~~livitad~~~~~~~~~~~s------~t~l~~~~~~~~~~~~i~thP~~ivs~t~t~~~l~~i~-~~~  504 (1023)
T KOG2006|consen  432 SAKVSDLVCVDYSLIVITADGKYQHWELWRNS------QTQLDLENVTEVSIVLINTHPACIVSLTVTSPSLANIG-NDN  504 (1023)
T ss_pred             hhhhhheeeecceeEEEEecceEEEEEeccch------hhccccceeeEEEEEeecCCCcEEEEeeccCccccccC-ccc
Confidence            34444556788888889999988888776322      35678888999999999999999999999988632111 123


Q ss_pred             CCccccccCCceEEEEEECCEEEEEecCC-------CceeEeccceeEEEEcCCCCccccCccceeeEEEECCCC-----
Q 003356          623 TSSDMLAREPARCLILRANGELSLLDLDD-------GRERELTDSVELFWVTCGQLEEKTSLIEEVSWLDYGYRG-----  690 (827)
Q Consensus       623 ~~~~~~~~~~~~~~l~~~~g~l~~l~~~~-------~~~~~la~~VE~~~~~~~~~~~~~~~~~~~~~~~~~~~g-----  690 (827)
                      |.++       +++....+|++.++....       ..+..+|.+||.+|+.+..   +...+.+..|+.||..|     
T Consensus       505 l~~~-------~~~~~~~~n~i~~l~~~~~~~~~~~~~~~~la~~Ve~~~~~ss~---~~~~~~d~~Wl~~g~~~~~~~~  574 (1023)
T KOG2006|consen  505 LQFY-------KSITVTFNNLIGRLIINSSLRDGALYQENKLASLVENFWLNSSF---EDQQVLDLHWLGDGANGCHMKN  574 (1023)
T ss_pred             hhHh-------hhhhhhhcchhheeehhhhccchhhhhhhhhhhhHHHeecCcHH---hhhhhhhceeeccCCCcccccc
Confidence            4443       234445566666665432       2578899999999987322   23345688899999999     


Q ss_pred             cEEecCC--------------CCCCCCCcccccccCcccccccccccceeecCccEEEEEeeeeeecc-----cccccee
Q 003356          691 MQVWYPS--------------PGVDPYKQEDFLQLDPELEFDREVYPLGLLPNAGVVVGVSQRMSFSA-----CTEFPCF  751 (827)
Q Consensus       691 ~~vw~~~--------------~~~~~~~~~~~~~~~~~l~~~~~~YPl~v~~~~~~~~g~~~~~~~~~-----~~~~~~~  751 (827)
                      |+.|.+.              .+.++.+.++|+++++|++|++++|||.+++++++++|++|+..+..     +..+++.
T Consensus       575 ~~g~~~~l~~~~~~~~g~~~~~~~~~~~~~sF~~k~~ml~f~l~~Ypl~~l~~~~~~~gv~~~~~l~asa~~~~~~~~f~  654 (1023)
T KOG2006|consen  575 MDGCPNHLCLALWLSEGNVWDLVMDAYRVPSFLSKRIMLPFTLNIYPLVLLKNVNLVLGVEQEDALLASAEIILFTLTFD  654 (1023)
T ss_pred             ccCCccccccceeecccchhhcccccccCchhhhhccccccchhhceeeeecccceeeeccchhhhhhhccccccccchH
Confidence            7766553              33457778999999999999999999999999999999999976643     3355666


Q ss_pred             eecCcccchHHHHHH--HHHHcCCHHHHHHHHHHcCCCCCchhHHHHHhhhhhhcccccCCCCCCC
Q 003356          752 EPTPQAQTILHCLLR--HLLQRDKIEEALRLAQLSAEKPHFSHCLEWLLFTVFDAEISRYLTLHKP  815 (827)
Q Consensus       752 ~~~~~~~~~L~~ilr--~~l~~~~~~~a~~~a~~~~~l~~f~h~LE~Llh~vle~e~~~~~~~~~~  815 (827)
                      -..++|++|||.|++  |+|+||++++||.+|+.|+.+|||+|+||+|||.|||+|||+++|||||
T Consensus       655 v~~~~h~~~l~~i~~l~q~lkrnl~~~aLllaq~~a~~p~f~h~le~ll~~Vle~e~ts~~p~~d~  720 (1023)
T KOG2006|consen  655 VQERLHQIYLHIILHLYQLLKRNLGEDALLLAQECAILPHFTHALELLLHFVLEEEATSSEPIPDK  720 (1023)
T ss_pred             HhhhhhhhHHHHHHHHHHHHHhhccHHHHHhHHHHHhcccchHHHHHHHHHHHHHhhcCCCCccch
Confidence            667899999999999  9999999999999999999999999999999999999999999999999

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PF07064 RIC1: RIC1; InterPro: IPR009771 This entry represents RIC1 (Ribosomal control protein1) and has been identified in yeast as a Golgi protein involved in retrograde transport to the cis-Golgi network Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11635 Med16: Mediator complex subunit 16; InterPro: IPR021665 Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [],[] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4659 consensus Uncharacterized conserved protein (Rhs family) [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query827
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 1e-05
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 4e-05
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 2e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 62.2 bits (150), Expect = 6e-10
 Identities = 88/617 (14%), Positives = 171/617 (27%), Gaps = 204/617 (33%)

Query: 5   YGWPQVIPLEQGLCPSSQQIIYFKVNNGLLLIASPCHIELWSSSQHKVRLGKYKRDSESV 64
           Y +       +   PS    +Y                 L++ +Q      KY     +V
Sbjct: 91  YKFLMSPIKTEQRQPSMMTRMY-----------IEQRDRLYNDNQ---VFAKY-----NV 131

Query: 65  QREGENLQAVWSPDTKLIAVVTSSLYLHIFKVQITEKSIQIGGKQPSGLFFIKISLVLNE 124
            R             +    +  +L     +++   K++ I G   SG    K  + L+ 
Sbjct: 132 SRL------------QPYLKLRQALL----ELR-PAKNVLIDGVLGSG----KTWVALD- 169

Query: 125 QLPFAEKGLSVSNIVSDNKHMLLGLSDGSLYSISWKGEFYGAFELVHSSNDSS------- 177
                         V  +  +   +       I W          ++  N +S       
Sbjct: 170 --------------VCLSYKVQCKMDFK----IFW----------LNLKNCNSPETVLEM 201

Query: 178 VAALSHHFPSNGLASVDTSGAFVSDHKFPISSAIIWLELCLPMRLLFVL--YSNGQLMSC 235
           +  L +    N  +  D S    S+ K  I S    L      R L     Y N  L+  
Sbjct: 202 LQKLLYQIDPNWTSRSDHS----SNIKLRIHSIQAEL------RRLLKSKPYENCLLVLL 251

Query: 236 SVSKKGLKLAEFIKIDKELGSGDAVCASIAPEQQILAVGTR-RGVVELYDLAESASLIRT 294
           +V         F          +  C       +IL + TR + V +   L+ + +   +
Sbjct: 252 NVQNAKA-WNAF----------NLSC-------KIL-LTTRFKQVTD--FLSAATTTHIS 290

Query: 295 VSLYDWGYSMDDT----------------------GP--VSCIAWTPDNSAFAVGWKSRG 330
           +  +    + D+                        P  +S IA             +  
Sbjct: 291 LDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIA------ESIRDGLAT- 343

Query: 331 LTVWSVSGCRLMSTIRQISLSSISSPIVKPN-QDC----KYEPLMSGTSMMQWDEYGYRL 385
              W    C  ++TI + SL+ +     +              + +    + W +     
Sbjct: 344 WDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSLIWFD----- 398

Query: 386 YAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDEL--KIL-HL 442
             + +     V+        + +     T +   I      L V+ E+   L   I+ H 
Sbjct: 399 --VIKSDVMVVVNKLHKYSLVEKQPKESTIS---IPSIYLELKVKLENEYALHRSIVDHY 453

Query: 443 NLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQ-KKWRVFGDITQ-----EQK 496
           N+P ++ S +    ++    D  F +  G H   L +I   ++  +F  +       EQK
Sbjct: 454 NIPKTFDSDDLIPPYL----DQYFYSHIGHH---LKNIEHPERMTLFRMVFLDFRFLEQK 506

Query: 497 IQSKGLLWLGKIIVVCNYIDSSNTYELLFYPRYHLDQSSLLCRKSLLAKPIVMDVYEDYI 556
           I+     W                                    S+L     +  Y+ YI
Sbjct: 507 IRHDSTAWN--------------------------------ASGSILNTLQQLKFYKPYI 534

Query: 557 LVTYRPFDVHIFHVKLF 573
                 ++  +  +  F
Sbjct: 535 CDNDPKYERLVNAILDF 551
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query827
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.97
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.97
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.97
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.97
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.97
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.97
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.97
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.97
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.97
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.97
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.97
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.97
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.97
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.97
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.97
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.97
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.97
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.97
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.96
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.96
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.96
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.96
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.96
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.96
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.96
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.96
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.96
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.96
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.96
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.96
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.96
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.96
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.95
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.95
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.95
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.95
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.95
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.95
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.95
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.95
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.95
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.95
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.95
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.95
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.95
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.95
2pm7_B297 Protein transport protein SEC13, protein transport 99.94
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.94
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.94
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.94
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.94
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.94
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.94
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.94
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.94
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.94
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.94
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.94
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.93
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.93
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.93
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.93
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.93
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.93
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.93
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.93
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.93
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.93
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.93
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.92
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.92
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.92
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.92
2pm7_B297 Protein transport protein SEC13, protein transport 99.92
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.92
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.92
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.92
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.92
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.92
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.92
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.92
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.92
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.91
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.91
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.91
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.91
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.91
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.91
3jrp_A379 Fusion protein of protein transport protein SEC13 99.91
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.9
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.9
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.9
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.9
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.9
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.9
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.9
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.89
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.89
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.89
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.89
3jrp_A379 Fusion protein of protein transport protein SEC13 99.89
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.89
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.89
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.88
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.88
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.88
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.88
3jro_A 753 Fusion protein of protein transport protein SEC13 99.87
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.86
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.85
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.85
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.85
3jro_A 753 Fusion protein of protein transport protein SEC13 99.85
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.83
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.83
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.83
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.82
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.82
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.82
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.81
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.81
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.8
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.77
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.75
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.73
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.69
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.69
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.67
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.66
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.66
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.65
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.65
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.64
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.64
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.64
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.63
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.63
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.62
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.61
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.61
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.61
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.61
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.6
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.59
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.58
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.57
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.56
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.56
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.53
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.52
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.5
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.5
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.49
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.46
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.43
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.42
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.41
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.39
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.32
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.3
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.28
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.23
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.2
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.2
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.19
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.18
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.18
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.14
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.14
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.14
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.12
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.09
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.05
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.04
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.03
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.02
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.02
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.0
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.0
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.98
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.96
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.94
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.93
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.9
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.82
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.79
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.79
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.78
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.76
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.76
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.72
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.72
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.72
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.7
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.7
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.68
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.66
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.65
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.62
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.6
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.5
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.49
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.47
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.45
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.44
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.42
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.41
2qe8_A343 Uncharacterized protein; structural genomics, join 98.4
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.36
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.27
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.25
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.25
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.16
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.16
2qe8_A343 Uncharacterized protein; structural genomics, join 98.05
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 97.94
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 97.84
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 97.83
4a2l_A795 BT_4663, two-component system sensor histidine kin 97.79
4a2l_A795 BT_4663, two-component system sensor histidine kin 97.78
2ece_A462 462AA long hypothetical selenium-binding protein; 97.75
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.65
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.63
2ece_A462 462AA long hypothetical selenium-binding protein; 97.59
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.58
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 97.57
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.47
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.45
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.42
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 97.42
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.42
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.39
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 97.33
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 97.31
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 97.15
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.13
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.97
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.96
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.96
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.94
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 96.89
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.87
2fp8_A322 Strictosidine synthase; six bladed beta propeller 96.83
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.81
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 96.81
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 96.69
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.63
2fp8_A322 Strictosidine synthase; six bladed beta propeller 96.4
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.26
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.21
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.2
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 96.19
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.02
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 95.99
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 95.86
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 95.73
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 95.46
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.45
2p4o_A306 Hypothetical protein; putative lactonase, structur 95.09
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.08
2p4o_A306 Hypothetical protein; putative lactonase, structur 95.07
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.06
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 94.89
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 94.43
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 94.42
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 94.27
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 94.17
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 93.85
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 93.85
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 93.77
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 93.7
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 93.31
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 92.85
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 92.6
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 92.51
3v65_B386 Low-density lipoprotein receptor-related protein; 91.75
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 91.65
3kya_A496 Putative phosphatase; structural genomics, joint c 90.79
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 90.24
3v65_B386 Low-density lipoprotein receptor-related protein; 90.2
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 89.83
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 89.82
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 89.28
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 89.21
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 87.59
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 87.4
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 87.23
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 86.09
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 84.51
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 83.45
3p5b_L400 Low density lipoprotein receptor variant; B-propel 82.2
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 82.03
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 81.62
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 80.97
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 80.14
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
Probab=100.00  E-value=6.4e-38  Score=369.97  Aligned_cols=460  Identities=10%  Similarity=0.058  Sum_probs=314.5

Q ss_pred             CceEEEEEecceEEEEEccCeEEEeecCCceeEEEEEEeChHhhhhcCcccEEEEcCCccEEEEEecCcEEEEEEEEecC
Q 003356           21 SQQIIYFKVNNGLLLIASPCHIELWSSSQHKVRLGKYKRDSESVQREGENLQAVWSPDTKLIAVVTSSLYLHIFKVQITE  100 (827)
Q Consensus        21 ~~~vv~fspdg~lla~~~~~~v~IW~~~~~~~~l~~~~r~~~s~~~~G~~~~v~wSPDg~~lav~t~dg~l~l~~v~~~~  100 (827)
                      ....++|||||+++|++.+++++||+.. ....+..+.      .+.+.+.+++|||||++||+++.||+|+|||+....
T Consensus        20 ~~~~~~~spdg~~l~~~~~~~v~l~~~~-~~~~~~~~~------~h~~~v~~~~~spdg~~lasg~~d~~v~lWd~~~~~   92 (611)
T 1nr0_A           20 TAVVLGNTPAGDKIQYCNGTSVYTVPVG-SLTDTEIYT------EHSHQTTVAKTSPSGYYCASGDVHGNVRIWDTTQTT   92 (611)
T ss_dssp             CCCCCEECTTSSEEEEEETTEEEEEETT-CSSCCEEEC------CCSSCEEEEEECTTSSEEEEEETTSEEEEEESSSTT
T ss_pred             ceeEEeeCCCCCEEEeCCCCEEEEecCC-CcccCeEec------CCCCceEEEEECCCCcEEEEEeCCCCEEEeECCCCc
Confidence            3455889999999999988899999994 433333332      234678899999999999999999999999985332


Q ss_pred             ceeecCCCCCCCceeeeEeeEeecccccccccceEE--EeecCCCeEEEEecCC--cEEEEecCCccCcceeecccCCCC
Q 003356          101 KSIQIGGKQPSGLFFIKISLVLNEQLPFAEKGLSVS--NIVSDNKHMLLGLSDG--SLYSISWKGEFYGAFELVHSSNDS  176 (827)
Q Consensus       101 ~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~v~--~~~~d~~~llv~t~dg--~i~~~~w~~~~~~~~~l~~~p~~~  176 (827)
                      ...           ..          .+.++...|.  +++++++.+++++.+.  ...++.|+....  .         
T Consensus        93 ~~~-----------~~----------~~~~~~~~v~~v~fs~dg~~l~~~~~~~~~~~~v~~wd~~~~--~---------  140 (611)
T 1nr0_A           93 HIL-----------KT----------TIPVFSGPVKDISWDSESKRIAAVGEGRERFGHVFLFDTGTS--N---------  140 (611)
T ss_dssp             CCE-----------EE----------EEECSSSCEEEEEECTTSCEEEEEECCSSCSEEEEETTTCCB--C---------
T ss_pred             cee-----------eE----------eecccCCceEEEEECCCCCEEEEEECCCCceeEEEEeeCCCC--c---------
Confidence            110           00          0122333444  4567778888777543  345556873211  0         


Q ss_pred             cccceecccCCCCccccccCCceeccccCCCcccEEEEEEcCCcceEEEEEeCCc-EEEEeeccCccccceeeccce---
Q 003356          177 SVAALSHHFPSNGLASVDTSGAFVSDHKFPISSAIIWLELCLPMRLLFVLYSNGQ-LMSCSVSKKGLKLAEFIKIDK---  252 (827)
Q Consensus       177 ~~i~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~i~~i~~~~~~~~~~~~s~dG~-~~~~~~~~~~~~~~~~~~~~~---  252 (827)
                                               ..+..+...|.+++          |+|+|+ .+++++.|+++++|+....+.   
T Consensus       141 -------------------------~~l~gh~~~v~~v~----------f~p~~~~~l~s~s~D~~v~lwd~~~~~~~~~  185 (611)
T 1nr0_A          141 -------------------------GNLTGQARAMNSVD----------FKPSRPFRIISGSDDNTVAIFEGPPFKFKST  185 (611)
T ss_dssp             -------------------------BCCCCCSSCEEEEE----------ECSSSSCEEEEEETTSCEEEEETTTBEEEEE
T ss_pred             -------------------------ceecCCCCCceEEE----------ECCCCCeEEEEEeCCCeEEEEECCCCeEeee
Confidence                                     11234455677766          667776 588889999999999765433   


Q ss_pred             ecCCCCcEE-EEEcCCCCEEEEEecCCeEEEEEcCCCCcceEEEEeecCCCCCCCCCCeEEEEECCCCCEEEEEEcCCcE
Q 003356          253 ELGSGDAVC-ASIAPEQQILAVGTRRGVVELYDLAESASLIRTVSLYDWGYSMDDTGPVSCIAWTPDNSAFAVGWKSRGL  331 (827)
Q Consensus       253 ~~~h~~~v~-va~sp~~~lla~g~~dg~v~vw~~~~~~~~~~~l~~~~~~~~~~h~~~V~~l~~spDg~~Lasg~~Dg~v  331 (827)
                      +.+|.+.+. ++|+|++++||+|+.||+|++||+.+ ++.+..+.... ....+|.+.|.+++|+|||++||+|+.|++|
T Consensus       186 l~~H~~~V~~v~fspdg~~las~s~D~~i~lwd~~~-g~~~~~~~~~~-~~~~~h~~~V~~v~~spdg~~l~s~s~D~~v  263 (611)
T 1nr0_A          186 FGEHTKFVHSVRYNPDGSLFASTGGDGTIVLYNGVD-GTKTGVFEDDS-LKNVAHSGSVFGLTWSPDGTKIASASADKTI  263 (611)
T ss_dssp             ECCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTT-CCEEEECBCTT-SSSCSSSSCEEEEEECTTSSEEEEEETTSEE
T ss_pred             eccccCceEEEEECCCCCEEEEEECCCcEEEEECCC-CcEeeeecccc-ccccccCCCEEEEEECCCCCEEEEEeCCCeE
Confidence            378999887 99999999999999999999999987 66666553100 0112499999999999999999999999999


Q ss_pred             EEEeccCCeeEEEe-------------------------------------------ccccccceeeeeecCCCCCCccc
Q 003356          332 TVWSVSGCRLMSTI-------------------------------------------RQISLSSISSPIVKPNQDCKYEP  368 (827)
Q Consensus       332 ~vWs~~~~~l~~tl-------------------------------------------~~~~~~~v~s~~~sp~~~~~~~~  368 (827)
                      ++||+.++++..++                                           .+| ...|.+++|+|++    ..
T Consensus       264 ~lWd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~s~s~d~~i~~~~~~~~~~~~~~~gh-~~~v~~l~~spdg----~~  338 (611)
T 1nr0_A          264 KIWNVATLKVEKTIPVGTRIEDQQLGIIWTKQALVSISANGFINFVNPELGSIDQVRYGH-NKAITALSSSADG----KT  338 (611)
T ss_dssp             EEEETTTTEEEEEEECCSSGGGCEEEEEECSSCEEEEETTCCEEEEETTTTEEEEEECCC-SSCEEEEEECTTS----SE
T ss_pred             EEEeCCCCceeeeecCCCCccceeEEEEEcCCEEEEEeCCCcEEEEeCCCCCcceEEcCC-CCCEEEEEEeCCC----CE
Confidence            99999877665443                                           344 5679999999999    88


Q ss_pred             eeecc---eeEEEccCCceEEEEe-cCCcceEEEEec--ceeeeecccCCCeeeeEEEEc--------------------
Q 003356          369 LMSGT---SMMQWDEYGYRLYAIE-EGSSERVLIFSF--GKCCLNRGVSGMTYARQVIYG--------------------  422 (827)
Q Consensus       369 l~sg~---~i~~W~~~~~~l~~~~-~~~~~~v~~~~~--~~~~~s~~~d~~~~~w~~~~~--------------------  422 (827)
                      +++++   ++++|+..++++.... .+|...+..+.+  ...+++++.|+++++|++..+                    
T Consensus       339 l~s~s~D~~v~~Wd~~~~~~~~~~~~~h~~~v~~~~~s~~~~l~s~s~d~~v~~w~~~~~~~~~~~~~~~~~~~~~~~~~  418 (611)
T 1nr0_A          339 LFSADAEGHINSWDISTGISNRVFPDVHATMITGIKTTSKGDLFTVSWDDHLKVVPAGGSGVDSSKAVANKLSSQPLGLA  418 (611)
T ss_dssp             EEEEETTSCEEEEETTTCCEEECSSCSCSSCEEEEEECTTSCEEEEETTTEEEEECSSSSSSCTTSCCEEECSSCEEEEE
T ss_pred             EEEEeCCCcEEEEECCCCceeeecccCCcceEEEEEECCCCcEEEEEcCCceEEeecCCccccccceeeeecCCCCcEEE
Confidence            88886   8999999988876654 457777755554  556778888888887763211                    


Q ss_pred             ----------------------------------------CCeEEEEecCCCCcceEEEe----eeceeeccCCCcEEEE
Q 003356          423 ----------------------------------------EDRLLVVQSEDTDELKILHL----NLPVSYISQNWPVQHV  458 (827)
Q Consensus       423 ----------------------------------------~~~~~~~~~~d~~~~~w~~~----~~p~~~~~~~~~I~~v  458 (827)
                                                              +.+.++..+.|.....|..-    ..... .+|..+|.++
T Consensus       419 ~s~dg~~~~~~~~~~v~~~~~~~~~~~~~~~~v~~va~spdg~~lasgs~D~~v~lwd~~~~~~~~~~~-~~h~~~v~~v  497 (611)
T 1nr0_A          419 VSADGDIAVAACYKHIAIYSHGKLTEVPISYNSSCVALSNDKQFVAVGGQDSKVHVYKLSGASVSEVKT-IVHPAEITSV  497 (611)
T ss_dssp             ECTTSSCEEEEESSEEEEEETTEEEEEECSSCEEEEEECTTSCEEEEEETTSEEEEEEEETTEEEEEEE-EECSSCEEEE
T ss_pred             EeCCCcEEEEEeCceEEEEeCCceeeeecCCCceEEEEeCCCCEEEEeCCCCeEEEEEccCCceeeeec-cCCCCceEEE
Confidence                                                    11122222333334456432    11122 6799999999


Q ss_pred             EEcCCCCEEEEEeCCceE-EEEcCC-CeEEeeCCccceEEEEEEEEEEeCC--EEEEEEEeeCCCcEEEEEeeCCCCCcc
Q 003356          459 AASKDGMFLAVAGLHGLI-LYDIRQ-KKWRVFGDITQEQKIQSKGLLWLGK--IIVVCNYIDSSNTYELLFYPRYHLDQS  534 (827)
Q Consensus       459 a~SpdG~~lavag~dg~i-iwd~~t-~~w~~f~~~~~e~~~~v~gl~W~~~--~li~~~~~~~~~~~~lrly~~~~l~~~  534 (827)
                      +|||||++||+++.|+.+ +|++.+ ++.... .....+...|..++|..+  .+++|+.     +..+++|....... 
T Consensus       498 ~fspdg~~las~s~d~~v~~w~~~~~~~~~~~-~~~~~H~~~V~~v~fspdg~~lasgs~-----D~~v~lW~~~~~~~-  570 (611)
T 1nr0_A          498 AFSNNGAFLVATDQSRKVIPYSVANNFELAHT-NSWTFHTAKVACVSWSPDNVRLATGSL-----DNSVIVWNMNKPSD-  570 (611)
T ss_dssp             EECTTSSEEEEEETTSCEEEEEGGGTTEESCC-CCCCCCSSCEEEEEECTTSSEEEEEET-----TSCEEEEETTCTTS-
T ss_pred             EECCCCCEEEEEcCCCCEEEEEcCCCCceeee-eeeeecccceeEEEECCCCCEEEEEEC-----CCcEEEEECCCccc-
Confidence            999999999999999999 999987 442211 011112235788999754  6666632     35699998852111 


Q ss_pred             ceEEEE-ec-CCcc--EEEEccCCEEEEEEcCceEEEEEE
Q 003356          535 SLLCRK-SL-LAKP--IVMDVYEDYILVTYRPFDVHIFHV  570 (827)
Q Consensus       535 ~~~~~~-~l-~~~~--~~l~~~~~~llV~~~~~~i~l~~~  570 (827)
                      ...... .+ ...+  +.++..+. ++.+..|+.|++|++
T Consensus       571 ~~~~~~~~h~~~~v~~v~fs~d~~-l~s~~~D~~i~lW~~  609 (611)
T 1nr0_A          571 HPIIIKGAHAMSSVNSVIWLNETT-IVSAGQDSNIKFWNV  609 (611)
T ss_dssp             CCEEETTSSTTSCEEEEEEEETTE-EEEEETTSCEEEEEC
T ss_pred             ccchhhccCcccCeeEEEEcCCCE-EEEecCCCCEEEEec
Confidence            111111 12 1222  23344444 666788999999986
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 827
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-05
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 0.001
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.003
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.003
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Arp2/3 complex 41 kDa subunit ARPC1
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 44.5 bits (103), Expect = 4e-05
 Identities = 16/124 (12%), Positives = 41/124 (33%), Gaps = 7/124 (5%)

Query: 261 CASIAPEQQILAVGTRRGVVELYDLAESASLIRTVSLYDWGYSMDDTGPVSCIAWTPDNS 320
           C +   ++  +A+      V +Y+       ++   L +        G V+ + W PD++
Sbjct: 12  CHAWNKDRTQIAICPNNHEVHIYEK-SGNKWVQVHELKE------HNGQVTGVDWAPDSN 64

Query: 321 AFAVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDE 380
                   R   VW++ G     T+  + ++  +  +     + K+        +     
Sbjct: 65  RIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNEKKFAVGSGSRVISICYF 124

Query: 381 YGYR 384
               
Sbjct: 125 EQEN 128
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query827
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.96
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.95
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.95
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.95
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.95
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.95
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.95
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.94
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.94
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.93
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.93
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.93
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.93
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.92
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.91
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.91
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.9
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.89
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.89
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.89
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.87
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.87
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.86
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.84
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.84
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.83
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.83
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.79
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.78
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.77
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.74
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.73
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.62
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.61
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.59
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.57
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.57
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.56
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.54
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.53
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.47
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.4
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.39
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.39
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.28
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.09
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.96
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.95
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.64
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.54
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.5
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.31
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.31
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.3
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.16
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.98
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.95
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.88
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.83
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.81
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.78
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.68
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.66
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.65
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.59
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.44
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.27
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.24
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.11
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 96.69
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.62
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 91.05
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 91.04
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 87.5
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 86.44
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 84.48
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 83.84
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=5.6e-27  Score=252.04  Aligned_cols=313  Identities=12%  Similarity=0.124  Sum_probs=213.8

Q ss_pred             EEEEecceEEEEEc-cCeEEEeecCCceeEEEEEEeChHhhhhcCcccEEEEcCCccEEEEEecCcEEEEEEEEecCcee
Q 003356           25 IYFKVNNGLLLIAS-PCHIELWSSSQHKVRLGKYKRDSESVQREGENLQAVWSPDTKLIAVVTSSLYLHIFKVQITEKSI  103 (827)
Q Consensus        25 v~fspdg~lla~~~-~~~v~IW~~~~~~~~l~~~~r~~~s~~~~G~~~~v~wSPDg~~lav~t~dg~l~l~~v~~~~~~~  103 (827)
                      ...++||++..... .+.+ + +..-|+.     .|....+.+-+.+.+++|||||++||+++ ||.|++||+.......
T Consensus        15 ~~~~~~~~~~~~~~~~~~~-~-~~~~p~~-----~~~~~~~~H~~~V~~v~fs~~g~~latg~-dg~V~iWd~~~~~~~~   86 (337)
T d1gxra_          15 FHVTADGQMQPVPFPPDAL-I-GPGIPRH-----ARQINTLNHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKS   86 (337)
T ss_dssp             EEECSSSCEEECCCCTTSS-S-STTCCSE-----EEEEEEECCSSCCCEEEECSSSSEEEEEC-BSEEEEEETTSTTCCS
T ss_pred             ccCCCCCCEEeeccCCcce-e-cCCCCCC-----ceEEEECCCCCcEEEEEECCCCCEEEEEE-CCEEEEEEccCCcccc
Confidence            45677887765543 3332 1 1111221     11112233457789999999999999987 8999999986433210


Q ss_pred             ecCCCCCCCceeeeEeeEeecccccccccceEEE--eecCCCeEEEEecCCcEEEEecCCccCcceeecccCCCCcccce
Q 003356          104 QIGGKQPSGLFFIKISLVLNEQLPFAEKGLSVSN--IVSDNKHMLLGLSDGSLYSISWKGEFYGAFELVHSSNDSSVAAL  181 (827)
Q Consensus       104 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~v~~--~~~d~~~llv~t~dg~i~~~~w~~~~~~~~~l~~~p~~~~~i~~  181 (827)
                      .          +.        .....++...|.+  ++++++.|++++.||.|++|+.........              
T Consensus        87 ~----------~~--------~~~~~~h~~~I~~v~~s~dg~~l~s~~~dg~i~iwd~~~~~~~~~--------------  134 (337)
T d1gxra_          87 P----------VS--------QLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIK--------------  134 (337)
T ss_dssp             C----------SE--------EEECSCTTSBEEEEEECTTSSEEEEEESSSEEEEEECCCC--EEE--------------
T ss_pred             e----------eE--------EeeecCCCCcEEEEEEcCCCCEEEEeecccccccccccccccccc--------------
Confidence            0          00        0011233445544  567888999999999999866543221110              


Q ss_pred             ecccCCCCccccccCCceeccccCCCcccEEEEEEcCCcceEEEEEeCCcEEEEeeccCccccceeecccee---cCCCC
Q 003356          182 SHHFPSNGLASVDTSGAFVSDHKFPISSAIIWLELCLPMRLLFVLYSNGQLMSCSVSKKGLKLAEFIKIDKE---LGSGD  258 (827)
Q Consensus       182 ~~~s~~~~~~~~~~~~~~~~~~~~~~~~~i~~i~~~~~~~~~~~~s~dG~~~~~~~~~~~~~~~~~~~~~~~---~~h~~  258 (827)
                                          ..+..+...+..+          .+++++..++++..++.+++|+....+..   .+|..
T Consensus       135 --------------------~~~~~~~~~v~~~----------~~~~~~~~l~s~~~d~~i~~~~~~~~~~~~~~~~~~~  184 (337)
T d1gxra_         135 --------------------AELTSSAPACYAL----------AISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTD  184 (337)
T ss_dssp             --------------------EEEECSSSCEEEE----------EECTTSSEEEEEETTSCEEEEETTTTEEEEEECCCSS
T ss_pred             --------------------ccccccccccccc----------ccccccccccccccccccccccccccccccccccccc
Confidence                                0111223334443          36778888888888888888887665433   56777


Q ss_pred             cEE-EEEcCCCCEEEEEecCCeEEEEEcCCCCcceEEEEeecCCCCCCCCCCeEEEEECCCCCEEEEEEcCCcEEEEecc
Q 003356          259 AVC-ASIAPEQQILAVGTRRGVVELYDLAESASLIRTVSLYDWGYSMDDTGPVSCIAWTPDNSAFAVGWKSRGLTVWSVS  337 (827)
Q Consensus       259 ~v~-va~sp~~~lla~g~~dg~v~vw~~~~~~~~~~~l~~~~~~~~~~h~~~V~~l~~spDg~~Lasg~~Dg~v~vWs~~  337 (827)
                      .+. ++|++++..+++|+.||.|++||+.+ ++.++.+.         |.++|.+++|+|+++.|++|+.|+.+++|++.
T Consensus       185 ~v~~l~~s~~~~~~~~~~~d~~v~i~d~~~-~~~~~~~~---------~~~~i~~l~~~~~~~~l~~~~~d~~i~i~d~~  254 (337)
T d1gxra_         185 GASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHD---------FTSQIFSLGYCPTGEWLAVGMESSNVEVLHVN  254 (337)
T ss_dssp             CEEEEEECTTSSEEEEEETTSEEEEEETTT-TEEEEEEE---------CSSCEEEEEECTTSSEEEEEETTSCEEEEETT
T ss_pred             cccccccccccccccccccccccccccccc-ceeecccc---------cccceEEEEEcccccccceecccccccccccc
Confidence            776 99999999999999999999999987 66665543         78999999999999999999999999999998


Q ss_pred             CCeeEEEeccccccceeeeeecCCCCCCccceeecceeEEEccCCceEEEEecCCcceEEEEecceeeeecccCCCeeee
Q 003356          338 GCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYGYRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYAR  417 (827)
Q Consensus       338 ~~~l~~tl~~~~~~~v~s~~~sp~~~~~~~~l~sg~~i~~W~~~~~~l~~~~~~~~~~v~~~~~~~~~~s~~~d~~~~~w  417 (827)
                      ++..... ..| ...|.+++|+|++    ..+                                    ++++.|+.+++|
T Consensus       255 ~~~~~~~-~~~-~~~i~~v~~s~~g----~~l------------------------------------~s~s~Dg~i~iw  292 (337)
T d1gxra_         255 KPDKYQL-HLH-ESCVLSLKFAYCG----KWF------------------------------------VSTGKDNLLNAW  292 (337)
T ss_dssp             SSCEEEE-CCC-SSCEEEEEECTTS----SEE------------------------------------EEEETTSEEEEE
T ss_pred             ccccccc-ccc-ccccceEEECCCC----CEE------------------------------------EEEeCCCeEEEE
Confidence            8876533 334 4567777777765    333                                    445556666666


Q ss_pred             EEEEcCCeEEEEecCCCCcceEEEeeeceeeccCCCcEEEEEEcCCCCEEEEEeCCceE-EEEc
Q 003356          418 QVIYGEDRLLVVQSEDTDELKILHLNLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLI-LYDI  480 (827)
Q Consensus       418 ~~~~~~~~~~~~~~~d~~~~~w~~~~~p~~~~~~~~~I~~va~SpdG~~lavag~dg~i-iwd~  480 (827)
                      ++..+..                     .....|..+|.+++|||||++||+||.||.+ +||+
T Consensus       293 d~~~~~~---------------------~~~~~~~~~v~~~~~s~d~~~l~t~s~D~~I~vWdl  335 (337)
T d1gxra_         293 RTPYGAS---------------------IFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEV  335 (337)
T ss_dssp             ETTTCCE---------------------EEEEECSSCEEEEEECTTSCEEEEEETTSCEEEEEE
T ss_pred             ECCCCCE---------------------EEEccCCCCEEEEEEeCCCCEEEEEeCCCeEEEEEE
Confidence            5332221                     1123467789999999999999999999999 9996
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure