Citrus Sinensis ID: 003420

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-
MELIDRRMLKIQEDNNVVAEGAALEMIDCLPGFLGTSRLGLAGVVNEEDQRIALGRITQIDGMIKTICDPKKWDEVSTLLIDGDRLRLEVDEGFLARMKQLHALAIFNSGFKSLDLSSKTEKKSEPEKLPMKLLVLRSCNLLNGIGDIELLKKLTVLEISGANSVQKIPDKLLDEMTKLQSLNLSGCQMKFLPSLSKLFNLRFLILRDCSSLQKLPRINELVRLEIIDLSGATSLTFFPEQDLSKHQHLQMIDLSRTQIKRLPKFGYLKRLSRISIEGCKRFHNFHEIKPRDSNTKSKPLFPVSLSELHLRDCPTLKRLPHIAGLKNLEVLDVSGTSDSKFAISDESFHDLDYLRELNLSNTKLKSLPPLSNLHRLRKLFLKNCELLEELPKMNGLENLEVLDLSGCSKLVEFPKLKDFPKLELLDISNTGIKVVPSDISVTSSNFTPDEKHRQASGVFNLVGSLAKGKKPLILANDGQIFQSDTGIKADPSEIAATSSNVVPDKKHRQAHGKKPSVLVNDGGNSQSNDGMEADPSKISAPKSANEVTDKRRGQANGVFTPAESQAKGKPSILTNDGEIVQSLEKNPELKEVRKLEISIPLSPSNEQATEGVMFSDLYRWAERKAAAKFLEIRGLKSICDGLKEILNNTEYISWVEPKPMKSLSDLDAGSLVKMEGLWIARCIEMESIFGEEKDIELARNLKILWVSNLPKVESLFNHKLQSVKNLENLKHLHLDCCPRLKCVFASPDQIPKRLEVLEIKFCDSLETVYKHSGDEQDECALSTLKKLFLFKLPALTSLGFKIPDAQIIKGCPKLPGSSSST
ccccccccEEEccccEEEccccHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHcccccccccccEEEEEcccccccccHHHHHccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEcccccccccccccccccccEEEccccccccccccccccccccEEEEEcccccccccHHcccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccHHHccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccEEEEEcccccccccccccccccccccccEEcccccccccccccccccccccccEEccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccc
ccccccEEEEEcccccccccHHHHHHHHHHHHHHHHccccccccccccccccccHHEEcccccccccccccccccEEEEEEcccccEccccHHHHHHcccccEEEcccccccccccHHHccccccccccccEEEEcccccccccccccHHHHHcccccEEEcccccccccHHHHHcccccEEEcccccccccHHHHHcccccEEEccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEccccccccccccccccccEEEEcccccccccccccccccccccHHHcccccccEEEcccccccccccccccccccEEEEcccccccccccccHHHcccccccEEEccccccccccccccccccEEEEcccccccccccccccccccEEEEccccccccccccccccccccEEEcccccccccccHcccccccccccccccHHccEEccccccccccccHHHHcHHHHHHHcccHccccHHHcccccccEEccccccccccccccccccccccccccccccccccccccccHcHHHHHHHHcccccccccccHHHccHHHccHHccccccccccccccccccccccccccccHHccccHHHHccccccccccccccccccccHHccccccHHHHHHHccccccccccccccccccccccccHHHHHHHHcccccHcccccHHHHccccccHcccccHHHHHcccccccccHHHHHHccEEcccccHHHHHcccccccccccccEEEccccccHccccccccccccHcccHHccEEcccccccccccccccccHHHHccccccccccccc
MELIDRRMLKIQEDNNVVAEGAALEMIdclpgflgtsrlglagvvneedqRIALGRITQIDGmikticdpkkwdevstllidgdrlrlEVDEGFLARMKQLHALAIFNSgfksldlssktekksepeklpMKLLVLRSCNLLNGIGDIELLKKLTVLEIsgansvqkiPDKLLDEMTKLQslnlsgcqmkflpslsklfNLRFLILRDCsslqklprinELVRLEIIdlsgatsltffpeqdlskhqhLQMIDLSRTQikrlpkfgylkrlsrisiegckrfhnfheikprdsntkskplfpvslselhlrdcptlkrlphiaglknlevldvsgtsdskfaisdesfhdlDYLRELnlsntklkslpplsnlhRLRKLFLKNCELleelpkmnglenlevldlsgcsklvefpklkdfpklelldisntgikvvpsdisvtssnftpdekhrqasGVFNLVgslakgkkplilandgqifqsdtgikadpseiaatssnvvpdkkhrqahgkkpsvlvndggnsqsndgmeadpskisapksanevtdkrrgqangvftpaesqakgkpsiltndgeivqsleknpelkevrkleisiplspsneqategvmfSDLYRWAERKAAAKFLEIRGLKSICDGLKEILNNteyiswvepkpmkslsdldagslvKMEGLWIARCIEMESIFGEEKDIELARNLKILwvsnlpkveSLFNHKLQSVknlenlkhlhldccprlkcvfaspdqipkRLEVLEIKFCDSLETVykhsgdeqdeCALSTLKKLFlfklpaltslgfkipdaqiikgcpklpgsssst
melidrrmLKIQEDNNVVAEGAALEMIDCLPGFLGTSRLGLagvvneedqrialgritqidgmikticdpkkwdEVSTLLIDGDRLRLEVDEGFLARMKQLHALAIFNsgfksldlssktekksepeklpmkLLVLRSCNLLNGIGDIELLKKLTVLEISgansvqkipDKLLDEMTKLQSLNLSGCQMKFLPSLSKLFNLRFLILRDCSSLQKLPRINELVRLEIIDLSGATSLTFFPEQDLSKHQHLQMIDLsrtqikrlpkfgylkrlsrisiEGCKRFHNFheikprdsntkskPLFPVSLSELHLRDCPTLKRLPHIAGLKNLEVLDVSGTSDSKFAISDESFHDLDYLRELNLSntklkslpplsnlhrLRKLFLKNCELLEELPKMNGLENLEVLDLSGCSKLVEFPKLKDFPKLELldisntgikvvpsdISVTSSnftpdekhrqASGVFNLVGSLAKGKKPLILANDGQIFQSDTGIKADPSEIAAtssnvvpdkkhrqahgkkpsvlvndggnsqsndgmeadpskisapksanevtdkrrgqangvftpaesqakgkpsiltndgeivqsleknpelkevRKLEisiplspsneqategVMFSDLYRWAERKAAAKFLEIRGLKSICDGLKEILNNTEYISWVEPKPMKSLSDLDAGSLVKMEGLWIARCIEMESIFGEEKDIELARNLKILWVSNLPKVESLFNHKLQSVKNLENLKHLHLDCCPRLKCVFASPDQIPKRLEVLEIKFCDSLETVYKHSGDEQDECALSTLKKLFLFKLPALTSLGfkipdaqiikgcpklpgsssst
MELIDRRMLKIQEDNNVVAEGAALEMIDCLPGFLGTSRLGLAGVVNEEDQRIALGRITQIDGMIKTICDPKKWDEVSTLLIDGDRLRLEVDEGFLARMKQLHALAIFNSGFKSLDLssktekksepekLPMKLLVLRSCNLLNGIGDIELLKKLTVLEISGANSVQKIPDKLLDEMTKLQSLNLSGCQMKFLPSLSKLFNLRFLILRDCSSLQKLPRINELVRLEIIDLSGATSLTFFPEQDLSKHQHLQMIDLSRTQIKRLPKFGYLKRLSRISIEGCKRFHNFHEIKPRDSNTKSKPLFPVSLSELHLRDCPTLKRLPHIAGLKNLEVLDVSGTSDSKFAISDESFHDLDYLRELNLSNTKLKSLPPLSNLHRLRKLFLKNCELLEELPKMNGLENLEVLDLSGCSKLVEFPKLKDFPKLELLDISNTGIKVVPSDISVTSSNFTPDEKHRQASGVFNLVGSLAKGKKPLILANDGQIFQSDTGIKADPSEIAATSSNVVPDKKHRQAHGKKPSVLVNDGGNSQSNDGMEADPSKISAPKSANEVTDKRRGQANGVFTPAESQAKGKPSILTNDGEIVQSLEKNPELKEVRKLEISIPLSPSNEQATEGVMFSDLYRWAERKAAAKFLEIRGLKSICDGLKEILNNTEYISWVEPKPMKSLSDLDAGSLVKMEGLWIARCIEMESIFGEEKDIELARNLKILWVSNLPKVESLFNHKLQSVKNLENLKHLHLDCCPRLKCVFASPDQIPKRLEVLEIKFCDSLETVYKHSGDEQDECALSTlkklflfklPALTSLGFKIPDAQIIKGCPKLPGSSSST
**********IQEDNNVVAEGAALEMIDCLPGFLGTSRLGLAGVVNEEDQRIALGRITQIDGMIKTICDPKKWDEVSTLLIDGDRLRLEVDEGFLARMKQLHALAIFNSGFK******************MKLLVLRSCNLLNGIGDIELLKKLTVLEISGANSVQKIPDKLLDEMTKLQSLNLSGCQMKFLPSLSKLFNLRFLILRDCSSLQKLPRINELVRLEIIDLSGATSLTFFPEQDLSKHQHLQMIDLSRTQIKRLPKFGYLKRLSRISIEGCKRFHNFHEI***********LFPVSLSELHLRDCPTLKRLPHIAGLKNLEVLDVSGTSDSKFAISDESFHDLDYLRELNLSNTKLKSLPPLSNLHRLRKLFLKNCELLEELPKMNGLENLEVLDLSGCSKLVEFPKLKDFPKLELLDISNTGIKVVPSDIS****************GVFNLVGSLAKGKKPLILANDGQIF*********************************************************************************************************************************GVMFSDLYRWAERKAAAKFLEIRGLKSICDGLKEILNNTEYISWVEPKPMKSLSDLDAGSLVKMEGLWIARCIEMESIFGEEKDIELARNLKILWVSNLPKVESLFNHKLQSVKNLENLKHLHLDCCPRLKCVFASPDQIPKRLEVLEIKFCDSLETVYKHSGDEQDECALSTLKKLFLFKLPALTSLGFKIPDAQIIKGC**********
MELIDRRMLKIQEDNNVVAEGAALEMIDCLPGFLGTSRLGL**************RITQIDGMIKTICDPKKWDEVSTLLIDGDRLRLEVDEGFLARMKQLHALAIFNSGFKSLDLSSKTEKKSEPEKLPMKLLVLRSCNLLNGIGDIELLKKLTVLEISGANSVQKIPDKLLDEMTKLQSLNLSGCQMKFLPSLSKLFNLRFLILRDCSSLQKLPRINELVRLEIIDLSGATSLTFFPEQDLSKHQHLQMIDLSRTQIKRLPKFGYLKRLSRISIEGCKRFHNFHEIKP****TKSKPLFPVSLSELHLRDCPTLKRLPHIAGLKNLEVLDVSGTSDSKFAISDESFHDLDYLRELNLSNTKLKSLPPLSNLHRLRKLFLKNCELLEELPKMNGLENLEVLDLSGCSKLVEFPKLKDFPKLELLDISNTGIKVVPSDISVTSSNFTPDEKHRQASGVFNLVGSLAKGKKPLILANDGQIFQSDTGIKADPSEIAATSSNVVPDKKHRQAHGKKPSVLVNDGGNSQSNDGMEADPSKISAPKSANEVTDKRRG************AKGKPSILTNDGEIVQSLEKNPELKEVRKLEISIPLSPSNEQATEGVMFSDLYRWAERKAAAKFLEIRGLKSICDGLKEILNNTEYISWVEPKPMKSLSDLDA**L*KMEGLWIARCIEMESIFGEEKDIELARNLKILWVSNLPKVESLFNHKLQSVKNLENLKHLHLDCCPRLKCVFASPDQIPKRLEVLEIKFCDSLETVYKHSGDEQDECALSTLKKLFLFKLPALTSLGFKIPDAQIIKGCP**PG*****
MELIDRRMLKIQEDNNVVAEGAALEMIDCLPGFLGTSRLGLAGVVNEEDQRIALGRITQIDGMIKTICDPKKWDEVSTLLIDGDRLRLEVDEGFLARMKQLHALAIFNSGFKSLD************KLPMKLLVLRSCNLLNGIGDIELLKKLTVLEISGANSVQKIPDKLLDEMTKLQSLNLSGCQMKFLPSLSKLFNLRFLILRDCSSLQKLPRINELVRLEIIDLSGATSLTFFPEQDLSKHQHLQMIDLSRTQIKRLPKFGYLKRLSRISIEGCKRFHNFHEIKPRDSNTKSKPLFPVSLSELHLRDCPTLKRLPHIAGLKNLEVLDVSGTSDSKFAISDESFHDLDYLRELNLSNTKLKSLPPLSNLHRLRKLFLKNCELLEELPKMNGLENLEVLDLSGCSKLVEFPKLKDFPKLELLDISNTGIKVVPSDISVTSSNFTPDEKHRQASGVFNLVGSLAKGKKPLILANDGQIFQSDTGIKADPSEIA*******************PSVLVNDGGNS*************************RRGQANGVFTPAESQAKGKPSILTNDGEIVQSLEKNPELKEVRKLEISIPLSPSNEQATEGVMFSDLYRWAERKAAAKFLEIRGLKSICDGLKEILNNTEYISWVEPKPMKSLSDLDAGSLVKMEGLWIARCIEMESIFGEEKDIELARNLKILWVSNLPKVESLFNHKLQSVKNLENLKHLHLDCCPRLKCVFASPDQIPKRLEVLEIKFCDSLETVYKHSGDEQDECALSTLKKLFLFKLPALTSLGFKIPDAQIIKGCP*********
*ELIDRRMLKIQEDNNVVAEGAALEMIDCLPGFLGTSRLGLAGVVNEEDQRIALGRITQIDGMIKTICDPKKWDEVSTLLIDGDRLRLEVDEGFLARMKQLHALAIFNSGFKSLDLSSKTEKKSEPEKLPMKLLVLRSCNLLNGIGDIELLKKLTVLEISGANSVQKIPDKLLDEMTKLQSLNLSGCQMKFLPSLSKLFNLRFLILRDCSSLQKLPRINELVRLEIIDLSGATSLTFFPEQDLSKHQHLQMIDLSRTQIKRLPKFGYLKRLSRISIEGCKRFHNFHEIKPRDSNTKSKPLFPVSLSELHLRDCPTLKRLPHIAGLKNLEVLDVSGTSDSKFAISDESFHDLDYLRELNLSNTKLKSLPPLSNLHRLRKLFLKNCELLEELPKMNGLENLEVLDLSGCSKLVEFPKLKDFPKLELLDISNTGIKVVPSDISVTSSNFTPDEKHRQASGVFNLVGSLAKGKKPLILANDGQIFQSDTGIKADPSEIAATSSNVVPDKKHRQAHGKKPSVLVNDGGNSQSNDGMEADPSKISAPKSANEVTDKRRGQANGVFTPAESQAKGKPSILTNDGEIVQSLEKNPELKEVRKLEISIPLSPSNEQATEGVMFSDLYRWAERKAAAKFLEIRGLKSICDGLKEILNNTEYISWVEPKPMKSLSDLDAGSLVKMEGLWIARCIEMESIFGEEKDIELARNLKILWVSNLPKVESLFNHKLQSVKNLENLKHLHLDCCPRLKCVFASPDQIPKRLEVLEIKFCDSLETVYKHSGDEQDECALSTLKKLFLFKLPALTSLGFKIPDAQIIKGCPKLP******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELIDRRMLKIQEDNNVVAEGAALEMIDCLPGFLGTSRLGLAGVVNEEDQRIALGRITQIDGMIKTICDPKKWDEVSTLLIDGDRLRLEVDEGFLARMKQLHALAIFNSGFKSLDLSSKTEKKSEPEKLPMKLLVLRSCNLLNGIGDIELLKKLTVLEISGANSVQKIPDKLLDEMTKLQSLNLSGCQMKFLPSLSKLFNLRFLILRDCSSLQKLPRINELVRLEIIDLSGATSLTFFPEQDLSKHQHLQMIDLSRTQIKRLPKFGYLKRLSRISIEGCKRFHNFHEIKPRDSNTKSKPLFPVSLSELHLRDCPTLKRLPHIAGLKNLEVLDVSGTSDSKFAISDESFHDLDYLRELNLSNTKLKSLPPLSNLHRLRKLFLKNCELLEELPKMNGLENLEVLDLSGCSKLVEFPKLKDFPKLELLDISNTGIKVVPSDISVTSSNFTPDEKHRQASGVFNLVGSLAKGKKPLILANDGQIFQSDTGIKADPSEIAATSSNVVPDKKHRQAHGKKPSVLVNDGGNSQSNDGMEADPSKISAPKSANEVTDKRRGQANGVFTPAESQAKGKPSILTNDGEIVQSLEKNPELKEVRKLEISIPLSPSNEQATEGVMFSDLYRWAERKAAAKFLEIRGLKSICDGLKEILNNTEYISWVEPKPMKSLSDLDAGSLVKMEGLWIARCIEMESIFGEEKDIELARNLKILWVSNLPKVESLFNHKLQSVKNLENLKHLHLDCCPRLKCVFASPDQIPKRLEVLEIKFCDSLETVYKHSGDEQDECALSTLKKLFLFKLPALTSLGFKIPDAQIIKGCPKLPGSSSST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query821 2.2.26 [Sep-21-2011]
Q8VZC71222 Probable disease resistan yes no 0.488 0.328 0.376 5e-60
P0CB161201 Putative disease resistan no no 0.518 0.354 0.349 1e-57
O235301301 Protein SUPPRESSOR OF npr no no 0.338 0.213 0.297 1e-19
P23799630 Putative adenylate cyclas N/A no 0.322 0.420 0.267 1e-12
P26337630 Putative adenylate cyclas N/A no 0.325 0.423 0.262 2e-12
Q9RBS21024 Protein PopC OS=Ralstonia yes no 0.342 0.274 0.281 1e-11
Q9SZ671895 Probable WRKY transcripti no no 0.208 0.090 0.319 1e-10
Q9FH831288 Probable WRKY transcripti no no 0.289 0.184 0.290 2e-10
Q723X5 1775 Internalin-I OS=Listeria yes no 0.228 0.105 0.291 6e-10
Q9T048985 Disease resistance protei no no 0.127 0.106 0.407 7e-10
>sp|Q8VZC7|DRL36_ARATH Probable disease resistance protein At5g45510 OS=Arabidopsis thaliana GN=At5g45510 PE=1 SV=2 Back     alignment and function desciption
 Score =  233 bits (594), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 174/462 (37%), Positives = 257/462 (55%), Gaps = 61/462 (13%)

Query: 1   MELIDRRMLKIQEDNNVVAEGAALEMIDCL-PGFLGTSRLGLAGVVNEEDQRIALGRITQ 59
           MELIDR MLKIQE+N VV E A   +ID    G LG SRLG + V    ++R  +G+ITQ
Sbjct: 532 MELIDRGMLKIQENNVVVPEMAMRNVIDPRRGGHLGKSRLGFSRVYGG-NKRKGIGKITQ 590

Query: 60  IDGMIKTICDPKKWDEVSTLLIDGDRLRLEVDEGFLARMKQLHALAIFNSGFKSLDLSSK 119
           +D MIKT+   KK D+++T+L+ GDRLR    + F   +K+L  L +F    K    S  
Sbjct: 591 LDDMIKTV-QAKKGDKITTILVSGDRLRRVTPKKFFKNLKELEVLGLFEPTVKPFVPSFS 649

Query: 120 TEKKSEPEKLPMKLLVLRSCNLLNGIGDIELLKKLTVLEISGANSVQKIPDKLLDEMTKL 179
            + K       +++L++R C+LL  I +++ L KL  LE+SGA+S+ KI +K  +   +L
Sbjct: 650 DQLKL------LRVLIIRDCDLLKSIEELKALTKLNTLEVSGASSLSKISEKFFESFPEL 703

Query: 180 QSLNLSGCQMKFL-PSLSKLFNLRFLILRDCSSLQKLPRINELVRLEIIDLSGATSL-TF 237
           +SL+LSG +++   PS+S L  L  LI++DC  LQ LP I ELV LE++D+SGA+ L T 
Sbjct: 704 RSLHLSGLKIESSPPSISGLKELHCLIIKDCPLLQDLPNIQELVNLEVVDVSGASGLRTC 763

Query: 238 FPEQD--------------LSKHQHLQMIDLSRTQIKRLPKFGYLKRLSRISIEGCKRFH 283
           F   D              L+K QHL   D S +QI+RLP F                  
Sbjct: 764 FDNADGAKKNKSKNKNFYLLTKLQHL---DFSGSQIERLPIF------------------ 802

Query: 284 NFHEIKPRDSNTKSKPLFPVSLSELHLRDCPTLKRLPHIAGLKNLEVLDVSGTSDSKFAI 343
                  +DS   +K     SL+ L LR+C  L+RLP +  L  L++LD+SGT+ S   +
Sbjct: 803 -------QDSAVAAKLH---SLTRLLLRNCSKLRRLPSLKPLSGLQILDLSGTT-SLVEM 851

Query: 344 SDESFHDLDYLRELNLSNTKLKSLP-PLSNLHRLRKLFLKNCELLEELPKMNGLENLEVL 402
            +  F D   L+ LNLS T L  L   + +L  L +L L++C  L+ +P +  LENLEV+
Sbjct: 852 LEVCFEDKLELKTLNLSGTNLSELATTIEDLSSLNELLLRDCINLDAIPNIEKLENLEVI 911

Query: 403 DLSGCSKLVEFP-KLKDFPKLELLDISNTGIKV--VPSDISV 441
           D+SG +KL +     +    L ++D+S T ++   +P+D  +
Sbjct: 912 DVSGSAKLAKIEGSFEKMFYLRVVDLSGTQVETPELPADTKI 953
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|P23799|ESAG8_TRYBB Putative adenylate cyclase regulatory protein OS=Trypanosoma brucei brucei GN=ESAG8 PE=2 SV=1 Back     alignment and function description
>sp|P26337|ESA8C_TRYEQ Putative adenylate cyclase regulatory protein OS=Trypanosoma equiperdum GN=ESAG8C PE=2 SV=1 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q723X5|INLI_LISMF Internalin-I OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlI PE=3 SV=1 Back     alignment and function description
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query821
224074429 1265 nbs-lrr resistance protein [Populus tric 0.515 0.334 0.439 7e-78
449469418 1078 PREDICTED: putative disease resistance p 0.965 0.735 0.293 1e-68
145334747 1210 leucine-rich repeat-containing protein [ 0.488 0.331 0.376 3e-58
222423297 1210 AT5G45510 [Arabidopsis thaliana] 0.488 0.331 0.376 3e-58
18086486 1202 AT5g45510/MFC19_18 [Arabidopsis thaliana 0.488 0.333 0.376 3e-58
22327597 1222 leucine-rich repeat-containing protein [ 0.488 0.328 0.376 3e-58
9758741 1214 unnamed protein product [Arabidopsis tha 0.485 0.328 0.377 4e-58
2832633 1405 putative protein [Arabidopsis thaliana] 0.523 0.306 0.348 7e-56
240256006 1201 NB-ARC domain-containing disease resista 0.518 0.354 0.349 9e-56
297794721 1082 predicted protein [Arabidopsis lyrata su 0.485 0.368 0.369 2e-55
>gi|224074429|ref|XP_002304369.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222841801|gb|EEE79348.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  298 bits (764), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 210/478 (43%), Positives = 272/478 (56%), Gaps = 55/478 (11%)

Query: 1   MELIDRRMLKIQEDNNVVAEGAALEMIDC-LPGFLGTSRLGLAGVVNEEDQRIALGRITQ 59
           M+L++RRMLKIQEDN V+ EGA   ++D  L GF GT+ LGLA +V   + +  L +IT 
Sbjct: 305 MQLLNRRMLKIQEDNIVILEGATQSIVDNRLGGFSGTANLGLASLVPGGELK-GLDKITP 363

Query: 60  IDGMIKTICDPKKWDEVSTLLIDGDRLRLEVDEGFLARMKQLHALAIFNSGFKSLDLSSK 119
           +DGMIKT+C  KKW EV  LLI G RL  EV E    RM  L  LA+F+   K L  SS 
Sbjct: 364 MDGMIKTLCSGKKWKEVHALLIHGSRLLREVPEKLFQRMDGLEVLAVFDLKLKQLP-SSL 422

Query: 120 TEKKSEPEKLPMKLLVLRSCNLLNGIGDIELLKKLTVLEISGANSVQKIPDKLLDEMTKL 179
           ++ K       + +LVLR C+LL+ I  I  LKKLTVLEISGA+S+ KI D    ++T+L
Sbjct: 423 SQLKY------LHVLVLRGCDLLDNIDHISKLKKLTVLEISGASSLTKISDDFFAQLTQL 476

Query: 180 QSLNLSGCQMKFLPS-LSKLFNLRFLILRDCSSLQKLPRINELVRLEIIDLSGATSLTFF 238
           QSLNLSG Q++ LPS +SKL  LR+LILR C  L+ LP+I+EL +LE+ DLS AT     
Sbjct: 477 QSLNLSGSQLQELPSTISKLIELRWLILRRCKRLESLPKIHELSKLEVFDLSDATLFNNV 536

Query: 239 PEQDLSKHQHLQMIDLSRTQIKRLPKFGYLKRLSRISIEGCKRFHNFHEIKPRDSNTKSK 298
            E+  +  + L++IDLS TQI RLP    LK L+RI + GC          P+  N    
Sbjct: 537 QEKSFTIFKKLKIIDLSNTQIVRLPFISDLKDLTRILLRGCTSLSRL----PKLENL--- 589

Query: 299 PLFPV---------------------------------SLSELHLRDCPTLKRLPHIAGL 325
           PL  +                                 +LSEL+L  C  LK LP    L
Sbjct: 590 PLLQILDLSDAVQLKEINALKFLDQSGITSNHSASCIGNLSELYLMGCHKLKELPCTENL 649

Query: 326 KNLEVLDVSGTSDSKFAISDESFHDLDYLRELNLSNTKLKSLPPLSNLHRLRKLFLKNCE 385
             L VLD+S  S  +  I D+SF+ L  L  +NLS TK++SLP LS+LH L  L L+ C 
Sbjct: 650 TGLRVLDLSDASSLERFI-DKSFNHLSLLHSINLSKTKVRSLPSLSDLHNLCFLLLRGCL 708

Query: 386 LLEELPKMNGLENLEVLDLSGCSKLVEFPKLKDFPKLELLDISNTGIKVVPSDISVTS 443
            LE+L  + GL  L+ LDLSGC  L     L    KLE+LD+S  G   +P +I V S
Sbjct: 709 CLEQL-DVGGLTRLKELDLSGCENLYGLQGLNALQKLEVLDLS--GCVALP-EIQVQS 762

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449469418|ref|XP_004152417.1| PREDICTED: putative disease resistance protein At4g19050-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|145334747|ref|NP_001078719.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|332007880|gb|AED95263.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|222423297|dbj|BAH19624.1| AT5G45510 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18086486|gb|AAL57696.1| AT5g45510/MFC19_18 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|22327597|ref|NP_199364.2| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|334302785|sp|Q8VZC7.2|DRL36_ARATH RecName: Full=Probable disease resistance protein At5g45510 gi|332007879|gb|AED95262.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9758741|dbj|BAB09179.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|2832633|emb|CAA16762.1| putative protein [Arabidopsis thaliana] gi|7268700|emb|CAB78907.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|240256006|ref|NP_193640.4| NB-ARC domain-containing disease resistance protein [Arabidopsis thaliana] gi|334302784|sp|P0CB16.2|DRL25_ARATH RecName: Full=Putative disease resistance protein At4g19050 gi|332658734|gb|AEE84134.1| NB-ARC domain-containing disease resistance protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297794721|ref|XP_002865245.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297311080|gb|EFH41504.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query821
TAIR|locus:21635881222 AT5G45510 [Arabidopsis thalian 0.573 0.385 0.352 2.1e-75
TAIR|locus:21171491201 AT4G19050 [Arabidopsis thalian 0.505 0.345 0.368 1.6e-74
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.388 0.161 0.302 1.7e-22
TAIR|locus:21759911294 AT5G17680 [Arabidopsis thalian 0.347 0.220 0.308 5.4e-20
TAIR|locus:21292361301 SNC1 "SUPPRESSOR OF NPR1-1, CO 0.350 0.221 0.295 1e-18
TAIR|locus:20534051215 AT2G14080 [Arabidopsis thalian 0.334 0.226 0.311 6.5e-18
TAIR|locus:21479921189 AT5G11250 [Arabidopsis thalian 0.332 0.229 0.302 3.9e-16
TAIR|locus:20981451240 AT3G44630 [Arabidopsis thalian 0.341 0.225 0.307 7.7e-16
TAIR|locus:2827629 1355 AT2G17050 [Arabidopsis thalian 0.316 0.191 0.318 1.5e-15
TAIR|locus:2174900968 AT5G40060 [Arabidopsis thalian 0.484 0.411 0.259 2.3e-15
TAIR|locus:2163588 AT5G45510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 614 (221.2 bits), Expect = 2.1e-75, Sum P(2) = 2.1e-75
 Identities = 180/511 (35%), Positives = 276/511 (54%)

Query:     1 MELIDRRMLKIQEDNNVVAEGAALEMIDCLPG-FLGTSRLGLAGVVNEEDQRIALGRITQ 59
             MELIDR MLKIQE+N VV E A   +ID   G  LG SRLG + V    ++R  +G+ITQ
Sbjct:   532 MELIDRGMLKIQENNVVVPEMAMRNVIDPRRGGHLGKSRLGFSRVYGG-NKRKGIGKITQ 590

Query:    60 IDGMIKTICDPKKWDEVSTLLIDGDRLRLEVDEGFLARMKQLHALAIFNSGFKSLDLXXX 119
             +D MIKT+   KK D+++T+L+ GDRLR    + F   +K+L  L +F    K       
Sbjct:   591 LDDMIKTV-QAKKGDKITTILVSGDRLRRVTPKKFFKNLKELEVLGLFEPTVKPF----- 644

Query:   120 XXXXXXXXXLPMKLLVLRSCNLLNGIGDIELLKKLTVLEISGANSVQKIPDKLLDEMTKL 179
                      L +++L++R C+LL  I +++ L KL  LE+SGA+S+ KI +K  +   +L
Sbjct:   645 VPSFSDQLKL-LRVLIIRDCDLLKSIEELKALTKLNTLEVSGASSLSKISEKFFESFPEL 703

Query:   180 QSLNLSGCQMKFLP-SLSKLFNLRFLILRDCSSLQKLPRINELVRLEIIDLSGATSL-TF 237
             +SL+LSG +++  P S+S L  L  LI++DC  LQ LP I ELV LE++D+SGA+ L T 
Sbjct:   704 RSLHLSGLKIESSPPSISGLKELHCLIIKDCPLLQDLPNIQELVNLEVVDVSGASGLRTC 763

Query:   238 FPEQDLSKHQHLQMIDLSRTQIKRLPKFGYLKRLSRISIEGCK--RFHNFHEIKPRDSNT 295
             F   D +K         ++++ K    F  L +L  +   G +  R   F     +DS  
Sbjct:   764 FDNADGAKK--------NKSKNKN---FYLLTKLQHLDFSGSQIERLPIF-----QDSAV 807

Query:   296 KSKPLFPVSLSELHLRDCPTLKRLPHIAGLKNLEVLDVSGTSDSKFAISDESFHDLDYLR 355
              +K L   SL+ L LR+C  L+RLP +  L  L++LD+SGT+ S   + +  F D   L+
Sbjct:   808 AAK-LH--SLTRLLLRNCSKLRRLPSLKPLSGLQILDLSGTT-SLVEMLEVCFEDKLELK 863

Query:   356 ELNLSNTKLKSLPP-LSNLHRLRKLFLKNCELLEELPKMNGLENLEVLDLSGCSKLVEFP 414
              LNLS T L  L   + +L  L +L L++C  L+ +P +  LENLEV+D+SG +KL +  
Sbjct:   864 TLNLSGTNLSELATTIEDLSSLNELLLRDCINLDAIPNIEKLENLEVIDVSGSAKLAKIE 923

Query:   415 -KLKDFPKLELLDISNTGIKV--VPSDISVTS-SNFT-PDEKHRQASGVFNLVGSLAKGK 469
                +    L ++D+S T ++   +P+D  +     FT  D K  +      +   + + +
Sbjct:   924 GSFEKMFYLRVVDLSGTQVETPELPADTKIHCLKRFTRADGKCFERDTWREIKEDIERDR 983

Query:   470 KPLILANDGQIFQSDTGIKADPSEIAATSSN 500
                  ++D  +   +   K  P EI    SN
Sbjct:   984 SENASSSDAVVISQEITEKK-PVEIREVESN 1013
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006952 "defense response" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2117149 AT4G19050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129236 SNC1 "SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098145 AT3G44630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827629 AT2G17050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174900 AT5G40060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query821
PLN032101153 PLN03210, PLN03210, Resistant to P 7e-17
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 3e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 85.3 bits (211), Expect = 7e-17
 Identities = 91/292 (31%), Positives = 133/292 (45%), Gaps = 52/292 (17%)

Query: 178 KLQSLNLSGCQMKFLPSLSKLFNLRFLILRDCSSLQKL-PRINELVRLEIIDLSGATSLT 236
           KL+ L      ++ +PS  +  NL  L ++  S L+KL   ++ L  L  IDL G+ +L 
Sbjct: 590 KLRLLRWDKYPLRCMPSNFRPENLVKLQMQG-SKLEKLWDGVHSLTGLRNIDLRGSKNLK 648

Query: 237 FFPEQDLSKHQHLQMIDLSR-TQIKRLP-KFGYLKRLSRISIEGCKRFHNFHEIKPRDSN 294
             P  DLS   +L+ + LS  + +  LP    YL +L  + +  C+      EI P   N
Sbjct: 649 EIP--DLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENL----EILPTGIN 702

Query: 295 TKSKPLFPVSLSELHLRDCPTLKRLPHIAGLKNLEVLDVSGTSDSKFAISDESFHDLDYL 354
            KS       L  L+L  C  LK  P I+   N+  LD+  T+  +F  S+    +LD L
Sbjct: 703 LKS-------LYRLNLSGCSRLKSFPDIS--TNISWLDLDETAIEEFP-SNLRLENLDEL 752

Query: 355 RELNLSNTKL-----------KSLPP-------------------LSNLHRLRKLFLKNC 384
               + + KL             L P                   + NLH+L  L ++NC
Sbjct: 753 ILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENC 812

Query: 385 ELLEELPKMNGLENLEVLDLSGCSKLVEFPKLKDFPKLELLDISNTGIKVVP 436
             LE LP    LE+LE LDLSGCS+L  FP +     +  L++S TGI+ VP
Sbjct: 813 INLETLPTGINLESLESLDLSGCSRLRTFPDIST--NISDLNLSRTGIEEVP 862

syringae 6; Provisional. Length = 1153
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 821
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.93
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
PLN032101153 Resistant to P. syringae 6; Provisional 99.9
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.89
PLN032101153 Resistant to P. syringae 6; Provisional 99.89
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.83
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.63
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.62
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.59
KOG4237498 consensus Extracellular matrix protein slit, conta 99.58
KOG4237498 consensus Extracellular matrix protein slit, conta 99.56
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.54
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.53
KOG0617264 consensus Ras suppressor protein (contains leucine 99.5
KOG0617264 consensus Ras suppressor protein (contains leucine 99.47
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.33
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.23
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.22
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.91
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.88
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.82
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.82
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.81
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.77
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.73
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.67
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.66
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.61
PRK15386 426 type III secretion protein GogB; Provisional 98.58
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.57
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.38
KOG4341483 consensus F-box protein containing LRR [General fu 98.35
KOG4341483 consensus F-box protein containing LRR [General fu 98.32
PRK15386 426 type III secretion protein GogB; Provisional 98.32
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.32
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.29
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.28
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.26
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.2
PLN03150623 hypothetical protein; Provisional 98.18
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.18
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.15
PLN03150623 hypothetical protein; Provisional 98.01
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.82
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.81
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.63
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.62
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.51
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.49
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.47
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.45
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.25
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.18
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.03
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.0
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.86
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.32
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.23
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.03
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.01
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.97
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.81
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.65
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.4
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.89
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.01
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.92
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.56
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.47
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.2
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 80.29
smart0037026 LRR Leucine-rich repeats, outliers. 80.29
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=5.4e-38  Score=383.51  Aligned_cols=367  Identities=20%  Similarity=0.267  Sum_probs=296.0

Q ss_pred             CceeEEEecCCCccccccHHHHhcCcCCcEEEeecCCC-Cccccccc-ccccCCCCCCCccEEEcCCCCCCCCcccccCC
Q 003420           74 DEVSTLLIDGDRLRLEVDEGFLARMKQLHALAIFNSGF-KSLDLSSK-TEKKSEPEKLPMKLLVLRSCNLLNGIGDIELL  151 (821)
Q Consensus        74 ~~l~~L~l~~n~~~~~~~~~~~~~l~~L~~L~l~~~~~-~~l~~~~~-~l~~~~~~~~~L~~L~l~~~~~~~~~~~i~~l  151 (821)
                      .+++.|++++|.+.+.++. .|..+++|++|++++|.+ +.+|..+. .+.+       |++|++++|++.+..+. +.+
T Consensus        69 ~~v~~L~L~~~~i~~~~~~-~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~-------L~~L~Ls~n~l~~~~p~-~~l  139 (968)
T PLN00113         69 SRVVSIDLSGKNISGKISS-AIFRLPYIQTINLSNNQLSGPIPDDIFTTSSS-------LRYLNLSNNNFTGSIPR-GSI  139 (968)
T ss_pred             CcEEEEEecCCCccccCCh-HHhCCCCCCEEECCCCccCCcCChHHhccCCC-------CCEEECcCCccccccCc-ccc
Confidence            4799999999998876654 578899999999999998 47887665 7777       99999999988765443 568


Q ss_pred             CCccEEeccCCcCCCcCchHhhhCCCCccEEEecCCCCC-cCcC-cCCCCcccEEEccCCCCCCCCcc-cccCCcccEEe
Q 003420          152 KKLTVLEISGANSVQKIPDKLLDEMTKLQSLNLSGCQMK-FLPS-LSKLFNLRFLILRDCSSLQKLPR-INELVRLEIID  228 (821)
Q Consensus       152 ~~L~~L~l~~~~~~~~lp~~~~~~l~~L~~L~l~~~~i~-~lp~-l~~l~~L~~L~l~~~~~~~~l~~-l~~l~~L~~L~  228 (821)
                      ++|++|++++|...+.+|..+ +++++|++|++++|.+. .+|. ++++++|++|++++|.+.+.+|. +.++++|+.|+
T Consensus       140 ~~L~~L~Ls~n~~~~~~p~~~-~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~  218 (968)
T PLN00113        140 PNLETLDLSNNMLSGEIPNDI-GSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIY  218 (968)
T ss_pred             CCCCEEECcCCcccccCChHH-hcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEE
Confidence            999999999977767788775 89999999999999876 4777 99999999999999988888887 89999999999


Q ss_pred             ecCCCCCCccChhhccCCCCCCEeeccCcCCcC-CCC-cCCCCCCceEeecCccccccccccccCCCCCCCCCCCCCCCc
Q 003420          229 LSGATSLTFFPEQDLSKHQHLQMIDLSRTQIKR-LPK-FGYLKRLSRISIEGCKRFHNFHEIKPRDSNTKSKPLFPVSLS  306 (821)
Q Consensus       229 l~~~~~~~~~~~~~l~~l~~L~~L~l~~~~l~~-l~~-~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~~~~~L~  306 (821)
                      +++|...+.+| ..++++++|++|++++|.+.+ +|. ++.+++|+.|++++|.....++          ..+..+++|+
T Consensus       219 L~~n~l~~~~p-~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p----------~~l~~l~~L~  287 (968)
T PLN00113        219 LGYNNLSGEIP-YEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIP----------PSIFSLQKLI  287 (968)
T ss_pred             CcCCccCCcCC-hhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCc----------hhHhhccCcC
Confidence            99988555666 678999999999999998875 554 8888999999998876433332          1255678899


Q ss_pred             EEEecCCCCCCCCC-CCCCCCCcCEEEecCCCCCCcccChhhhcCCCCCcEEEecCCCCC-CCCC-ccccccccEEEeec
Q 003420          307 ELHLRDCPTLKRLP-HIAGLKNLEVLDVSGTSDSKFAISDESFHDLDYLRELNLSNTKLK-SLPP-LSNLHRLRKLFLKN  383 (821)
Q Consensus       307 ~L~l~~~~~~~~~~-~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~l~-~l~~-~~~l~~L~~L~l~~  383 (821)
                      +|++++|.....+| .+..+++|+.|++++|....  ..+..+..+++|+.|++++|.+. .+|. ++.+++|+.|++++
T Consensus       288 ~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~--~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~  365 (968)
T PLN00113        288 SLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTG--KIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLST  365 (968)
T ss_pred             EEECcCCeeccCCChhHcCCCCCcEEECCCCccCC--cCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCC
Confidence            99999887776776 57788899999999888654  67778888899999999999887 5666 88889999999999


Q ss_pred             CCCcCcCCC-CCCCCCcCEEeccCCCCCCcCCC-CCCCCCCCEEEeeCCCCCccCCCccccCCCCCchhhhhcccceeee
Q 003420          384 CELLEELPK-MNGLENLEVLDLSGCSKLVEFPK-LKDFPKLELLDISNTGIKVVPSDISVTSSNFTPDEKHRQASGVFNL  461 (821)
Q Consensus       384 ~~~~~~l~~-~~~l~~L~~L~l~~c~~l~~i~~-l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~l~l  461 (821)
                      |++.+.+|. +..+++|+.|++++|...+.+|. +..+++|+.|++++|.++.  ..+.        .+..++.++.+++
T Consensus       366 n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~--~~p~--------~~~~l~~L~~L~L  435 (968)
T PLN00113        366 NNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSG--ELPS--------EFTKLPLVYFLDI  435 (968)
T ss_pred             CeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeee--ECCh--------hHhcCCCCCEEEC
Confidence            987777765 66788899999998887777777 8888999999999988842  1121        2334567778888


Q ss_pred             cccccCCCCccc
Q 003420          462 VGSLAKGKKPLI  473 (821)
Q Consensus       462 ~~n~~~~~~p~~  473 (821)
                      ++|.+.+..|..
T Consensus       436 s~N~l~~~~~~~  447 (968)
T PLN00113        436 SNNNLQGRINSR  447 (968)
T ss_pred             cCCcccCccChh
Confidence            888888776644

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query821
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 1e-07
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-05
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 4e-06
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 1e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 2e-05
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 2e-05
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 3e-05
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 3e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 4e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 4e-05
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 86/174 (49%), Gaps = 12/174 (6%)
Query: 249 LQMIDLSRTQIKRLP-KFGYLKRLSRISIEGCKRFHNFHE-IKPRDSNTKSKPLFPVSLS 306
           L+ + L+R  ++ LP     L RL  +SI  C       E +   D++ + + L  V+L 
Sbjct: 129 LETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGL--VNLQ 186
Query: 307 ELHLRDCPTLKRLP-HIAGLKNLEVLDVSGTSDSKFAISDESFHDLDYLRELNLSN-TKL 364
            L L +   ++ LP  IA L+NL+ L +    +S  +    + H L  L EL+L   T L
Sbjct: 187 SLRL-EWTGIRSLPASIANLQNLKSLKIR---NSPLSALGPAIHHLPKLEELDLRGCTAL 242
Query: 365 KSLPPL-SNLHRLRKLFLKNCELLEELP-KMNGLENLEVLDLSGCSKLVEFPKL 416
           ++ PP+      L++L LK+C  L  LP  ++ L  LE LDL GC  L   P L
Sbjct: 243 RNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSL 296
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query821
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-31
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-29
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-27
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-27
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-25
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-26
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-26
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-23
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-24
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-25
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-24
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-24
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-23
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-22
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-22
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-22
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-21
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-19
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-17
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-15
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-13
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-11
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 4e-08
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  138 bits (349), Expect = 5e-36
 Identities = 75/342 (21%), Positives = 129/342 (37%), Gaps = 42/342 (12%)

Query: 98  MKQLHALAIFNSGFKSLDLSSKTEKKSEPEKLP-MKLLVLRSCNLLNGIGDIELLKKLTV 156
           M   H     +SG ++L     T  +   + L   +       N  +            +
Sbjct: 1   MGSSHHHHHHSSGRENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQANSNNPQI 60

Query: 157 LEISGANSVQKIPDKLLD-EMTKLQSLNLSGCQMKFLP-SLSKLFNLRFLILRDCSSLQK 214
              +G  +++   D L D       +L L    +   P    +L +L+ + +     L +
Sbjct: 61  ETRTG-RALKATADLLEDATQPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAG-LME 118

Query: 215 LPRINELVRLEIIDLSGATSLTFFPEQDLSKHQHLQMIDLSRTQIKRLPK-FGYLKRLSR 273
           LP  + + +                         L+ + L+R  ++ LP     L RL  
Sbjct: 119 LP--DTMQQF----------------------AGLETLTLARNPLRALPASIASLNRLRE 154

Query: 274 ISIEGCKRFHNF-HEIKPRDSNTKSKPLFPVSLSELHLRDCPTLKRLPH-IAGLKNLEVL 331
           +SI  C         +   D++ + + L  V+L  L L     ++ LP  IA L+NL+ L
Sbjct: 155 LSIRACPELTELPEPLASTDASGEHQGL--VNLQSLRLEWTG-IRSLPASIANLQNLKSL 211

Query: 332 DVSGTSDSKFAISDESFHDLDYLRELNLS-NTKLKSLPP-LSNLHRLRKLFLKNCELLEE 389
            +  +  S       + H L  L EL+L   T L++ PP       L++L LK+C  L  
Sbjct: 212 KIRNSPLSALG---PAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLT 268

Query: 390 LPK-MNGLENLEVLDLSGCSKLVEFPK-LKDFPKLELLDISN 429
           LP  ++ L  LE LDL GC  L   P  +   P   ++ +  
Sbjct: 269 LPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPANCIILVPP 310
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query821
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.98
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.89
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.88
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.86
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.86
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.84
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.84
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.84
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.84
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.83
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.82
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.81
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.8
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.8
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.79
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.77
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.76
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.76
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.76
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.76
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.76
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.75
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.75
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.74
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.74
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.73
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.73
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.73
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.72
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.71
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.68
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.67
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.67
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.67
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.65
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.65
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.63
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.63
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.62
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.6
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.57
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.57
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.56
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.55
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.55
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.55
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.54
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.54
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.54
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.54
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.54
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.54
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.53
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.53
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.51
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.51
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.44
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.44
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.44
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.43
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.38
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.38
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.32
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.32
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.29
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.26
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.26
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.26
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.25
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.25
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.22
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.22
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.2
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.2
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.18
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.17
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.16
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.16
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.15
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.09
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.02
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.85
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.84
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.83
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.82
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.59
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.57
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.5
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.46
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.43
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.25
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.96
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.76
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.73
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.68
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.56
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.38
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.24
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.31
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.67
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.93
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 92.84
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2e-42  Score=410.33  Aligned_cols=613  Identities=17%  Similarity=0.124  Sum_probs=420.5

Q ss_pred             CceeEEEecCCCcccc---ccHHHHhcCcCCcEEEeecCCCCcccccccccccCCCCCCCccEEEcCCCCCCCCc-c--c
Q 003420           74 DEVSTLLIDGDRLRLE---VDEGFLARMKQLHALAIFNSGFKSLDLSSKTEKKSEPEKLPMKLLVLRSCNLLNGI-G--D  147 (821)
Q Consensus        74 ~~l~~L~l~~n~~~~~---~~~~~~~~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~-~--~  147 (821)
                      ..|+.|+++++.+.|.   ++. .+.++++|+.++++.+++..+|..++.+++       |++|++++|.+.+.+ .  .
T Consensus        50 ~~v~~L~L~~~~l~g~~~~l~~-~l~~L~~L~~l~~~~~~~~~l~~~~~~l~~-------L~~L~Ls~n~l~~~~~~~~~  121 (768)
T 3rgz_A           50 DKVTSIDLSSKPLNVGFSAVSS-SLLSLTGLESLFLSNSHINGSVSGFKCSAS-------LTSLDLSRNSLSGPVTTLTS  121 (768)
T ss_dssp             TEEEEEECTTSCCCEEHHHHHH-HTTTCTTCCEEECTTSCEEECCCCCCCCTT-------CCEEECCSSEEEEEGGGGGG
T ss_pred             CcEEEEECCCCCcCCccCccCh-hHhccCcccccCCcCCCcCCCchhhccCCC-------CCEEECCCCcCCCcCCChHH
Confidence            4788899998888776   554 467788888888888887667788888888       999999988887644 3  6


Q ss_pred             ccCCCCccEEeccCCcCCCcCchHhhhCCCCccEEEecCCCCCcCcC-----cCCCCcccEEEccCCCCCCCCcccccCC
Q 003420          148 IELLKKLTVLEISGANSVQKIPDKLLDEMTKLQSLNLSGCQMKFLPS-----LSKLFNLRFLILRDCSSLQKLPRINELV  222 (821)
Q Consensus       148 i~~l~~L~~L~l~~~~~~~~lp~~~~~~l~~L~~L~l~~~~i~~lp~-----l~~l~~L~~L~l~~~~~~~~l~~l~~l~  222 (821)
                      ++++++|++|++++|...+.+|..++.++++|++|++++|.++..+.     +..+++|++|++++|.+.+..+ +..++
T Consensus       122 l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~-~~~l~  200 (768)
T 3rgz_A          122 LGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD-VSRCV  200 (768)
T ss_dssp             GGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB-CTTCT
T ss_pred             HhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCC-cccCC
Confidence            88888999999988776667776655788899999999988876432     5788889999998887665444 37888


Q ss_pred             cccEEeecCCCCCCccChhhccCCCCCCEeeccCcCCcC-CCC-cCCCCCCceEeecCccccccccccccCCCCCCCCCC
Q 003420          223 RLEIIDLSGATSLTFFPEQDLSKHQHLQMIDLSRTQIKR-LPK-FGYLKRLSRISIEGCKRFHNFHEIKPRDSNTKSKPL  300 (821)
Q Consensus       223 ~L~~L~l~~~~~~~~~~~~~l~~l~~L~~L~l~~~~l~~-l~~-~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~  300 (821)
                      +|++|++++|...+.++ . ++++++|++|++++|.+++ +|. +..+++|++|++++|......+            ..
T Consensus       201 ~L~~L~Ls~n~l~~~~~-~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~------------~~  266 (768)
T 3rgz_A          201 NLEFLDVSSNNFSTGIP-F-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIP------------PL  266 (768)
T ss_dssp             TCCEEECCSSCCCSCCC-B-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCC------------CC
T ss_pred             cCCEEECcCCcCCCCCc-c-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccC------------cc
Confidence            88999998887444454 3 8888899999999888885 343 7888888888888876443332            12


Q ss_pred             CCCCCcEEEecCCCCCCCCC-CCCC-CCCcCEEEecCCCCCCcccChhhhcCCCCCcEEEecCCCCC-CCCC--cccccc
Q 003420          301 FPVSLSELHLRDCPTLKRLP-HIAG-LKNLEVLDVSGTSDSKFAISDESFHDLDYLRELNLSNTKLK-SLPP--LSNLHR  375 (821)
Q Consensus       301 ~~~~L~~L~l~~~~~~~~~~-~l~~-~~~L~~L~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~l~-~l~~--~~~l~~  375 (821)
                      .+++|++|++.+|...+.+| .+.. +++|+.|++++|....  ..+..+..+++|+.|++++|.+. .+|.  +..+++
T Consensus       267 ~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~--~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~  344 (768)
T 3rgz_A          267 PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYG--AVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRG  344 (768)
T ss_dssp             CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEE--CCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTT
T ss_pred             ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCC--ccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCC
Confidence            56788888888887665666 4444 4888888888887544  67778888888888888888877 6675  778888


Q ss_pred             ccEEEeecCCCcCcCCC-CCCCC-CcCEEeccCCCCCCcCCC-CCC--CCCCCEEEeeCCCCCccCCCccccCCCCCchh
Q 003420          376 LRKLFLKNCELLEELPK-MNGLE-NLEVLDLSGCSKLVEFPK-LKD--FPKLELLDISNTGIKVVPSDISVTSSNFTPDE  450 (821)
Q Consensus       376 L~~L~l~~~~~~~~l~~-~~~l~-~L~~L~l~~c~~l~~i~~-l~~--l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~l  450 (821)
                      |++|++++|.+.+.+|. +..++ +|++|++++|...+.++. +..  +++|++|++++|.++.  ..+.        .+
T Consensus       345 L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~--~~p~--------~l  414 (768)
T 3rgz_A          345 LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG--KIPP--------TL  414 (768)
T ss_dssp             CCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEE--ECCG--------GG
T ss_pred             CCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCcccc--ccCH--------HH
Confidence            88888888887666665 55555 888888888876666666 444  7788888888888741  1121        33


Q ss_pred             hhhcccceeeecccccCCCCccccccCcceeeccCccccCCCcccccccceeccCCcccccCCCCcch---hcccCCCCC
Q 003420          451 KHRQASGVFNLVGSLAKGKKPLILANDGQIFQSDTGIKADPSEIAATSSNVVPDKKHRQAHGKKPSVL---VNDGGNSQS  527 (821)
Q Consensus       451 ~~~~~l~~l~l~~n~~~~~~p~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~p~~~---~~L~~L~ls  527 (821)
                      ..++.++.+++++|.+.+..|..+...                    ..++.+++++|.+.+.+|..+   ++|+.|+++
T Consensus       415 ~~l~~L~~L~Ls~N~l~~~~p~~l~~l--------------------~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~  474 (768)
T 3rgz_A          415 SNCSELVSLHLSFNYLSGTIPSSLGSL--------------------SKLRDLKLWLNMLEGEIPQELMYVKTLETLILD  474 (768)
T ss_dssp             GGCTTCCEEECCSSEEESCCCGGGGGC--------------------TTCCEEECCSSCCCSCCCGGGGGCTTCCEEECC
T ss_pred             hcCCCCCEEECcCCcccCcccHHHhcC--------------------CCCCEEECCCCcccCcCCHHHcCCCCceEEEec
Confidence            445677888888888888777654443                    234556667777777777654   347777777


Q ss_pred             CCCCc-cCCcccCCCCchhHHHHhhhccCCCCCCcccccccCCCceecCChhhhhhhccChhHHHhhhccccccCCCCcc
Q 003420          528 NDGME-ADPSKISAPKSANEVTDKRRGQANGVFTPAESQAKGKPSILTNDGEIVQSLEKNPELKEVRKLEISIPLSPSNE  606 (821)
Q Consensus       528 ~~~~~-~~~~~l~~l~~L~~l~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~l~~~~l~i~~~~~~~  606 (821)
                      +|.+. .+|.++.++++|+.++.....                                                  -. 
T Consensus       475 ~N~l~~~~p~~l~~l~~L~~L~L~~N~--------------------------------------------------l~-  503 (768)
T 3rgz_A          475 FNDLTGEIPSGLSNCTNLNWISLSNNR--------------------------------------------------LT-  503 (768)
T ss_dssp             SSCCCSCCCGGGGGCTTCCEEECCSSC--------------------------------------------------CC-
T ss_pred             CCcccCcCCHHHhcCCCCCEEEccCCc--------------------------------------------------cC-
Confidence            77776 456666665555533221110                                                  00 


Q ss_pred             ccccCccchhhhHHhhhcccccEEEEcCCCCchhhh--HHhhcCCcEEEEecCCCCcccchhchhhhcCCceE-------
Q 003420          607 QATEGVMFSDLYRWAERKAAAKFLEIRGLKSICDGL--KEILNNTEYISWVEPKPMKSLSDLDAGSLVKMEGL-------  677 (821)
Q Consensus       607 ~~~~~~~~~~~~~~~~~~~~L~~L~i~~~~~~~~~~--~~~~~~L~~L~i~~c~~l~~l~~~~~~~l~~L~~L-------  677 (821)
                              ...+..+..+++|++|+++++......+  ...+++|+.|.+.+|.-...+|..... ...+..+       
T Consensus       504 --------~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~-~~~~~~~~~~~~~~  574 (768)
T 3rgz_A          504 --------GEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFK-QSGKIAANFIAGKR  574 (768)
T ss_dssp             --------SCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGT-TTTCBCCSTTCSCE
T ss_pred             --------CcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhc-ccchhhhhcccccc
Confidence                    0001122356778888888876543332  355688999999888765566654332 2222211       


Q ss_pred             --EEecccC--------------------ceec------------cc--ccchhhhhcCcceeecccccccccccccccc
Q 003420          678 --WIARCIE--------------------MESI------------FG--EEKDIELARNLKILWVSNLPKVESLFNHKLQ  721 (821)
Q Consensus       678 --~i~~C~~--------------------l~~l------------~~--~~~~~~~~~~L~~L~i~~c~~L~~l~~~~~~  721 (821)
                        ++.+...                    +..+            +.  .+..++.+++|+.|+++++.--..+|.    
T Consensus       575 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~----  650 (768)
T 3rgz_A          575 YVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPK----  650 (768)
T ss_dssp             EEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCG----
T ss_pred             ccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCH----
Confidence              1111000                    0000            00  011234578899999988754446776    


Q ss_pred             ccccCCCCceEEecCCCCCcccccC-CCcccccccEEEEeccccccccccccccccccccCCcccEEecccccccccccc
Q 003420          722 SVKNLENLKHLHLDCCPRLKCVFAS-PDQIPKRLEVLEIKFCDSLETVYKHSGDEQDECALSTLKKLFLFKLPALTSLGF  800 (821)
Q Consensus       722 ~l~~~~sL~~L~i~~C~~L~~~~p~-~~~l~~~L~~L~i~~C~~L~~i~~~~~~~~~~~~l~~L~~L~l~~cp~L~~l~~  800 (821)
                      .+..+++|+.|.++++ ++...+|. -..+ ++|++|+++++.--..+|      .....+++|+.|++++++--..+|.
T Consensus       651 ~l~~l~~L~~L~Ls~N-~l~g~ip~~l~~L-~~L~~LdLs~N~l~g~ip------~~l~~l~~L~~L~ls~N~l~g~iP~  722 (768)
T 3rgz_A          651 EIGSMPYLFILNLGHN-DISGSIPDEVGDL-RGLNILDLSSNKLDGRIP------QAMSALTMLTEIDLSNNNLSGPIPE  722 (768)
T ss_dssp             GGGGCTTCCEEECCSS-CCCSCCCGGGGGC-TTCCEEECCSSCCEECCC------GGGGGCCCCSEEECCSSEEEEECCS
T ss_pred             HHhccccCCEEeCcCC-ccCCCCChHHhCC-CCCCEEECCCCcccCcCC------hHHhCCCCCCEEECcCCcccccCCC
Confidence            6788999999999877 45544553 3567 889999998876555666      3444589999999999876667777


Q ss_pred             C--CCCcc--cccCCCC
Q 003420          801 K--IPDAQ--IIKGCPK  813 (821)
Q Consensus       801 ~--~~~L~--~i~~Cp~  813 (821)
                      +  +..+.  .+.++|.
T Consensus       723 ~~~~~~~~~~~~~gN~~  739 (768)
T 3rgz_A          723 MGQFETFPPAKFLNNPG  739 (768)
T ss_dssp             SSSGGGSCGGGGCSCTE
T ss_pred             chhhccCCHHHhcCCch
Confidence            3  44443  3445443
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 821
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-11
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-10
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-08
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 4e-07
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 5e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 8e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 2e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 78.5 bits (192), Expect = 4e-16
 Identities = 33/184 (17%), Positives = 73/184 (39%), Gaps = 19/184 (10%)

Query: 246 HQHLQMIDLSRTQIKRLPKFGYLKRLSRISIEGCKRFHNFHEIKPRDSNTKSKPLFPVSL 305
             +L  + L+  Q+K +     L  L+ + +           + P    T         L
Sbjct: 218 LTNLDELSLNGNQLKDIGTLASLTNLTDLDLANN----QISNLAPLSGLT--------KL 265

Query: 306 SELHLRDCPTLKRLPHIAGLKNLEVLDVSGTSDSKFAISDESFHDLDYLRELNLSNTKLK 365
           +EL L     +  +  +AGL  L  L+++       +       +L  L  L L    + 
Sbjct: 266 TELKL-GANQISNISPLAGLTALTNLELNENQLEDISP----ISNLKNLTYLTLYFNNIS 320

Query: 366 SLPPLSNLHRLRKLFLKNCELLEELPKMNGLENLEVLDLSGCSKLVEFPKLKDFPKLELL 425
            + P+S+L +L++LF  N ++  ++  +  L N+  L      ++ +   L +  ++  L
Sbjct: 321 DISPVSSLTKLQRLFFANNKV-SDVSSLANLTNINWLSAGHN-QISDLTPLANLTRITQL 378

Query: 426 DISN 429
            +++
Sbjct: 379 GLND 382
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query821
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.9
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.88
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.81
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.81
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.77
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.77
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.71
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.71
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.69
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.69
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.68
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.66
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.64
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.56
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.34
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.3
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.28
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.26
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.26
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.26
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.24
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.22
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.17
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.96
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.94
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.92
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.77
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.72
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.66
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.64
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.06
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.05
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.53
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.44
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.92
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.05
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.90  E-value=4.8e-22  Score=213.79  Aligned_cols=321  Identities=19%  Similarity=0.299  Sum_probs=166.5

Q ss_pred             CCCceeEEEecCCCccccccHHHHhcCcCCcEEEeecCCCCcccccccccccCCCCCCCccEEEcCCCCCCCCcccccCC
Q 003420           72 KWDEVSTLLIDGDRLRLEVDEGFLARMKQLHALAIFNSGFKSLDLSSKTEKKSEPEKLPMKLLVLRSCNLLNGIGDIELL  151 (821)
Q Consensus        72 ~~~~l~~L~l~~n~~~~~~~~~~~~~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~i~~l  151 (821)
                      .+.++++|+++++.+. .+.  .++.+++|++|++++|.++.++. ++++++       |++|++++|.+.+. +.++.+
T Consensus        42 ~l~~l~~L~l~~~~I~-~l~--gl~~L~nL~~L~Ls~N~l~~l~~-l~~L~~-------L~~L~L~~n~i~~i-~~l~~l  109 (384)
T d2omza2          42 DLDQVTTLQADRLGIK-SID--GVEYLNNLTQINFSNNQLTDITP-LKNLTK-------LVDILMNNNQIADI-TPLANL  109 (384)
T ss_dssp             HHTTCCEEECCSSCCC-CCT--TGGGCTTCCEEECCSSCCCCCGG-GTTCTT-------CCEEECCSSCCCCC-GGGTTC
T ss_pred             HhCCCCEEECCCCCCC-Ccc--ccccCCCCCEEeCcCCcCCCCcc-ccCCcc-------cccccccccccccc-cccccc
Confidence            3457777777777775 332  25667777777777777777764 666666       77777777776643 346777


Q ss_pred             CCccEEeccCCcCCCcCchHhhhCCCCccEEEecCCCCCcCcC---------------------cCCCCcccEEEccCCC
Q 003420          152 KKLTVLEISGANSVQKIPDKLLDEMTKLQSLNLSGCQMKFLPS---------------------LSKLFNLRFLILRDCS  210 (821)
Q Consensus       152 ~~L~~L~l~~~~~~~~lp~~~~~~l~~L~~L~l~~~~i~~lp~---------------------l~~l~~L~~L~l~~~~  210 (821)
                      ++|+.|+++++ ....++..  .....+..+....+.+..+..                     +...+.........+.
T Consensus       110 ~~L~~L~~~~~-~~~~~~~~--~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  186 (384)
T d2omza2         110 TNLTGLTLFNN-QITDIDPL--KNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNK  186 (384)
T ss_dssp             TTCCEEECCSS-CCCCCGGG--TTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSC
T ss_pred             ccccccccccc-cccccccc--cccccccccccccccccccccccccccccccccccccchhhhhccccccccccccccc
Confidence            77777777764 33444432  345556666655554433222                     1111111111111111


Q ss_pred             CCCCCcccccCCcccEEeecCCCCCCccChhhccCCCCCCEeeccCcCCcCCCCcCCCCCCceEeecCcccccccccccc
Q 003420          211 SLQKLPRINELVRLEIIDLSGATSLTFFPEQDLSKHQHLQMIDLSRTQIKRLPKFGYLKRLSRISIEGCKRFHNFHEIKP  290 (821)
Q Consensus       211 ~~~~l~~l~~l~~L~~L~l~~~~~~~~~~~~~l~~l~~L~~L~l~~~~l~~l~~~~~l~~L~~L~l~~~~~l~~~~~~~~  290 (821)
                       .........+++++.++++++. ++.++  .....++|++|++++|.++.++.+..+++|+.+++.++. +..++.   
T Consensus       187 -~~~~~~~~~l~~~~~l~l~~n~-i~~~~--~~~~~~~L~~L~l~~n~l~~~~~l~~l~~L~~L~l~~n~-l~~~~~---  258 (384)
T d2omza2         187 -VSDISVLAKLTNLESLIATNNQ-ISDIT--PLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQ-ISNLAP---  258 (384)
T ss_dssp             -CCCCGGGGGCTTCSEEECCSSC-CCCCG--GGGGCTTCCEEECCSSCCCCCGGGGGCTTCSEEECCSSC-CCCCGG---
T ss_pred             -cccccccccccccceeeccCCc-cCCCC--cccccCCCCEEECCCCCCCCcchhhcccccchhccccCc-cCCCCc---
Confidence             1111223455555566655544 33332  133445566666666665555555555555555555543 111111   


Q ss_pred             CCCCCCCCCCCCCCCcEEEecCCCCCCCCCCCCCCCCcCEEEecCCCCCCcccChhhhcCCCCCcEEEecCCCCCCCCCc
Q 003420          291 RDSNTKSKPLFPVSLSELHLRDCPTLKRLPHIAGLKNLEVLDVSGTSDSKFAISDESFHDLDYLRELNLSNTKLKSLPPL  370 (821)
Q Consensus       291 ~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~l~~l~~~  370 (821)
                              +..+++|++++++++.. ..++.+..++.++.+.+..+....    ...+..+++++.|++++|.+++++.+
T Consensus       259 --------~~~~~~L~~L~l~~~~l-~~~~~~~~~~~l~~l~~~~n~l~~----~~~~~~~~~l~~L~ls~n~l~~l~~l  325 (384)
T d2omza2         259 --------LSGLTKLTELKLGANQI-SNISPLAGLTALTNLELNENQLED----ISPISNLKNLTYLTLYFNNISDISPV  325 (384)
T ss_dssp             --------GTTCTTCSEEECCSSCC-CCCGGGTTCTTCSEEECCSSCCSC----CGGGGGCTTCSEEECCSSCCSCCGGG
T ss_pred             --------ccccccCCEeeccCccc-CCCCcccccccccccccccccccc----ccccchhcccCeEECCCCCCCCCccc
Confidence                    23344555555555432 233344455555555555554322    12244455555555555555555445


Q ss_pred             cccccccEEEeecCCCcCcCCCCCCCCCcCEEeccCCCCCCcCCCCCCCCCCCEEEeeCC
Q 003420          371 SNLHRLRKLFLKNCELLEELPKMNGLENLEVLDLSGCSKLVEFPKLKDFPKLELLDISNT  430 (821)
Q Consensus       371 ~~l~~L~~L~l~~~~~~~~l~~~~~l~~L~~L~l~~c~~l~~i~~l~~l~~L~~L~l~~~  430 (821)
                      ..+++|++|++++|+ ++.++.+..+++|++|++++|+ +..++.+.++++|+.|++++|
T Consensus       326 ~~l~~L~~L~L~~n~-l~~l~~l~~l~~L~~L~l~~N~-l~~l~~l~~l~~L~~L~L~~N  383 (384)
T d2omza2         326 SSLTKLQRLFFANNK-VSDVSSLANLTNINWLSAGHNQ-ISDLTPLANLTRITQLGLNDQ  383 (384)
T ss_dssp             GGCTTCCEEECCSSC-CCCCGGGGGCTTCCEEECCSSC-CCBCGGGTTCTTCSEEECCCE
T ss_pred             ccCCCCCEEECCCCC-CCCChhHcCCCCCCEEECCCCc-CCCChhhccCCCCCEeeCCCC
Confidence            555555555555554 2334445555555555555543 333333555555555555544
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure