Citrus Sinensis ID: 003451

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------82
MAQNLSLPLLLPTPPPAKPLFLTQTNHHNLPPPSPPQQQTTPSASPTTISPLLQDLYNNNSSSQPIHQPRSRTRLGKSRDSNRGKPWSHHRLSAKGQQVLQSLIDDSFDVKDIDSVLSQLLDQNPGEKSEDLGADLLGIVKGLGFHKKTDLALDVFEWFRSCCSKDGNLVLRGSVIAVLISMLGKEGKVSVAASLLHGLHKDGFDIDVYAYTSLITTYASNGRYREAVMVFKKMEEEGCKPTLITYNVILNVYGKMGMPWNKIMALVEGMKSAGVKPDSYTFNTLISCCRRGSLHEEAAGVFEEMKLAGFSPDKVTYNALLDVYGKCRRPKEAMQVLREMKINGCLPSIVTYNSLISAYARDGLLEEAMELKTQMVEIGITPDVFTYTTLLSGFEKAGKDESAMKVFEEMRSAGCKPNICTFNALIKMHGNRGNFVEMMKVFDEINKCNCKPDIVTWNTLLAVFGQNGMDSEVSGVFKEMKRAGFIPERDTFNTLISAYSRCGSFDQAMSIYKRMLEAGVTPDLSTYNAVLAALARGGMWEQSEKIFAEMKGGRCKPNELTYSSLLHAYANGREIDQMLALSEEIYSGIIEPHAVLLKTLILVYSKSDLLMDTERAFLELKKKGFSPDIPTLNAMISIYGRRQMVAKTNEILHFMNDSGFTPSLTTYNTLMYMYSRSENFARAEDVLREILAKGIKPDIISYNTVIFAYCRNGRMKEASRIFSEMRDSGLVPDVITYNTFVASYAADSLFVEALDVVRYMIKQGCKPNQNTYNSIVDGYCKLNQRYEAITFVNNLSKLDPHVTKELECKLSDRIAKKWT
cccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccc
cccHcccccccccccccccccccccccccccccccHHHcccccccHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccc
maqnlslplllptpppakplfltqtnhhnlpppsppqqqttpsaspttispllqdlynnnsssqpihqprsrtrlgksrdsnrgkpwshhrlsakGQQVLQSLIddsfdvkdIDSVLSQLldqnpgeksedLGADLLGIVKglgfhkktdLALDVFEWFRSccskdgnlvlRGSVIAVLISMLGKEGKVSVAASLLHglhkdgfdiDVYAYTSLITTYASNGRYREAVMVFKKMeeegckptlITYNVILNVYGKMGMPWNKIMALVEGMksagvkpdsytfntlisccrrgslheeaAGVFeemklagfspdkvTYNALLDVygkcrrpkEAMQVLREMKINGCLPSIVTYNSLISAYARDGLLEEAMELKTQMVEigitpdvfTYTTLLSGFEKAGKDESAMKVFEEMRsagckpnicTFNALIKMHGNRGNFVEMMKVFDEInkcnckpdivTWNTLLAVFgqngmdseVSGVFKemkragfiperdtFNTLISAYSRCGSFDQAMSIYKRMLeagvtpdlsTYNAVLAALARGGMWEQSEKIFAEmkggrckpneltYSSLLHAYANGREIDQMLALSEEIYSGIIEPHAVLLKTLILVYSKSDLLMDTERAFLELKkkgfspdiptlNAMISIYGRRQMVAKTNEILHFmndsgftpslttYNTLMYMYSRSENFARAEDVLREILAKgikpdiisYNTVIFAYCRNGRMKEASRIFSEmrdsglvpdviTYNTFVASYAADSLFVEALDVVRYMIkqgckpnqntynSIVDGYCKLNQRYEAITFvnnlskldphVTKELECKLSDRIAKKWT
maqnlslplllptppPAKPLFLTQTNHHNLPPPSPPQQQTTPSASPTTISPLLQDLYNNNsssqpihqprsrtrlgksrdsnrgkpwshhrlsakGQQVLQSLIDDSFDVKDIDSVLSQLLDQNPGEKSEDLGADLLGIVKGLGFHKKTDLALDVFEWFRSCCSKDGNLVLRGSVIAVLISMLGKEGKVSVAASLLHGLHKDGFDIDVYAYTSLITTYASNGRYREAVMVFKKMeeegckptlITYNVILNVYGKMGMPWNKIMALVEGMKSAGVKPDSYTFNTLISCCRRGSLHEEAAGVFEEMKLAGFSPDKVTYNALLDVYGKCRRPKEAMQVLREMKINGCLPSIVTYNSLISAYARDGLLEEAMELKTQMVEIGITPDVFTYTTLLSGFEKAGKDESAMKVFEEMRSAGCKPNICTFNALIKMHGNRGNFVEMMKVFDEINKCNCKPDIVTWNTLLAVFGQNGMDSEVSGVFKEMKRAGFIPERDTFNTLISAYSRCGSFDQAMSIYKRMLEAGVTPDLSTYNAVLAALARGGMWEQSEKIFAEMKGGRCKPNELTYSSLLHAYANGREIDQMLALSEEIYSGIIEPHAVLLKTLILVYSKSDLLMDTERAFLElkkkgfspdiptLNAMISIYGRRQMVAKTNEILHFMNDSGFTPSLTTYNTLMYMYSRSENFARAEDVLREILakgikpdiisyNTVIFAYCRNGRMKEASRIFSEMRDSGLVPDVITYNTFVASYAADSLFVEALDVVRYMIKqgckpnqntyNSIVDGYCKLNQRYEAITFvnnlskldphvtkelecklsdriakkwt
MAQNlslplllptpppakplflTQTNHHNLpppsppqqqttpsaspttispLLQDLYNNNSSSQPIHQPRSRTRLGKSRDSNRGKPWSHHRLSAKGQQVLQSLIDDSFDVKDIDSVLSQLLDQNPGEKSEDLGADLLGIVKGLGFHKKTDLALDVFEWFRSCCSKDGNLVLRGSVIAVLISMLGKEGKVSVAASLLHGLHKDGFDIDVYAYTSLITTYASNGRYREAVMVFKKMEEEGCKPTLITYNVILNVYGKMGMPWNKIMALVEGMKSAGVKPDSYTFNTLISCCRRGSLHEEAAGVFEEMKLAGFSPDKVTYNALLDVYGKCRRPKEAMQVLREMKINGCLPSIVTYNSLISAYARDGLLEEAMELKTQMVEIGITPDVFTYTTLLSGFEKAGKDESAMKVFEEMRSAGCKPNICTFNALIKMHGNRGNFVEMMKVFDEINKCNCKPDIVTWNTLLAVFGQNGMDSEVSGVFKEMKRAGFIPERDTFNTLISAYSRCGSFDQAMSIYKRMLEAGVTPDLSTYNAVLAALARGGMWEQSEKIFAEMKGGRCKPNELTYSSLLHAYANGREIDQMLALSEEIYSGIIEPHAVLLKTLILVYSKSDLLMDTERAFLELKKKGFSPDIPTLNAMISIYGRRQMVAKTNEILHFMNDSGFTPSLTTYNTLMYMYSRSENFARAEDVLREILAKGIKPDIISYNTVIFAYCRNGRMKEASRIFSEMRDSGLVPDVITYNTFVASYAADSLFVEALDVVRYMIKQGCKPNQNTYNSIVDGYCKLNQRYEAITFVNNLSKLDPHVTKELECKLSDRIAKKWT
*****************************************************************************************************SLIDDSFDVKDIDSVL**************LGADLLGIVKGLGFHKKTDLALDVFEWFRSCCSKDGNLVLRGSVIAVLISMLGKEGKVSVAASLLHGLHKDGFDIDVYAYTSLITTYASNGRYREAVMVFKKMEEEGCKPTLITYNVILNVYGKMGMPWNKIMALVEGMKSAGVKPDSYTFNTLISCCRRGSLHEEAAGVFEEMKLAGFSPDKVTYNALLDVYGKCRRPKEAMQVLREMKINGCLPSIVTYNSLISAYARDGLLEEAMELKTQMVEIGITPDVFTYTTLLSGFEKAG*****MKVFEEMRSAGCKPNICTFNALIKMHGNRGNFVEMMKVFDEINKCNCKPDIVTWNTLLAVFGQNGMDSEVSGVFKEMKRAGFIPERDTFNTLISAYSRCGSFDQAMSIYKRMLEAGVTPDLSTYNAVLAALARGGMWEQSEKIFAEMKGGRCKPNELTYSSLLHAYANGREIDQMLALSEEIYSGIIEPHAVLLKTLILVYSKSDLLMDTERAFLELKKKGFSPDIPTLNAMISIYGRRQMVAKTNEILHFMNDSGFTPSLTTYNTLMYMYSRSENFARAEDVLREILAKGIKPDIISYNTVIFAYCRNGRMKEASRIFSEMRDSGLVPDVITYNTFVASYAADSLFVEALDVVRYMIKQGCKPNQNTYNSIVDGYCKLNQRYEAITFVNNLSKLDPHVTKELECK**********
*******************************************************************************************LSAKGQQVLQSLIDDSFDVKDIDSVLSQLLDQNPGEKSEDLGADLLGIVKGLGFHKKTDLALDVFEWFRSCCSKDGNLVLRGSVIAVLISMLGKEGKVSVAASLLHGLHKDGFDIDVYAYTSLITTYASNGRYREAVMVFKKMEEEGCKPTLITYNVILNVYGKMGMPWNKIMALVEGMKSAGVKPDSYTFNTLISCCRRGSLHEEAAGVFEEMKLAGFSPDKVTYNALLDVYGKCRRPKEAMQVLREMKINGCLPSIVTYNSLISAYARDGLLEEAMELKTQMVEIGITPDVFTYTTLLSGFEKAGKDESAMKVFEEMRSAGCKPNICTFNALIKMHGNRGNFVEMMKVFDEINKCNCKPDIVTWNTLLAVFGQNGMDSEVSGVFKEMKRAGFIPERDTFNTLISAYSRCGSFDQAMSIYKRMLEAGVTPDLSTYNAVLAALARGGMWEQSEKIFAEMKGGRCKPNELTYSSLLHAYANGREIDQMLALSEEIYSGIIEPHAVLLKTLILVYSKSDLLMDTERAFLELKKKGFSPDIPTLNAMISIYGRRQMVAKTNEILHFMNDSGFTPSLTTYNTLMYMYSRSENFARAEDVLREILAKGIKPDIISYNTVIFAYCRNGRMKEASRIFSEMRDSGLVPDVITYNTFVASYAADSLFVEALDVVRYMIKQGCKPNQNTYNSIVDGYCKLNQRYEAITFVNNLSKLDPHVTKELECKLSDRIAKKWT
MAQNLSLPLLLPTPPPAKPLFLTQTNHHNL****************TTISPLLQDLYNNN********************************SAKGQQVLQSLIDDSFDVKDIDSVLSQLLDQNPGEKSEDLGADLLGIVKGLGFHKKTDLALDVFEWFRSCCSKDGNLVLRGSVIAVLISMLGKEGKVSVAASLLHGLHKDGFDIDVYAYTSLITTYASNGRYREAVMVFKKMEEEGCKPTLITYNVILNVYGKMGMPWNKIMALVEGMKSAGVKPDSYTFNTLISCCRRGSLHEEAAGVFEEMKLAGFSPDKVTYNALLDVYGKCRRPKEAMQVLREMKINGCLPSIVTYNSLISAYARDGLLEEAMELKTQMVEIGITPDVFTYTTLLSGFEKAGKDESAMKVFEEMRSAGCKPNICTFNALIKMHGNRGNFVEMMKVFDEINKCNCKPDIVTWNTLLAVFGQNGMDSEVSGVFKEMKRAGFIPERDTFNTLISAYSRCGSFDQAMSIYKRMLEAGVTPDLSTYNAVLAALARGGMWEQSEKIFAEMKGGRCKPNELTYSSLLHAYANGREIDQMLALSEEIYSGIIEPHAVLLKTLILVYSKSDLLMDTERAFLELKKKGFSPDIPTLNAMISIYGRRQMVAKTNEILHFMNDSGFTPSLTTYNTLMYMYSRSENFARAEDVLREILAKGIKPDIISYNTVIFAYCRNGRMKEASRIFSEMRDSGLVPDVITYNTFVASYAADSLFVEALDVVRYMIKQGCKPNQNTYNSIVDGYCKLNQRYEAITFVNNLSKLDPHVTKELECKLSDRIAKKWT
******L*LLLPTPPPAKPLFLTQTNHHNLPPPSPPQQQTTPSASPTTISPLLQDLYNNNSSSQPIHQPRSRTRLGKSRDSNRGKPWSHHRLSAKGQQVLQSLIDDSFDVKDIDSVLSQLLDQNPGEKSEDLGADLLGIVKGLGFHKKTDLALDVFEWFRSCCSKDGNLVLRGSVIAVLISMLGKEGKVSVAASLLHGLHKDGFDIDVYAYTSLITTYASNGRYREAVMVFKKMEEEGCKPTLITYNVILNVYGKMGMPWNKIMALVEGMKSAGVKPDSYTFNTLISCCRRGSLHEEAAGVFEEMKLAGFSPDKVTYNALLDVYGKCRRPKEAMQVLREMKINGCLPSIVTYNSLISAYARDGLLEEAMELKTQMVEIGITPDVFTYTTLLSGFEKAGKDESAMKVFEEMRSAGCKPNICTFNALIKMHGNRGNFVEMMKVFDEINKCNCKPDIVTWNTLLAVFGQNGMDSEVSGVFKEMKRAGFIPERDTFNTLISAYSRCGSFDQAMSIYKRMLEAGVTPDLSTYNAVLAALARGGMWEQSEKIFAEMKGGRCKPNELTYSSLLHAYANGREIDQMLALSEEIYSGIIEPHAVLLKTLILVYSKSDLLMDTERAFLELKKKGFSPDIPTLNAMISIYGRRQMVAKTNEILHFMNDSGFTPSLTTYNTLMYMYSRSENFARAEDVLREILAKGIKPDIISYNTVIFAYCRNGRMKEASRIFSEMRDSGLVPDVITYNTFVASYAADSLFVEALDVVRYMIKQGCKPNQNTYNSIVDGYCKLNQRYEAITFVNNLSKLDPHVTKELECKLSDRIAKKWT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQNLSLPLLLPTPPPAKPLFLTQTNHHNLPPPSPPQQQTTPSASPTTISPLLQDLYNNNSSSQPIHQPRSRTRLGKSRDSNRGKPWSHHRLSAKGQQVLQSLIDDSFDVKDIDSVLSQLLDQNPGEKSEDLGADLLGIVKGLGFHKKTDLALDVFEWFRSCCSKDGNLVLRGSVIAVLISMLGKEGKVSVAASLLHGLHKDGFDIDVYAYTSLITTYASNGRYREAVMVFKKMEEEGCKPTLITYNVILNVYGKMGMPWNKIMALVEGMKSAGVKPDSYTFNTLISCCRRGSLHEEAAGVFEEMKLAGFSPDKVTYNALLDVYGKCRRPKEAMQVLREMKINGCLPSIVTYNSLISAYARDGLLEEAMELKTQMVEIGITPDVFTYTTLLSGFEKAGKDESAMKVFEEMRSAGCKPNICTFNALIKMHGNRGNFVEMMKVFDEINKCNCKPDIVTWNTLLAVFGQNGMDSEVSGVFKEMKRAGFIPERDTFNTLISAYSRCGSFDQAMSIYKRMLEAGVTPDLSTYNAVLAALARGGMWEQSEKIFAEMKGGRCKPNELTYSSLLHAYANGREIDQMLALSEEIYSGIIEPHAVLLKTLILVYSKSDLLMDTERAFLELKKKGFSPDIPTLNAMISIYGRRQMVAKTNEILHFMNDSGFTPSLTTYNTLMYMYSRSENFARAEDVLREILAKGIKPDIISYNTVIFAYCRNGRMKEASRIFSEMRDSGLVPDVITYNTFVASYAADSLFVEALDVVRYMIKQGCKPNQNTYNSIVDGYCKLNQRYEAITFVNNLSKLDPHVTKELECKLSDRIAKKWT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query819 2.2.26 [Sep-21-2011]
Q9LYZ9819 Pentatricopeptide repeat- yes no 0.993 0.993 0.698 0.0
O64624822 Pentatricopeptide repeat- no no 0.949 0.946 0.399 1e-164
Q9S7Q2862 Pentatricopeptide repeat- no no 0.694 0.660 0.284 2e-80
Q9SIC9918 Pentatricopeptide repeat- no no 0.617 0.551 0.301 6e-72
Q9M907871 Pentatricopeptide repeat- no no 0.771 0.725 0.262 4e-67
Q76C99791 Protein Rf1, mitochondria N/A no 0.706 0.731 0.261 2e-66
Q9LFC5729 Pentatricopeptide repeat- no no 0.633 0.711 0.287 2e-64
Q9SZ521112 Pentatricopeptide repeat- no no 0.755 0.556 0.268 5e-63
Q9LSL9 915 Pentatricopeptide repeat- no no 0.650 0.582 0.279 1e-62
Q9LER0940 Pentatricopeptide repeat- no no 0.702 0.611 0.265 4e-62
>sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 Back     alignment and function desciption
 Score = 1182 bits (3059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/822 (69%), Positives = 675/822 (82%), Gaps = 8/822 (0%)

Query: 1   MAQNLSLPLLLPTPPPAKPLFLTQTNHHNLPPPSPPQQQTTPSASPTTISPLLQDLYNNN 60
           MA  L+LPLLLP  P +KP    Q NHH    P      ++P   P         L+ N 
Sbjct: 1   MADKLALPLLLPCTPSSKPYSHDQ-NHHISRTPFLTTSLSSPPPPPVEPLLHDVFLHQNP 59

Query: 61  SSSQPIH----QPRSRTRLGKSRDSNRGKPWSHHRLSAKGQQVLQSLIDDSFDVKDIDSV 116
           +S QPI     + R+RTR+GKSRD N GKPWS+H LS +GQQVL+SLI+ +FD   +DSV
Sbjct: 60  NSRQPISSQTSRNRNRTRIGKSRDPNLGKPWSYHGLSPQGQQVLRSLIEPNFDSGQLDSV 119

Query: 117 LSQLLDQNPGEKSEDLGADLLGIVKGLGFHKKTDLALDVFEWFRSCCSKDGNLVLRGSVI 176
           LS+L +    +K E   ++LL  +KGLGFHKK DLAL  F+WF     KD   +L  SV+
Sbjct: 120 LSELFEPFK-DKPESTSSELLAFLKGLGFHKKFDLALRAFDWFMK--QKDYQSMLDNSVV 176

Query: 177 AVLISMLGKEGKVSVAASLLHGLHKDGFDIDVYAYTSLITTYASNGRYREAVMVFKKMEE 236
           A++ISMLGKEG+VS AA++ +GL +DGF +DVY+YTSLI+ +A++GRYREAV VFKKMEE
Sbjct: 177 AIIISMLGKEGRVSSAANMFNGLQEDGFSLDVYSYTSLISAFANSGRYREAVNVFKKMEE 236

Query: 237 EGCKPTLITYNVILNVYGKMGMPWNKIMALVEGMKSAGVKPDSYTFNTLISCCRRGSLHE 296
           +GCKPTLITYNVILNV+GKMG PWNKI +LVE MKS G+ PD+YT+NTLI+CC+RGSLH+
Sbjct: 237 DGCKPTLITYNVILNVFGKMGTPWNKITSLVEKMKSDGIAPDAYTYNTLITCCKRGSLHQ 296

Query: 297 EAAGVFEEMKLAGFSPDKVTYNALLDVYGKCRRPKEAMQVLREMKINGCLPSIVTYNSLI 356
           EAA VFEEMK AGFS DKVTYNALLDVYGK  RPKEAM+VL EM +NG  PSIVTYNSLI
Sbjct: 297 EAAQVFEEMKAAGFSYDKVTYNALLDVYGKSHRPKEAMKVLNEMVLNGFSPSIVTYNSLI 356

Query: 357 SAYARDGLLEEAMELKTQMVEIGITPDVFTYTTLLSGFEKAGKDESAMKVFEEMRSAGCK 416
           SAYARDG+L+EAMELK QM E G  PDVFTYTTLLSGFE+AGK ESAM +FEEMR+AGCK
Sbjct: 357 SAYARDGMLDEAMELKNQMAEKGTKPDVFTYTTLLSGFERAGKVESAMSIFEEMRNAGCK 416

Query: 417 PNICTFNALIKMHGNRGNFVEMMKVFDEINKCNCKPDIVTWNTLLAVFGQNGMDSEVSGV 476
           PNICTFNA IKM+GNRG F EMMK+FDEIN C   PDIVTWNTLLAVFGQNGMDSEVSGV
Sbjct: 417 PNICTFNAFIKMYGNRGKFTEMMKIFDEINVCGLSPDIVTWNTLLAVFGQNGMDSEVSGV 476

Query: 477 FKEMKRAGFIPERDTFNTLISAYSRCGSFDQAMSIYKRMLEAGVTPDLSTYNAVLAALAR 536
           FKEMKRAGF+PER+TFNTLISAYSRCGSF+QAM++Y+RML+AGVTPDLSTYN VLAALAR
Sbjct: 477 FKEMKRAGFVPERETFNTLISAYSRCGSFEQAMTVYRRMLDAGVTPDLSTYNTVLAALAR 536

Query: 537 GGMWEQSEKIFAEMKGGRCKPNELTYSSLLHAYANGREIDQMLALSEEIYSGIIEPHAVL 596
           GGMWEQSEK+ AEM+ GRCKPNELTY SLLHAYANG+EI  M +L+EE+YSG+IEP AVL
Sbjct: 537 GGMWEQSEKVLAEMEDGRCKPNELTYCSLLHAYANGKEIGLMHSLAEEVYSGVIEPRAVL 596

Query: 597 LKTLILVYSKSDLLMDTERAFLELKKKGFSPDIPTLNAMISIYGRRQMVAKTNEILHFMN 656
           LKTL+LV SK DLL + ERAF ELK++GFSPDI TLN+M+SIYGRRQMVAK N +L +M 
Sbjct: 597 LKTLVLVCSKCDLLPEAERAFSELKERGFSPDITTLNSMVSIYGRRQMVAKANGVLDYMK 656

Query: 657 DSGFTPSLTTYNTLMYMYSRSENFARAEDVLREILAKGIKPDIISYNTVIFAYCRNGRMK 716
           + GFTPS+ TYN+LMYM+SRS +F ++E++LREILAKGIKPDIISYNTVI+AYCRN RM+
Sbjct: 657 ERGFTPSMATYNSLMYMHSRSADFGKSEEILREILAKGIKPDIISYNTVIYAYCRNTRMR 716

Query: 717 EASRIFSEMRDSGLVPDVITYNTFVASYAADSLFVEALDVVRYMIKQGCKPNQNTYNSIV 776
           +ASRIFSEMR+SG+VPDVITYNTF+ SYAADS+F EA+ VVRYMIK GC+PNQNTYNSIV
Sbjct: 717 DASRIFSEMRNSGIVPDVITYNTFIGSYAADSMFEEAIGVVRYMIKHGCRPNQNTYNSIV 776

Query: 777 DGYCKLNQRYEAITFVNNLSKLDPHVTKELECKLSDRIAKKW 818
           DGYCKLN++ EA  FV +L  LDPH  K  + +L +RI KKW
Sbjct: 777 DGYCKLNRKDEAKLFVEDLRNLDPHAPKGEDLRLLERIVKKW 818

Arabidopsis thaliana (taxid: 3702)
>sp|O64624|PP163_ARATH Pentatricopeptide repeat-containing protein At2g18940 OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1 Back     alignment and function description
>sp|Q9S7Q2|PP124_ARATH Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 Back     alignment and function description
>sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 Back     alignment and function description
>sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 Back     alignment and function description
>sp|Q9LER0|PP381_ARATH Pentatricopeptide repeat-containing protein At5g14770, mitochondrial OS=Arabidopsis thaliana GN=At5g14770 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query819
255555231827 pentatricopeptide repeat-containing prot 0.990 0.980 0.729 0.0
225429339811 PREDICTED: pentatricopeptide repeat-cont 0.905 0.914 0.773 0.0
449438627831 PREDICTED: pentatricopeptide repeat-cont 0.945 0.931 0.740 0.0
449530359831 PREDICTED: pentatricopeptide repeat-cont 0.945 0.931 0.739 0.0
297806221819 pentatricopeptide repeat-containing prot 0.993 0.993 0.700 0.0
15242557819 pentatricopeptide repeat-containing prot 0.993 0.993 0.698 0.0
356540307804 PREDICTED: pentatricopeptide repeat-cont 0.930 0.947 0.697 0.0
224056220643 predicted protein [Populus trichocarpa] 0.785 1.0 0.827 0.0
224103707643 predicted protein [Populus trichocarpa] 0.785 1.0 0.807 0.0
356574297794 PREDICTED: pentatricopeptide repeat-cont 0.919 0.948 0.670 0.0
>gi|255555231|ref|XP_002518652.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542033|gb|EEF43577.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1236 bits (3198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/835 (72%), Positives = 698/835 (83%), Gaps = 24/835 (2%)

Query: 1   MAQNLSLPLLLPTPPPAKPLFLTQTNHHNLPPPSPPQQQTTPSASPTTISPLLQDLYNNN 60
           MA+ ++LPLL+  P P KP F TQ+  HNL  PS     ++ + S    +PL+Q++  N+
Sbjct: 1   MAEKVALPLLISNPLPTKPQFPTQS--HNLQQPS--SPISSSNTSSPPFTPLIQNMLINH 56

Query: 61  SSSQPIHQP---------RSRTRLGKSRDSNRGKPWSHHRLSAKGQQVLQSLIDDSFDVK 111
              QP H P         R RTR+ K+RD NRGKPW+ HRLS  GQQVL SLID  F+  
Sbjct: 57  HKIQP-HSPKFINPNVSIRPRTRISKARDPNRGKPWASHRLSTLGQQVLDSLIDPCFEGS 115

Query: 112 DIDSVLSQLLDQNPGEK-------SEDLGADLLGIVKGLGFHKKTDLALDVFEWFRSCCS 164
           ++D VLSQL +    E+          L  D+LGI+KGLGF+KK D+A+ VF W R    
Sbjct: 116 ELDKVLSQLFEYYHKEELSLSSGTWNSLSMDVLGIIKGLGFYKKCDMAMSVFSWVRE--R 173

Query: 165 KDGNLVLRGSVIAVLISMLGKEGKVSVAASLLHGLHKDGFDIDVYAYTSLITTYASNGRY 224
           +D   VL  SV+AV+I+MLGKEGKVS A+S+L+ L KDGFD+DVYAYTSLIT YASNGRY
Sbjct: 174 EDFESVLNCSVVAVIITMLGKEGKVSAASSILNNLRKDGFDLDVYAYTSLITAYASNGRY 233

Query: 225 REAVMVFKKMEEEGCKPTLITYNVILNVYGKMGMPWNKIMALVEGMKSAGVKPDSYTFNT 284
           R+AV+VFKKMEEEGCKPTLITYNVILNVYGKMGMPW+KI  LV GMKS+GV PD YT+NT
Sbjct: 234 RDAVLVFKKMEEEGCKPTLITYNVILNVYGKMGMPWSKISGLVHGMKSSGVAPDDYTYNT 293

Query: 285 LISCCRRGSLHEEAAGVFEEMKLAGFSPDKVTYNALLDVYGKCRRPKEAMQVLREMKING 344
           LISCCRRGSL+EEAA VFEEMKL+GFSPDKVT+N LLDVYGK RRPKEAM+VL+EM+ +G
Sbjct: 294 LISCCRRGSLYEEAAQVFEEMKLSGFSPDKVTFNTLLDVYGKSRRPKEAMEVLKEMEFSG 353

Query: 345 CLPSIVTYNSLISAYARDGLLEEAMELKTQMVEIGITPDVFTYTTLLSGFEKAGKDESAM 404
             PSIVTYNSLISAYARDGLL EAMELK QMVE GI PDVFTYTTLLSGFEKAG DE AM
Sbjct: 354 FSPSIVTYNSLISAYARDGLLREAMELKDQMVEKGIKPDVFTYTTLLSGFEKAGMDEPAM 413

Query: 405 KVFEEMRSAGCKPNICTFNALIKMHGNRGNFVEMMKVFDEINKCNCKPDIVTWNTLLAVF 464
           ++F EMR+AGCKPNICTFNALIKMHGNRG F EMMKVF+EI  CNC PDIVTWNTLLAVF
Sbjct: 414 RIFGEMRAAGCKPNICTFNALIKMHGNRGRFAEMMKVFEEIEICNCAPDIVTWNTLLAVF 473

Query: 465 GQNGMDSEVSGVFKEMKRAGFIPERDTFNTLISAYSRCGSFDQAMSIYKRMLEAGVTPDL 524
           GQNGMDSEVSGVFKEMKRAGF+PERDTFNTLISAYSRCGSF QAM++YKRMLEAGVTPDL
Sbjct: 474 GQNGMDSEVSGVFKEMKRAGFVPERDTFNTLISAYSRCGSFQQAMAVYKRMLEAGVTPDL 533

Query: 525 STYNAVLAALARGGMWEQSEKIFAEMKGGRCKPNELTYSSLLHAYANGREIDQMLALSEE 584
           S+YNAVLAALARGG+WEQSEK+FAEMK GRCKPNELTY SLLHAYAN +EI++M  L+EE
Sbjct: 534 SSYNAVLAALARGGLWEQSEKVFAEMKDGRCKPNELTYCSLLHAYANSKEIERMHTLAEE 593

Query: 585 IYSGIIEPHAVLLKTLILVYSKSDLLMDTERAFLELKKKGFSPDIPTLNAMISIYGRRQM 644
           IYSG+ EP  VLLKTL+LV SK DLLM+TE AF ELKKKG SPD+ TLNAMI+IYGRRQM
Sbjct: 594 IYSGLTEPVPVLLKTLVLVNSKCDLLMETEHAFEELKKKG-SPDLSTLNAMIAIYGRRQM 652

Query: 645 VAKTNEILHFMNDSGFTPSLTTYNTLMYMYSRSENFARAEDVLREILAKGIKPDIISYNT 704
           VAK NEIL+FMN+SGF+PSL TYN+LMYM+SRSENF R+E+VL+EILAKG+KPD+ISYNT
Sbjct: 653 VAKANEILNFMNESGFSPSLATYNSLMYMHSRSENFERSEEVLKEILAKGLKPDLISYNT 712

Query: 705 VIFAYCRNGRMKEASRIFSEMRDSGLVPDVITYNTFVASYAADSLFVEALDVVRYMIKQG 764
           VIFAYCRNGRMK+ASRIFS M+  GLVPDVITYNTFVASYAADSLF +A+ VVRYMIK G
Sbjct: 713 VIFAYCRNGRMKDASRIFSYMKTYGLVPDVITYNTFVASYAADSLFEDAIGVVRYMIKHG 772

Query: 765 CKPNQNTYNSIVDGYCKLNQRYEAITFVNNLSKLDPHVTKELECKLSDRIAKKWT 819
           CK NQNTYNSIVDGYCK ++R +AI FV++L++LDPHVTKE E +LS+RIAKKW+
Sbjct: 773 CKRNQNTYNSIVDGYCKHSRRADAIMFVSSLNQLDPHVTKEEELRLSERIAKKWS 827

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225429339|ref|XP_002269471.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449438627|ref|XP_004137089.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449530359|ref|XP_004172163.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297806221|ref|XP_002870994.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297316831|gb|EFH47253.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15242557|ref|NP_195906.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75181167|sp|Q9LYZ9.1|PP362_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g02860 gi|7413561|emb|CAB86040.1| putative protein [Arabidopsis thaliana] gi|332003145|gb|AED90528.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356540307|ref|XP_003538631.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860-like [Glycine max] Back     alignment and taxonomy information
>gi|224056220|ref|XP_002298762.1| predicted protein [Populus trichocarpa] gi|222846020|gb|EEE83567.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224103707|ref|XP_002313163.1| predicted protein [Populus trichocarpa] gi|222849571|gb|EEE87118.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356574297|ref|XP_003555285.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query819
TAIR|locus:2151281819 AT5G02860 [Arabidopsis thalian 0.932 0.932 0.721 1.3e-304
TAIR|locus:2044430822 AT2G18940 [Arabidopsis thalian 0.899 0.896 0.410 6.9e-150
TAIR|locus:2027166862 PTAC2 "plastid transcriptional 0.694 0.660 0.284 1.9e-76
TAIR|locus:2061310918 GUN1 "AT2G31400" [Arabidopsis 0.567 0.506 0.310 2.6e-69
TAIR|locus:2077637871 AT3G06920 "AT3G06920" [Arabido 0.770 0.724 0.267 2.2e-66
TAIR|locus:2174008974 AT5G61990 "AT5G61990" [Arabido 0.746 0.627 0.271 3.6e-62
TAIR|locus:2150024729 AT5G01110 [Arabidopsis thalian 0.633 0.711 0.287 3.8e-62
TAIR|locus:21167721112 PGR3 "AT4G31850" [Arabidopsis 0.785 0.578 0.268 1.3e-61
TAIR|locus:2077061619 AT3G22470 "AT3G22470" [Arabido 0.693 0.917 0.256 2.1e-61
TAIR|locus:2015208630 AT1G63130 [Arabidopsis thalian 0.709 0.922 0.259 9e-61
TAIR|locus:2151281 AT5G02860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2923 (1034.0 bits), Expect = 1.3e-304, P = 1.3e-304
 Identities = 558/773 (72%), Positives = 654/773 (84%)

Query:    52 LLQD--LYNNNSSSQPIHQP----RSRTRLGKSRDSNRGKPWSHHRLSAKGQQVLQSLID 105
             LL D  L+ N +S QPI       R+RTR+GKSRD N GKPWS+H LS +GQQVL+SLI+
Sbjct:    49 LLHDVFLHQNPNSRQPISSQTSRNRNRTRIGKSRDPNLGKPWSYHGLSPQGQQVLRSLIE 108

Query:   106 DSFDVKDIDSVLSQLLDQNPGEKSEDLGADLLGIVKGLGFHKKTDLALDVFEWFRSCCSK 165
              +FD   +DSVLS+L +    +K E   ++LL  +KGLGFHKK DLAL  F+WF     K
Sbjct:   109 PNFDSGQLDSVLSELFEPFK-DKPESTSSELLAFLKGLGFHKKFDLALRAFDWFMK--QK 165

Query:   166 DGNLVLRGSVIAVLISMLGKEGKVSVAASLLHGLHKDGFDIDVYAYTSLITTYASNGRYR 225
             D   +L  SV+A++ISMLGKEG+VS AA++ +GL +DGF +DVY+YTSLI+ +A++GRYR
Sbjct:   166 DYQSMLDNSVVAIIISMLGKEGRVSSAANMFNGLQEDGFSLDVYSYTSLISAFANSGRYR 225

Query:   226 EAVMVFKKMEEEGCKPTLITYNVILNVYGKMGMPWNKIMALVEGMKSAGVKPDSYTFNTL 285
             EAV VFKKMEE+GCKPTLITYNVILNV+GKMG PWNKI +LVE MKS G+ PD+YT+NTL
Sbjct:   226 EAVNVFKKMEEDGCKPTLITYNVILNVFGKMGTPWNKITSLVEKMKSDGIAPDAYTYNTL 285

Query:   286 ISCCRRGSLHEEAAGVFEEMKLAGFSPDKVTYNALLDVYGKCRRPKEAMQVLREMKINGC 345
             I+CC+RGSLH+EAA VFEEMK AGFS DKVTYNALLDVYGK  RPKEAM+VL EM +NG 
Sbjct:   286 ITCCKRGSLHQEAAQVFEEMKAAGFSYDKVTYNALLDVYGKSHRPKEAMKVLNEMVLNGF 345

Query:   346 LPSIVTYNSLISAYARDGLLEEAMELKTQMVEIGITPDVFTYTTLLSGFEKAGKDESAMK 405
              PSIVTYNSLISAYARDG+L+EAMELK QM E G  PDVFTYTTLLSGFE+AGK ESAM 
Sbjct:   346 SPSIVTYNSLISAYARDGMLDEAMELKNQMAEKGTKPDVFTYTTLLSGFERAGKVESAMS 405

Query:   406 VFEEMRSAGCKPNICTFNALIKMHGNRGNFVEMMKVFDEINKCNCKPDIVTWNTLLAVFG 465
             +FEEMR+AGCKPNICTFNA IKM+GNRG F EMMK+FDEIN C   PDIVTWNTLLAVFG
Sbjct:   406 IFEEMRNAGCKPNICTFNAFIKMYGNRGKFTEMMKIFDEINVCGLSPDIVTWNTLLAVFG 465

Query:   466 QNGMDSEVSGVFKEMKRAGFIPERDTFNTLISAYSRCGSFDQAMSIYKRMLEAGVTPDLS 525
             QNGMDSEVSGVFKEMKRAGF+PER+TFNTLISAYSRCGSF+QAM++Y+RML+AGVTPDLS
Sbjct:   466 QNGMDSEVSGVFKEMKRAGFVPERETFNTLISAYSRCGSFEQAMTVYRRMLDAGVTPDLS 525

Query:   526 TYNAVLAALARGGMWEQSEKIFAEMKGGRCKPNELTYSSLLHAYANGREIDQMLALSEEI 585
             TYN VLAALARGGMWEQSEK+ AEM+ GRCKPNELTY SLLHAYANG+EI  M +L+EE+
Sbjct:   526 TYNTVLAALARGGMWEQSEKVLAEMEDGRCKPNELTYCSLLHAYANGKEIGLMHSLAEEV 585

Query:   586 YSGIIEPHAVLLKTLILVYSKSDLLMDTERAFLELKKKGFSPDIPTLNAMISIYGRRQMV 645
             YSG+IEP AVLLKTL+LV SK DLL + ERAF ELK++GFSPDI TLN+M+SIYGRRQMV
Sbjct:   586 YSGVIEPRAVLLKTLVLVCSKCDLLPEAERAFSELKERGFSPDITTLNSMVSIYGRRQMV 645

Query:   646 AKTNEILHFMNDSGFTPSLTTYNTLMYMYSRSENFARAEDVLREILAKGIKPDIISYNTV 705
             AK N +L +M + GFTPS+ TYN+LMYM+SRS +F ++E++LREILAKGIKPDIISYNTV
Sbjct:   646 AKANGVLDYMKERGFTPSMATYNSLMYMHSRSADFGKSEEILREILAKGIKPDIISYNTV 705

Query:   706 IFAYCRNGRMKEASRIFSEMRDSGLVPDVITYNTFVASYAADSLFVEALDVVRYMIKQGC 765
             I+AYCRN RM++ASRIFSEMR+SG+VPDVITYNTF+ SYAADS+F EA+ VVRYMIK GC
Sbjct:   706 IYAYCRNTRMRDASRIFSEMRNSGIVPDVITYNTFIGSYAADSMFEEAIGVVRYMIKHGC 765

Query:   766 KPNQNTYNSIVDGYCKLNQRYEAITFVNNLSKLDPHVTKELECKLSDRIAKKW 818
             +PNQNTYNSIVDGYCKLN++ EA  FV +L  LDPH  K  + +L +RI KKW
Sbjct:   766 RPNQNTYNSIVDGYCKLNRKDEAKLFVEDLRNLDPHAPKGEDLRLLERIVKKW 818
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2044430 AT2G18940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027166 PTAC2 "plastid transcriptionally active 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061310 GUN1 "AT2G31400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077637 AT3G06920 "AT3G06920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174008 AT5G61990 "AT5G61990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150024 AT5G01110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116772 PGR3 "AT4G31850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077061 AT3G22470 "AT3G22470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015208 AT1G63130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LYZ9PP362_ARATHNo assigned EC number0.69820.99380.9938yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query819
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-36
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-35
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-33
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-32
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-28
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-26
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-25
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 9e-25
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 7e-23
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-20
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-18
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-18
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-15
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-15
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-12
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 7e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-08
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-08
pfam0153531 pfam01535, PPR, PPR repeat 3e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-07
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 7e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 8e-07
pfam0153531 pfam01535, PPR, PPR repeat 9e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-06
pfam0153531 pfam01535, PPR, PPR repeat 2e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-06
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 3e-06
pfam0153531 pfam01535, PPR, PPR repeat 7e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-05
pfam0153531 pfam01535, PPR, PPR repeat 1e-05
pfam0153531 pfam01535, PPR, PPR repeat 1e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-05
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 4e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 4e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 5e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 1e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 4e-04
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 5e-04
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 5e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 6e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 8e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 8e-04
pfam0153531 pfam01535, PPR, PPR repeat 8e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 0.001
pfam1285434 pfam12854, PPR_1, PPR repeat 0.002
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.002
pfam1285434 pfam12854, PPR_1, PPR repeat 0.003
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information 
 Score =  146 bits (370), Expect = 5e-36
 Identities = 124/563 (22%), Positives = 234/563 (41%), Gaps = 66/563 (11%)

Query: 61  SSSQPIHQPRSRTRLGKSRDSNRGKPWSHHRLSAKGQQ----VLQSLIDDSFDVKDIDSV 116
           SS + I     R  L    +  + +  S    + KG +       + +  S D K+    
Sbjct: 278 SSGKGIFAESKREELYTFYEEKQSRAKSSRLPNVKGLRKGVSSATNSL--SLDKKNNGVK 335

Query: 117 LSQLLDQNPGEKSEDLGADLLGIVKGLGFHKKTDLA--LDVFEWFRSCCSKDGNLVLRGS 174
            ++L  Q+ G+ + D+  +        G   K      +D +                  
Sbjct: 336 DAELPGQSSGQAASDVEEENSLAAYNGGVSGKRKSPEYIDAYN----------------- 378

Query: 175 VIAVLISMLGKEGKVSVAASLLHGLHKDG-FDIDVYAYTSLITTYASNGRYREAVMVFKK 233
                  +L ++G++     LL  + K G  D+D   +             +EA    K 
Sbjct: 379 ------RLL-RDGRIKDCIDLLEDMEKRGLLDMDKIYHAKFFKACKKQRAVKEAFRFAKL 431

Query: 234 MEEEGCKPTLITYNVILNVY-------GKMGMPWNKIMALVEGMKSAGVKPDSYTFNTLI 286
           +      PTL T+N++++V        G +      ++ LV+    AG+K D   + TLI
Sbjct: 432 IRN----PTLSTFNMLMSVCASSQDIDGALR-----VLRLVQ---EAGLKADCKLYTTLI 479

Query: 287 SCCRRGSLHEEAAGVFEEMKLAGFSPDKVTYNALLDVYGKCRR----PKE--AMQVLREM 340
           S C +    +    VF EM  AG   +  T+ AL+D    C R     K   A  ++R  
Sbjct: 480 STCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALID---GCARAGQVAKAFGAYGIMRSK 536

Query: 341 KINGCLPSIVTYNSLISAYARDGLLEEAMELKTQMVEIG--ITPDVFTYTTLLSGFEKAG 398
            +    P  V +N+LISA  + G ++ A ++  +M      I PD  T   L+     AG
Sbjct: 537 NVK---PDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAG 593

Query: 399 KDESAMKVFEEMRSAGCKPNICTFNALIKMHGNRGNFVEMMKVFDEINKCNCKPDIVTWN 458
           + + A +V++ +     K     +   +     +G++   + ++D++ K   KPD V ++
Sbjct: 594 QVDRAKEVYQMIHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFS 653

Query: 459 TLLAVFGQNGMDSEVSGVFKEMKRAGFIPERDTFNTLISAYSRCGSFDQAMSIYKRMLEA 518
            L+ V G  G   +   + ++ ++ G      ++++L+ A S   ++ +A+ +Y+ +   
Sbjct: 654 ALVDVAGHAGDLDKAFEILQDARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSI 713

Query: 519 GVTPDLSTYNAVLAALARGGMWEQSEKIFAEMKGGRCKPNELTYSSLLHAYANGREIDQM 578
            + P +ST NA++ AL  G    ++ ++ +EMK     PN +TYS LL A     + D  
Sbjct: 714 KLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVASERKDDADVG 773

Query: 579 LALSEEIYSGIIEPHAVLLKTLI 601
           L L  +     I+P+ V+ + + 
Sbjct: 774 LDLLSQAKEDGIKPNLVMCRCIT 796

Length = 1060
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 819
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.97
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.96
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.94
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.94
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.94
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.91
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.9
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.89
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.88
PRK14574 822 hmsH outer membrane protein; Provisional 99.87
PRK11788389 tetratricopeptide repeat protein; Provisional 99.87
KOG2076895 consensus RNA polymerase III transcription factor 99.87
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.87
KOG2076895 consensus RNA polymerase III transcription factor 99.86
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.85
PRK14574 822 hmsH outer membrane protein; Provisional 99.84
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.82
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.81
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.8
KOG1915677 consensus Cell cycle control protein (crooked neck 99.8
KOG2003840 consensus TPR repeat-containing protein [General f 99.79
KOG2003840 consensus TPR repeat-containing protein [General f 99.78
KOG1915677 consensus Cell cycle control protein (crooked neck 99.71
KOG0547606 consensus Translocase of outer mitochondrial membr 99.68
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.68
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.67
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.67
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.67
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.66
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.63
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.63
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.63
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.62
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.62
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.61
KOG1126638 consensus DNA-binding cell division cycle control 99.6
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.6
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.58
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.58
KOG0547606 consensus Translocase of outer mitochondrial membr 99.58
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.58
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.55
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.54
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.54
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.54
KOG1126638 consensus DNA-binding cell division cycle control 99.54
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.54
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.53
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.52
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.52
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.51
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.5
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.46
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.45
KOG1129478 consensus TPR repeat-containing protein [General f 99.4
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.4
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.39
KOG1129478 consensus TPR repeat-containing protein [General f 99.38
KOG2376652 consensus Signal recognition particle, subunit Srp 99.38
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.37
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.34
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.34
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.33
PRK12370553 invasion protein regulator; Provisional 99.32
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.31
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.3
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.3
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.29
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.29
PRK12370553 invasion protein regulator; Provisional 99.27
PRK11189296 lipoprotein NlpI; Provisional 99.27
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.26
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.24
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.21
PF1304150 PPR_2: PPR repeat family 99.2
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.2
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.19
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.18
PF1304150 PPR_2: PPR repeat family 99.16
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.15
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.15
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.12
PRK11189296 lipoprotein NlpI; Provisional 99.07
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.04
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.0
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.99
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.96
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.96
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.95
KOG1125579 consensus TPR repeat-containing protein [General f 98.95
KOG1125579 consensus TPR repeat-containing protein [General f 98.94
PRK04841 903 transcriptional regulator MalT; Provisional 98.92
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.91
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.89
PRK04841903 transcriptional regulator MalT; Provisional 98.85
PLN02789320 farnesyltranstransferase 98.8
PRK15359144 type III secretion system chaperone protein SscB; 98.8
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.79
PRK10370198 formate-dependent nitrite reductase complex subuni 98.79
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.78
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.77
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.74
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.73
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.72
PLN02789320 farnesyltranstransferase 98.7
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.68
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.63
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.63
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.61
KOG1128777 consensus Uncharacterized conserved protein, conta 98.6
PF1285434 PPR_1: PPR repeat 98.6
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.56
PF1285434 PPR_1: PPR repeat 98.55
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.54
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.52
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.5
PRK10370198 formate-dependent nitrite reductase complex subuni 98.49
PRK15359144 type III secretion system chaperone protein SscB; 98.47
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.44
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.43
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.39
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.36
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.32
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.31
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.31
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.3
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.28
KOG0553 304 consensus TPR repeat-containing protein [General f 98.22
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.19
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.12
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.1
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.07
KOG20411189 consensus WD40 repeat protein [General function pr 98.04
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.04
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.02
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.01
COG4700251 Uncharacterized protein conserved in bacteria cont 98.0
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.97
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.97
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.96
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.96
COG4700251 Uncharacterized protein conserved in bacteria cont 97.95
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.94
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 97.94
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.93
KOG0553304 consensus TPR repeat-containing protein [General f 97.92
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.91
KOG20411189 consensus WD40 repeat protein [General function pr 97.9
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.89
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.88
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.85
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.84
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.83
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.82
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.78
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.78
KOG19241102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 97.78
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.75
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.74
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.72
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.72
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.71
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.71
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.71
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.69
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.69
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.68
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.67
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.65
PRK10803263 tol-pal system protein YbgF; Provisional 97.65
PF12688120 TPR_5: Tetratrico peptide repeat 97.64
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.63
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.61
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.58
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.57
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.56
PF1337173 TPR_9: Tetratricopeptide repeat 97.56
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.55
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.55
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.54
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.47
PRK15331165 chaperone protein SicA; Provisional 97.44
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.42
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.39
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.36
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.35
PF12688120 TPR_5: Tetratrico peptide repeat 97.35
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.31
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.3
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.26
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 97.24
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.19
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.15
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.13
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.12
KOG1941 518 consensus Acetylcholine receptor-associated protei 97.11
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.11
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 97.09
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.08
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.06
PRK10803263 tol-pal system protein YbgF; Provisional 96.99
PF13512142 TPR_18: Tetratricopeptide repeat 96.98
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.98
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.93
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.92
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.92
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.9
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.76
COG3898531 Uncharacterized membrane-bound protein [Function u 96.72
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.69
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.67
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.66
PRK15331165 chaperone protein SicA; Provisional 96.65
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.62
PRK11906458 transcriptional regulator; Provisional 96.62
PF1337173 TPR_9: Tetratricopeptide repeat 96.61
PF13512142 TPR_18: Tetratricopeptide repeat 96.57
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.56
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.54
KOG1258577 consensus mRNA processing protein [RNA processing 96.47
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.46
PRK11906458 transcriptional regulator; Provisional 96.45
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.44
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.42
KOG1258577 consensus mRNA processing protein [RNA processing 96.39
KOG1586288 consensus Protein required for fusion of vesicles 96.38
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.34
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.29
PF1342844 TPR_14: Tetratricopeptide repeat 96.25
KOG1585308 consensus Protein required for fusion of vesicles 96.21
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.2
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.05
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.95
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.9
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.86
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 95.85
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.76
KOG4234271 consensus TPR repeat-containing protein [General f 95.69
KOG4555175 consensus TPR repeat-containing protein [Function 95.69
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.68
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.62
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 95.58
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.5
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.44
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.42
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.39
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.31
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.31
PF1342844 TPR_14: Tetratricopeptide repeat 95.25
smart00299140 CLH Clathrin heavy chain repeat homology. 95.22
KOG1550552 consensus Extracellular protein SEL-1 and related 95.22
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.16
smart00299140 CLH Clathrin heavy chain repeat homology. 95.0
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.96
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.84
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.81
KOG4648 536 consensus Uncharacterized conserved protein, conta 94.78
PF1343134 TPR_17: Tetratricopeptide repeat 94.78
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.76
KOG4555175 consensus TPR repeat-containing protein [Function 94.74
KOG3941406 consensus Intermediate in Toll signal transduction 94.57
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.52
KOG2062 929 consensus 26S proteasome regulatory complex, subun 94.52
KOG1585308 consensus Protein required for fusion of vesicles 94.51
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.45
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.41
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.3
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 94.25
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.05
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 94.01
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.92
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.83
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.8
PF13170297 DUF4003: Protein of unknown function (DUF4003) 93.78
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 93.73
COG1747 711 Uncharacterized N-terminal domain of the transcrip 93.7
KOG3364149 consensus Membrane protein involved in organellar 93.59
PF13170297 DUF4003: Protein of unknown function (DUF4003) 93.49
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.38
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.34
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.32
COG3629280 DnrI DNA-binding transcriptional activator of the 93.31
KOG2471 696 consensus TPR repeat-containing protein [General f 93.24
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 93.18
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.16
KOG3941406 consensus Intermediate in Toll signal transduction 93.16
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.04
COG2976207 Uncharacterized protein conserved in bacteria [Fun 93.03
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 92.81
COG3947361 Response regulator containing CheY-like receiver a 92.81
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 92.78
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 92.72
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.68
KOG1550552 consensus Extracellular protein SEL-1 and related 92.62
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 92.6
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 92.19
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 92.14
KOG1923830 consensus Rac1 GTPase effector FRL [Signal transdu 92.08
PF06552186 TOM20_plant: Plant specific mitochondrial import r 91.98
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 91.81
KOG4234271 consensus TPR repeat-containing protein [General f 91.02
PF09986214 DUF2225: Uncharacterized protein conserved in bact 91.0
PF06552186 TOM20_plant: Plant specific mitochondrial import r 90.84
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 90.82
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 90.7
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.65
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 90.45
PRK09687280 putative lyase; Provisional 90.21
COG3947361 Response regulator containing CheY-like receiver a 90.09
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 89.89
COG3629280 DnrI DNA-binding transcriptional activator of the 89.88
PF1343134 TPR_17: Tetratricopeptide repeat 89.58
COG4455 273 ImpE Protein of avirulence locus involved in tempe 89.3
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 89.15
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 89.03
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 88.81
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 88.8
KOG4570418 consensus Uncharacterized conserved protein [Funct 88.74
KOG0403645 consensus Neoplastic transformation suppressor Pdc 88.18
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 88.17
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 87.76
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 87.56
COG1747 711 Uncharacterized N-terminal domain of the transcrip 87.32
KOG02921202 consensus Vesicle coat complex COPI, alpha subunit 87.11
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 87.05
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 86.57
COG5178 2365 PRP8 U5 snRNP spliceosome subunit [RNA processing 86.31
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 86.09
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 86.02
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 85.89
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 85.44
KOG4648 536 consensus Uncharacterized conserved protein, conta 85.42
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 85.35
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 84.95
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 84.48
PRK10941269 hypothetical protein; Provisional 84.48
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 84.28
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 84.09
KOG4507 886 consensus Uncharacterized conserved protein, conta 83.97
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 83.77
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 83.63
KOG0687393 consensus 26S proteasome regulatory complex, subun 83.62
PRK11619 644 lytic murein transglycosylase; Provisional 83.34
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 83.3
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 83.25
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 82.79
KOG4570418 consensus Uncharacterized conserved protein [Funct 82.53
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 82.47
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 81.47
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 81.31
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 80.65
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.1e-82  Score=729.54  Aligned_cols=651  Identities=19%  Similarity=0.310  Sum_probs=617.0

Q ss_pred             hcHHHHHHhhccCCChHHHHHHHHHHHhccCCCCCccchHHHHHHHHHHHHhcCChHHHHHHHHHHhhCCCCCCHHHHHH
Q 003451          134 ADLLGIVKGLGFHKKTDLALDVFEWFRSCCSKDGNLVLRGSVIAVLISMLGKEGKVSVAASLLHGLHKDGFDIDVYAYTS  213 (819)
Q Consensus       134 ~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~  213 (819)
                      .....++..++..|+++.|+.+|+.+.+.     +...+..+|..++..|.+.+.++.|.+++..+.+.+..++...++.
T Consensus        52 ~~~n~~i~~l~~~g~~~~A~~l~~~m~~~-----g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~n~  126 (857)
T PLN03077         52 HDSNSQLRALCSHGQLEQALKLLESMQEL-----RVPVDEDAYVALFRLCEWKRAVEEGSRVCSRALSSHPSLGVRLGNA  126 (857)
T ss_pred             hhHHHHHHHHHhCCCHHHHHHHHHHHHhc-----CCCCChhHHHHHHHHHhhCCCHHHHHHHHHHHHHcCCCCCchHHHH
Confidence            34566778888999999999999999772     3345777899999999999999999999999999999999999999


Q ss_pred             HHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHcCC
Q 003451          214 LITTYASNGRYREAVMVFKKMEEEGCKPTLITYNVILNVYGKMGMPWNKIMALVEGMKSAGVKPDSYTFNTLISCCRRGS  293 (819)
Q Consensus       214 li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~ll~~~~~~g~~~~~a~~~~~~~~~~~~~p~~~~~~~ll~~~~~~g  293 (819)
                      ++.+|++.|+++.|..+|++|.    .||+.+||.+|.+|++.| ++++|.++|++|...|+.||..||++++.+|+..+
T Consensus       127 li~~~~~~g~~~~A~~~f~~m~----~~d~~~~n~li~~~~~~g-~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~  201 (857)
T PLN03077        127 MLSMFVRFGELVHAWYVFGKMP----ERDLFSWNVLVGGYAKAG-YFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIP  201 (857)
T ss_pred             HHHHHHhCCChHHHHHHHhcCC----CCCeeEHHHHHHHHHhCC-CHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCcc
Confidence            9999999999999999999996    469999999999999999 89999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHCCCCCCHHhHHHHHHHHHhCCChHHHHHHHHHHHHCCCCCCHhhHHHHHHHHHHcCCHHHHHHHHH
Q 003451          294 LHEEAAGVFEEMKLAGFSPDKVTYNALLDVYGKCRRPKEAMQVLREMKINGCLPSIVTYNSLISAYARDGLLEEAMELKT  373 (819)
Q Consensus       294 ~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~  373 (819)
                      +.+.+.+++..|.+.|+.||..+||+|+.+|++.|++++|.++|++|    ..+|.++||++|.+|++.|++++|+++|.
T Consensus       202 ~~~~~~~~~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m----~~~d~~s~n~li~~~~~~g~~~eAl~lf~  277 (857)
T PLN03077        202 DLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRM----PRRDCISWNAMISGYFENGECLEGLELFF  277 (857)
T ss_pred             chhhHHHHHHHHHHcCCCcccchHhHHHHHHhcCCCHHHHHHHHhcC----CCCCcchhHHHHHHHHhCCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999    45799999999999999999999999999


Q ss_pred             HHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHhhCCCCCC
Q 003451          374 QMVEIGITPDVFTYTTLLSGFEKAGKDESAMKVFEEMRSAGCKPNICTFNALIKMHGNRGNFVEMMKVFDEINKCNCKPD  453 (819)
Q Consensus       374 ~m~~~g~~pd~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~  453 (819)
                      +|.+.|+.||..||+.++.+|++.|+.+.|.+++..|.+.|+.||..+|++++.+|++.|++++|.++|++|.    .||
T Consensus       278 ~M~~~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~----~~d  353 (857)
T PLN03077        278 TMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRME----TKD  353 (857)
T ss_pred             HHHHcCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCC----CCC
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999987    578


Q ss_pred             HHHHHHHHHHHHhcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q 003451          454 IVTWNTLLAVFGQNGMDSEVSGVFKEMKRAGFIPERDTFNTLISAYSRCGSFDQAMSIYKRMLEAGVTPDLSTYNAVLAA  533 (819)
Q Consensus       454 ~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~  533 (819)
                      ..+|+.++.+|++.|++++|.++|++|.+.|+.||..||+.++.+|++.|+++.|.++++.|.+.|+.++..+|+.|+.+
T Consensus       354 ~~s~n~li~~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~  433 (857)
T PLN03077        354 AVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEM  433 (857)
T ss_pred             eeeHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHhcCCCHHHH
Q 003451          534 LARGGMWEQSEKIFAEMKGGRCKPNELTYSSLLHAYANGREIDQMLALSEEIYSGIIEPHAVLLKTLILVYSKSDLLMDT  613 (819)
Q Consensus       534 ~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a  613 (819)
                      |++.|++++|.++|++|.+    +|..+|+.++.+|++.|+.++|+.+|++|.. ++.|+..++..++.+|++.|+++.+
T Consensus       434 y~k~g~~~~A~~vf~~m~~----~d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~  508 (857)
T PLN03077        434 YSKCKCIDKALEVFHNIPE----KDVISWTSIIAGLRLNNRCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCG  508 (857)
T ss_pred             HHHcCCHHHHHHHHHhCCC----CCeeeHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHh
Confidence            9999999999999999974    5788999999999999999999999999986 4899999999999999999999999


Q ss_pred             HHHHHHHHHcCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHhhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHC
Q 003451          614 ERAFLELKKKGFSPDIPTLNAMISIYGRRQMVAKTNEILHFMNDSGFTPSLTTYNTLMYMYSRSENFARAEDVLREILAK  693 (819)
Q Consensus       614 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~  693 (819)
                      .+++..+.+.|+.+|..+++.|+++|++.|++++|.++|+.+     .+|..+|++++.+|++.|+.++|.++|++|.+.
T Consensus       509 ~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-----~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~  583 (857)
T PLN03077        509 KEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSH-----EKDVVSWNILLTGYVAHGKGSMAVELFNRMVES  583 (857)
T ss_pred             HHHHHHHHHhCCCccceechHHHHHHHHcCCHHHHHHHHHhc-----CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHc
Confidence            999999999999999999999999999999999999999987     589999999999999999999999999999999


Q ss_pred             CCCCCHhHHHHHHHHHHhcCCHHHHHHHHHHHH-HCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCCHHHH
Q 003451          694 GIKPDIISYNTVIFAYCRNGRMKEASRIFSEMR-DSGLVPDVITYNTFVASYAADSLFVEALDVVRYMIKQGCKPNQNTY  772 (819)
Q Consensus       694 ~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~-~~g~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~p~~~~~  772 (819)
                      |+.||..+|+.++.+|++.|++++|.++|++|. +.|+.|+..+|+.++.+|++.|++++|.+++++|.   ++||..+|
T Consensus       584 g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m~---~~pd~~~~  660 (857)
T PLN03077        584 GVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMP---ITPDPAVW  660 (857)
T ss_pred             CCCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHCC---CCCCHHHH
Confidence            999999999999999999999999999999999 67999999999999999999999999999999983   78999999


Q ss_pred             HHHHHHHHhcCCHhHHHHHHHHhhhcCCCCCHHHHHHHHHHHHh
Q 003451          773 NSIVDGYCKLNQRYEAITFVNNLSKLDPHVTKELECKLSDRIAK  816 (819)
Q Consensus       773 ~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~~l~~~l~~  816 (819)
                      ..|+.+|...|+.+.|....+++.+++|++. ..|..|...+++
T Consensus       661 ~aLl~ac~~~~~~e~~e~~a~~l~~l~p~~~-~~y~ll~n~ya~  703 (857)
T PLN03077        661 GALLNACRIHRHVELGELAAQHIFELDPNSV-GYYILLCNLYAD  703 (857)
T ss_pred             HHHHHHHHHcCChHHHHHHHHHHHhhCCCCc-chHHHHHHHHHH
Confidence            9999999999999999999999999999864 445555555543

>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0403 consensus Neoplastic transformation suppressor Pdcd4/MA-3, contains MA3 domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5178 PRP8 U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query819
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-25
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-21
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-20
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-20
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score =  111 bits (276), Expect = 4e-25
 Identities = 34/209 (16%), Positives = 66/209 (31%), Gaps = 4/209 (1%)

Query: 265 ALVEGMKSAGVKPDSYTFNTLISCCRRGSLHEEAAGVFEEMKLAGFSPDKVTYNALLDVY 324
            L +  + A   P       L+         +       +   A  S  +    A     
Sbjct: 78  CLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCC 137

Query: 325 GKCRRPKEAMQVL---REMKINGCLPSIVTYNSLISAYARDGLLEEAMELKTQMVEIGIT 381
               +   A  +L      +    L ++  YN+++  +AR G  +E + +   + + G+T
Sbjct: 138 LLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLT 197

Query: 382 PDVFTYTTLLSGFEKAGKD-ESAMKVFEEMRSAGCKPNICTFNALIKMHGNRGNFVEMMK 440
           PD+ +Y   L    +  +D  +  +  E+M   G K        L+           + K
Sbjct: 198 PDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHK 257

Query: 441 VFDEINKCNCKPDIVTWNTLLAVFGQNGM 469
           V    +     P  V  + LL        
Sbjct: 258 VKPTFSLPPQLPPPVNTSKLLRDVYAKDG 286
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query819
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.97
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.93
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.91
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.89
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.88
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.88
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.87
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.87
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.86
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.82
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.82
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.82
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.81
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.8
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.78
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.76
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.76
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.75
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.75
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.75
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.74
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.74
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.73
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.73
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.72
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.72
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.7
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.66
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.66
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.65
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.64
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.64
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.62
3u4t_A272 TPR repeat-containing protein; structural genomics 99.62
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.62
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.59
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.59
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.59
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.58
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.58
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.57
3u4t_A272 TPR repeat-containing protein; structural genomics 99.56
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.56
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.55
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.53
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.53
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.52
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.52
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.51
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.5
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.49
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.48
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.48
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.47
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.47
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.47
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.45
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.44
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.42
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.39
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.38
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.38
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.37
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.36
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.36
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.36
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.35
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.32
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.31
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.29
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.28
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.24
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.23
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.22
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.18
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.18
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.17
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.17
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.16
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.16
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.13
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.12
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.1
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.09
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.08
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.05
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.03
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.02
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.02
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.01
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.01
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.01
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.0
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.99
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.99
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.99
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.99
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.97
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.96
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.94
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.94
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.93
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.92
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.91
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.91
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.89
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.86
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.84
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.84
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.82
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.8
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.79
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.79
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.79
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.77
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.76
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.74
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.73
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.71
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.7
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.69
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.67
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.67
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.66
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.66
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.65
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.64
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.64
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.62
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.61
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.61
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.61
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.59
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.59
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.59
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.59
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.58
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.58
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.57
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.57
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.56
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.56
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.54
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.54
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.54
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.52
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.51
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.51
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.5
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.49
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.46
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.46
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.44
3k9i_A117 BH0479 protein; putative protein binding protein, 98.44
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.44
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.44
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.42
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.39
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.39
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.39
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.37
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.37
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.36
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.34
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.34
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.34
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.32
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.31
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.3
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.28
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.22
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.2
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.18
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.18
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.16
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.16
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.16
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.14
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.14
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.13
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.09
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.08
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.08
3k9i_A117 BH0479 protein; putative protein binding protein, 98.08
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.07
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.05
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.04
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.97
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.96
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.95
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.91
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.85
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.81
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.74
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.73
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.69
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.69
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.65
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.59
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.54
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.47
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.47
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.41
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.38
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.3
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.17
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.14
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.07
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.99
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.99
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.9
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.88
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.88
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.79
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.74
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.64
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.61
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.35
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.3
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.98
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.97
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.81
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.53
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.51
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.4
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.22
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.73
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.48
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 94.33
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 93.56
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.48
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.08
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 92.97
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 92.93
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 92.3
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.14
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 91.0
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 90.26
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 89.44
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 89.3
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 88.81
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 88.12
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 87.24
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 86.87
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 86.46
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 86.39
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 85.56
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 85.05
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 84.91
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 84.59
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 83.82
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 83.76
2p58_C116 Putative type III secretion protein YSCG; type III 82.71
2uwj_G115 Type III export protein PSCG; virulence, chaperone 80.77
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 80.75
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 80.04
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=1.3e-39  Score=366.83  Aligned_cols=513  Identities=11%  Similarity=-0.000  Sum_probs=304.2

Q ss_pred             HHhcCChHHHHHHHHHHhhCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCCHHH
Q 003451          183 LGKEGKVSVAASLLHGLHKDGFDIDVYAYTSLITTYASNGRYREAVMVFKKMEEEGCKPTLITYNVILNVYGKMGMPWNK  262 (819)
Q Consensus       183 ~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~ll~~~~~~g~~~~~  262 (819)
                      ..+.|.+..+...+..+.    .++...|+.++..|.+.|++++|+.+|++|.+.  .|+..++..++.+|.+.| ++++
T Consensus        63 ~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~p~~~~~~~l~~~~~~~g-~~~~  135 (597)
T 2xpi_A           63 TSTDGSFLKERNAQNTDS----LSREDYLRLWRHDALMQQQYKCAAFVGEKVLDI--TGNPNDAFWLAQVYCCTG-DYAR  135 (597)
T ss_dssp             -----------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--HCCHHHHHHHHHHHHHTT-CHHH
T ss_pred             ccccCccCCCCCccccch----HHHHHHHHHHHHHHHHccCchHHHHHHHHHHhh--CCCchHHHHHHHHHHHcC-cHHH
Confidence            445566666655555443    236778888888888888888888888888754  457777888888888888 7888


Q ss_pred             HHHHHHHHHhCCCCCCHHHHHHHHHHHHcCCCHHHHHHHHHHHHHCCCCCCHHhHHHHHHHHHhCCChHHHHHHHHHHHH
Q 003451          263 IMALVEGMKSAGVKPDSYTFNTLISCCRRGSLHEEAAGVFEEMKLAGFSPDKVTYNALLDVYGKCRRPKEAMQVLREMKI  342 (819)
Q Consensus       263 a~~~~~~~~~~~~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~  342 (819)
                      |..+|+++...  .++..+++.++.+|.+.|++++|.++|+++..     +..    ....+.+.++           ..
T Consensus       136 A~~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~-----~~~----~~~~~~~~~~-----------~~  193 (597)
T 2xpi_A          136 AKCLLTKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNP-----FRK----DEKNANKLLM-----------QD  193 (597)
T ss_dssp             HHHHHHHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCT-----TC--------------C-----------CC
T ss_pred             HHHHHHHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCC-----ccc----cccccccccc-----------cc
Confidence            88888776532  45667777777777777777777777764211     110    0001111110           11


Q ss_pred             CCCCCCHhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHH--HH-HHHHHHCCCCCCH
Q 003451          343 NGCLPSIVTYNSLISAYARDGLLEEAMELKTQMVEIGITPDVFTYTTLLSGFEKAGKDESAM--KV-FEEMRSAGCKPNI  419 (819)
Q Consensus       343 ~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~pd~~~~~~l~~~~~~~g~~~~A~--~~-~~~~~~~~~~~~~  419 (819)
                      .|...+..+|+.++.+|.+.|++++|+++|++|.+.+.. +...+..+...+...+..+.+.  .+ +..+...+.....
T Consensus       194 ~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~-~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~  272 (597)
T 2xpi_A          194 GGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAK-CYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLR  272 (597)
T ss_dssp             SSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHH
T ss_pred             cccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCch-hhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHH
Confidence            234456778888888888888888888888888876422 4445555544433322222111  11 3333333333344


Q ss_pred             HHHHHHHHHHHccCCHHHHHHHHHHHhhCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
Q 003451          420 CTFNALIKMHGNRGNFVEMMKVFDEINKCNCKPDIVTWNTLLAVFGQNGMDSEVSGVFKEMKRAGFIPERDTFNTLISAY  499 (819)
Q Consensus       420 ~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~~~~l~~~~  499 (819)
                      .+|+.++..|.+.|++++|.++|+++.+.  +++..+|+.++..|.+.|++++|.++|+++.+.+.. +..++..++.++
T Consensus       273 ~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~-~~~~~~~l~~~~  349 (597)
T 2xpi_A          273 SLYMLKLNKTSHEDELRRAEDYLSSINGL--EKSSDLLLCKADTLFVRSRFIDVLAITTKILEIDPY-NLDVYPLHLASL  349 (597)
T ss_dssp             HHHHTTSCTTTTHHHHHHHHHHHHTSTTG--GGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CCTTHHHHHHHH
T ss_pred             HHHHHHHHHHcCcchHHHHHHHHHHhhcC--CchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcCcc-cHHHHHHHHHHH
Confidence            55666667777777777777777776654  456666666666666666666666666666655422 455566666666


Q ss_pred             HhcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHccCCHHHHH
Q 003451          500 SRCGSFDQAMSIYKRMLEAGVTPDLSTYNAVLAALARGGMWEQSEKIFAEMKGGRCKPNELTYSSLLHAYANGREIDQML  579 (819)
Q Consensus       500 ~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~l~~~~~~~~~~~~a~  579 (819)
                      .+.|++++|.++++.+.+... .+..+++.++..|.+.|++++|.++|+++.+.. +.                      
T Consensus       350 ~~~g~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~----------------------  405 (597)
T 2xpi_A          350 HESGEKNKLYLISNDLVDRHP-EKAVTWLAVGIYYLCVNKISEARRYFSKSSTMD-PQ----------------------  405 (597)
T ss_dssp             HHHTCHHHHHHHHHHHHHHCT-TSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TT----------------------
T ss_pred             HHhCCHHHHHHHHHHHHhhCc-ccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhC-CC----------------------
Confidence            666666666666666654322 245555555555555565555555555554321 11                      


Q ss_pred             HHHHHHHhCCCCCCHHHHHHHHHHHhcCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHhhCC
Q 003451          580 ALSEEIYSGIIEPHAVLLKTLILVYSKSDLLMDTERAFLELKKKGFSPDIPTLNAMISIYGRRQMVAKTNEILHFMNDSG  659 (819)
Q Consensus       580 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~  659 (819)
                                                                      +..+|+.++.+|.+.|++++|+++|+++.+.+
T Consensus       406 ------------------------------------------------~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~  437 (597)
T 2xpi_A          406 ------------------------------------------------FGPAWIGFAHSFAIEGEHDQAISAYTTAARLF  437 (597)
T ss_dssp             ------------------------------------------------CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT
T ss_pred             ------------------------------------------------CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC
Confidence                                                            33344444444555555555555555554432


Q ss_pred             CCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHhHHHHHHHHHHhcCCHHHHHHHHHHHHHC----CCCCC--
Q 003451          660 FTPSLTTYNTLMYMYSRSENFARAEDVLREILAKGIKPDIISYNTVIFAYCRNGRMKEASRIFSEMRDS----GLVPD--  733 (819)
Q Consensus       660 ~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~----g~~p~--  733 (819)
                       +.+..+|..++.+|.+.|++++|.++|+++.+.. +.+..+|+.++.+|.+.|++++|.++|+++.+.    +..|+  
T Consensus       438 -~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~  515 (597)
T 2xpi_A          438 -QGTHLPYLFLGMQHMQLGNILLANEYLQSSYALF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPW  515 (597)
T ss_dssp             -TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGG
T ss_pred             -ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhH
Confidence             3345566666666666666666666666666542 225666666667777777777777777666654    45565  


Q ss_pred             HHHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHhHHHHHHHHhhhcCCCCC
Q 003451          734 VITYNTFVASYAADSLFVEALDVVRYMIKQGCKPNQNTYNSIVDGYCKLNQRYEAITFVNNLSKLDPHVT  803 (819)
Q Consensus       734 ~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~  803 (819)
                      ..+|..++.+|.+.|++++|+++++++.+.+ ..+..+|..++.+|.+.|++++|.+.++++.+++|+++
T Consensus       516 ~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p~~~  584 (597)
T 2xpi_A          516 AATWANLGHAYRKLKMYDAAIDALNQGLLLS-TNDANVHTAIALVYLHKKIPGLAITHLHESLAISPNEI  584 (597)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHS-SCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCH
T ss_pred             HHHHHHHHHHHHHhcCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCCCh
Confidence            5677777777777777777777777777642 22667777777777777777777777777777777663
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 819
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-08
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.002
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 0.001
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 55.4 bits (132), Expect = 1e-08
 Identities = 46/343 (13%), Positives = 112/343 (32%), Gaps = 14/343 (4%)

Query: 207 DVYAYTSLITTYASNGRYREAVMVFKKMEEEGCKPTLITYNVILNVYGKMGMPWNKIMAL 266
           +      L + +    R   +        ++   P L       +  G +     ++   
Sbjct: 32  NTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQ--NPLLAEA---YSNLGNVYKERGQLQEA 86

Query: 267 VEGMKSAGVKPDSYTFNTLISCCRRGSLHEEAAGVFEEMKLAGFSPDKVTYNALLDVYGK 326
           +E  + A      +    +       +  +    V   +    ++PD     + L    K
Sbjct: 87  IEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLK 146

Query: 327 CRRPKEAMQVLREMKINGCLPSIVTYNSLISAYARDGLLEEAMELKTQMVEIGITPD-VF 385
                E  +      I       V +++L   +   G +  A+    + V +   P+ + 
Sbjct: 147 ALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD--PNFLD 204

Query: 386 TYTTLLSGFEKAGKDESAMKVFEEMRSAGCKPNICTFNALIKMHGNRGNFVEMMKVFDEI 445
            Y  L +  ++A   + A+  +    S      +   N L  ++  +G     +  +   
Sbjct: 205 AYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGN-LACVYYEQGLIDLAIDTYRRA 263

Query: 446 NKCNCKPDIVTWNTLLAVFGQNGMDSEVSGVFKEMKRAGFIPERDTFNTLISAYSRCGSF 505
            +         +  L     + G  +E    +    R       D+ N L +     G+ 
Sbjct: 264 IELQPH-FPDAYCNLANALKEKGSVAEAEDCYNTALR-LCPTHADSLNNLANIKREQGNI 321

Query: 506 DQAMSIYKRMLEAGVTPDLSTYNAVLA-ALARGGMWEQSEKIF 547
           ++A+ +Y++ LE  V P+ +  ++ LA  L + G  +++   +
Sbjct: 322 EEAVRLYRKALE--VFPEFAAAHSNLASVLQQQGKLQEALMHY 362
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query819
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.92
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.92
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.61
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.57
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.26
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.24
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.21
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.2
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.18
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.13
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.11
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.04
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.03
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.93
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.85
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.82
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.73
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.7
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.67
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.65
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.64
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.64
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.61
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.6
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.53
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.52
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.47
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.46
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.46
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.44
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.29
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.29
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.28
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.21
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.17
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.17
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.14
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.14
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.07
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.04
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.01
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.98
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.97
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.86
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.86
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.83
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.78
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.76
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.62
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.55
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.41
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.38
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.32
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.23
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.22
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.64
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.56
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.14
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.75
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.34
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 93.07
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 90.42
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 83.79
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.92  E-value=2.5e-21  Score=201.86  Aligned_cols=375  Identities=11%  Similarity=0.055  Sum_probs=230.9

Q ss_pred             HccCCHHHHHHHHHHHhhCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCChHHHH
Q 003451          430 GNRGNFVEMMKVFDEINKCNCKPDIVTWNTLLAVFGQNGMDSEVSGVFKEMKRAGFIPERDTFNTLISAYSRCGSFDQAM  509 (819)
Q Consensus       430 ~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~~~~l~~~~~~~g~~~~A~  509 (819)
                      .+.|++++|.+.++++.+.. +-+...+..+...|.+.|++++|...+++..+... -+..++..+...|...|++++|.
T Consensus        10 ~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p-~~~~a~~~l~~~~~~~g~~~~A~   87 (388)
T d1w3ba_          10 YQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNP-LLAEAYSNLGNVYKERGQLQEAI   87 (388)
T ss_dssp             HHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHHTCHHHHH
T ss_pred             HHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCC-CCHHHHHHHHHHhhhhccccccc
Confidence            33444444444444443321 22334444444444444444444444444444321 13344555555555555555555


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHHhCC
Q 003451          510 SIYKRMLEAGVTPDLSTYNAVLAALARGGMWEQSEKIFAEMKGGRCKPNELTYSSLLHAYANGREIDQMLALSEEIYSGI  589 (819)
Q Consensus       510 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~  589 (819)
                      +.+..+.+.... +..............+....+........... .................+....+...+.+.....
T Consensus        88 ~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (388)
T d1w3ba_          88 EHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYN-PDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ  165 (388)
T ss_dssp             HHHHHHHHHCTT-CHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHC-TTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC
T ss_pred             cccccccccccc-cccccccccccccccccccccccccccccccc-cccccccccccccccccchhhhhHHHHHHhhccC
Confidence            555555544322 23333333333333333333333333333221 2233333334444555555666665555555432


Q ss_pred             CCCCHHHHHHHHHHHhcCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHhhCCCCCCHHHHHH
Q 003451          590 IEPHAVLLKTLILVYSKSDLLMDTERAFLELKKKGFSPDIPTLNAMISIYGRRQMVAKTNEILHFMNDSGFTPSLTTYNT  669 (819)
Q Consensus       590 ~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~p~~~~~~~  669 (819)
                       +.....+..++..+...|++++|...+++..+.. +.+...+..+...+...|++++|...++...... +.+...+..
T Consensus       166 -~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~  242 (388)
T d1w3ba_         166 -PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHAVVHGN  242 (388)
T ss_dssp             -TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCHHHHHH
T ss_pred             -cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhHHHHHHH
Confidence             3445566666677777777777777777776653 2256677777888888888888888888877654 456667777


Q ss_pred             HHHHHHhcCCHHHHHHHHHHHHHCCCCCCHhHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCC
Q 003451          670 LMYMYSRSENFARAEDVLREILAKGIKPDIISYNTVIFAYCRNGRMKEASRIFSEMRDSGLVPDVITYNTFVASYAADSL  749 (819)
Q Consensus       670 l~~~~~~~g~~~~A~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~g~~p~~~~~~~l~~~~~~~g~  749 (819)
                      ++..+.+.|++++|+..|+++++.. +-+..+|..++..+...|++++|.+.++..... ...+...+..++..+...|+
T Consensus       243 l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~-~~~~~~~~~~l~~~~~~~~~  320 (388)
T d1w3ba_         243 LACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTALRL-CPTHADSLNNLANIKREQGN  320 (388)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHH-CTTCHHHHHHHHHHHHTTTC
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhcc-CCccchhhhHHHHHHHHCCC
Confidence            8888888888888888888888753 224777888888888888888888888887774 23466677788888888888


Q ss_pred             hHHHHHHHHHHHHcCCCC-CHHHHHHHHHHHHhcCCHhHHHHHHHHhhhcCCCCCHHHHHHHHHHHHh
Q 003451          750 FVEALDVVRYMIKQGCKP-NQNTYNSIVDGYCKLNQRYEAITFVNNLSKLDPHVTKELECKLSDRIAK  816 (819)
Q Consensus       750 ~~~A~~~~~~~~~~~~~p-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~~l~~~l~~  816 (819)
                      +++|++.++++++  +.| +..++..++.+|.+.|++++|++.++++++++|++.. .|..|...+.+
T Consensus       321 ~~~A~~~~~~al~--~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~-a~~~lg~~~~~  385 (388)
T d1w3ba_         321 IEEAVRLYRKALE--VFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFAD-AYSNMGNTLKE  385 (388)
T ss_dssp             HHHHHHHHHHHTT--SCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHH-HHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHH-HHHHHHHHHHH
Confidence            8888888888887  456 5677888888888888888888888888888887744 44555555543
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure