Citrus Sinensis ID: 003455
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 818 | ||||||
| 225423909 | 827 | PREDICTED: uncharacterized protein LOC10 | 0.819 | 0.810 | 0.802 | 0.0 | |
| 224111730 | 796 | predicted protein [Populus trichocarpa] | 0.792 | 0.814 | 0.806 | 0.0 | |
| 297737854 | 815 | unnamed protein product [Vitis vinifera] | 0.805 | 0.808 | 0.790 | 0.0 | |
| 356502460 | 879 | PREDICTED: uncharacterized protein LOC10 | 0.794 | 0.739 | 0.727 | 0.0 | |
| 449434652 | 858 | PREDICTED: mediator of RNA polymerase II | 0.788 | 0.751 | 0.725 | 0.0 | |
| 312283021 | 852 | unnamed protein product [Thellungiella h | 0.789 | 0.758 | 0.661 | 0.0 | |
| 30689268 | 836 | phytochrome and flowering time regulator | 0.793 | 0.776 | 0.651 | 0.0 | |
| 297845606 | 832 | hypothetical protein ARALYDRAFT_472815 [ | 0.793 | 0.780 | 0.656 | 0.0 | |
| 255576521 | 561 | conserved hypothetical protein [Ricinus | 0.645 | 0.941 | 0.779 | 0.0 | |
| 123979422 | 759 | phytochrome and flowering time protein 1 | 0.770 | 0.830 | 0.592 | 0.0 |
| >gi|225423909|ref|XP_002278845.1| PREDICTED: uncharacterized protein LOC100259509 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1042 bits (2695), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 542/675 (80%), Positives = 596/675 (88%), Gaps = 5/675 (0%)
Query: 6 YAYSKLSLYFH---RCFCVNELAGQKTSASNVELSLVTFNTHGSYCACLVQRSGWTKDVD 62
Y + +S Y R FC NELAGQK S+SN ELSLV FN HGSYC+CLVQRSGWT+DVD
Sbjct: 19 YWQAVVSDYLDKIIRYFCGNELAGQKPSSSNFELSLVMFNAHGSYCSCLVQRSGWTRDVD 78
Query: 63 IFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQQNVDGQRHCILVAASNPH 122
+FL WLS +PFAGGGFNDAAIAEGL+EALMMFSVA NGSQ QQNVDGQRHCILVAA+NP+
Sbjct: 79 LFLQWLSALPFAGGGFNDAAIAEGLAEALMMFSVAANGSQTQQNVDGQRHCILVAANNPY 138
Query: 123 PLPTPVYRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQCSVSLSVICPKQLPKLTAIY 182
PLPTPVY+PQMQN++QNE+ E+Q ESRLSDAE VAKSF QCSVSLSVICPKQLPKL +IY
Sbjct: 139 PLPTPVYQPQMQNMEQNESIESQTESRLSDAEAVAKSFAQCSVSLSVICPKQLPKLKSIY 198
Query: 183 NAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSRPGVANLAPNQNPVKMDIAPVT 242
NA KRNPR ADPPVDN KNPHFLVLIS++FMEARAALSRPG++N+ NQ+PVKMDIA V
Sbjct: 199 NAGKRNPRVADPPVDNVKNPHFLVLISDSFMEARAALSRPGLSNMTANQSPVKMDIASVP 258
Query: 243 SVTGPAPTSIPSVNGI-NRPPISVGNVPTATVKVEPSTVTSMVNGPTFPHIPSVPRPASQ 301
V+ P SIPSVNGI NRP I+VG VPTATVKVEPSTVTS+ +GP FPHIPSVPR ASQ
Sbjct: 259 QVSAAPPASIPSVNGIMNRPTIAVGAVPTATVKVEPSTVTSITSGPGFPHIPSVPRAASQ 318
Query: 302 GVPSLQTSSPSSTSQEMITSGDSVPEVKPLVSGMSQPLRPMAPAAANVNILNNLSQARQV 361
GVPSLQTSSPSSTSQEMI++GD+V ++KP+VSG+SQ LRP+ PAAANV+ILNNLSQARQV
Sbjct: 319 GVPSLQTSSPSSTSQEMISNGDNVQDLKPIVSGISQTLRPVVPAAANVSILNNLSQARQV 378
Query: 362 MNNAALTGGTSIGLQSMGQTPMAMHMSNMISSGMASSVPTSQPVFSSAQSGITSIGGSGT 421
M++AAL+GGTSIGLQSMG T MAMHMSNMISSGMASSVP +Q VFSS QS ++SI GSGT
Sbjct: 379 MHSAALSGGTSIGLQSMGGTSMAMHMSNMISSGMASSVPATQTVFSSGQSAVSSITGSGT 438
Query: 422 LTGTSQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGTLQGGASMGQSV-GMSQGNHSGGQ 480
L GT+QV QNS L SFTSA SN+S NSN ISQP+ LQGG SMGQ+V GMSQGN GGQ
Sbjct: 439 LAGTAQVAQNSALGSFTSATSNMSVNSNLGISQPLSNLQGGVSMGQTVPGMSQGNLPGGQ 498
Query: 481 MVQNGISMNQNMMSGLGPSGVSSGTGTMIPTPGMSQQAQSGMQPLSVNNNTAVNMQLSQQ 540
MVQ+GI MNQNMMSGLGPSG+SSGTGTMIPTPGMSQQ Q GM L VNNN A NM L QQ
Sbjct: 499 MVQSGIGMNQNMMSGLGPSGISSGTGTMIPTPGMSQQVQPGMPSLGVNNNAAANMPLPQQ 558
Query: 541 TSSALHSSQSKYVKVWEGSLSGQRQGQPVFITKLEGYRSASASETLAANWPPTMQIVRLI 600
TS A+ ++QSKYVKVWEG+LSGQRQGQPVFIT+LEGYRSASASE+LAANWP TMQIVRLI
Sbjct: 559 TSGAMQTAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASESLAANWPATMQIVRLI 618
Query: 601 SQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIG 660
SQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIG
Sbjct: 619 SQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIG 678
Query: 661 MLFPGDMVVFKPQIS 675
MLFPGDMVVFKPQI+
Sbjct: 679 MLFPGDMVVFKPQIT 693
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224111730|ref|XP_002315956.1| predicted protein [Populus trichocarpa] gi|222864996|gb|EEF02127.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297737854|emb|CBI27055.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356502460|ref|XP_003520037.1| PREDICTED: uncharacterized protein LOC100801664 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449434652|ref|XP_004135110.1| PREDICTED: mediator of RNA polymerase II transcription subunit 25-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|312283021|dbj|BAJ34376.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|30689268|ref|NP_173925.3| phytochrome and flowering time regulatory protein 1 [Arabidopsis thaliana] gi|75145501|sp|Q7XYY2.1|MED25_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 25; Short=AtMED25; AltName: Full=Phytochrome and flowering time 1 protein; AltName: Full=Phytochrome and flowering time regulatory protein 1 gi|32478899|gb|AAO39425.1| phytochrome and flowering time 1 protein [Arabidopsis thaliana] gi|332192518|gb|AEE30639.1| phytochrome and flowering time regulatory protein 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297845606|ref|XP_002890684.1| hypothetical protein ARALYDRAFT_472815 [Arabidopsis lyrata subsp. lyrata] gi|297336526|gb|EFH66943.1| hypothetical protein ARALYDRAFT_472815 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|255576521|ref|XP_002529152.1| conserved hypothetical protein [Ricinus communis] gi|223531431|gb|EEF33265.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|123979422|gb|ABM81545.1| phytochrome and flowering time protein 1 [Triticum aestivum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 818 | ||||||
| TAIR|locus:2031200 | 836 | PFT1 "PHYTOCHROME AND FLOWERIN | 0.775 | 0.758 | 0.611 | 1.3e-206 | |
| UNIPROTKB|F1N3D4 | 743 | MED25 "Mediator of RNA polymer | 0.106 | 0.117 | 0.372 | 2.5e-08 | |
| UNIPROTKB|F1RHT9 | 746 | MED25 "Uncharacterized protein | 0.106 | 0.116 | 0.372 | 7.3e-08 | |
| MGI|MGI:1922863 | 745 | Med25 "mediator of RNA polymer | 0.106 | 0.116 | 0.372 | 7.9e-08 | |
| UNIPROTKB|A2VE44 | 746 | MED25 "Mediator of RNA polymer | 0.106 | 0.116 | 0.372 | 8e-08 | |
| UNIPROTKB|Q71SY5 | 747 | MED25 "Mediator of RNA polymer | 0.106 | 0.116 | 0.372 | 3.2e-06 | |
| ZFIN|ZDB-GENE-040426-2850 | 701 | med25 "mediator of RNA polymer | 0.106 | 0.124 | 0.351 | 6.4e-06 | |
| WB|WBGene00019435 | 2232 | K06A9.1 [Caenorhabditis elegan | 0.392 | 0.143 | 0.219 | 1.2e-05 | |
| DICTYBASE|DDB_G0286967 | 1553 | med25 "putative mediator compl | 0.100 | 0.052 | 0.3 | 2.2e-05 | |
| POMBASE|SPAPB1E7.04c | 1236 | SPAPB1E7.04c "chitinase (predi | 0.360 | 0.238 | 0.212 | 3.4e-05 |
| TAIR|locus:2031200 PFT1 "PHYTOCHROME AND FLOWERING TIME 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1958 (694.3 bits), Expect = 1.3e-206, Sum P(2) = 1.3e-206
Identities = 405/662 (61%), Positives = 486/662 (73%)
Query: 17 RCFCVNELAGQKTSASNVELSLVTFNTHGSYCACLVQRSGWTKDVDIFLHWLSTIPFAGG 76
R FC +EL G++ S VELSLV FN+HGSYCACLVQRSGWT+DVDIFLHWLS+I F GG
Sbjct: 35 RSFCGSELNGERNPVSTVELSLVIFNSHGSYCACLVQRSGWTRDVDIFLHWLSSIQFGGG 94
Query: 77 GFNDAAIAEGLSEALMMFSVAPNGSQNQQNVDGQRHCILVAASNPHPLPTPVYRPQMQNL 136
GFN+ A AEGL+EALMMFS P+G Q Q + D +RHCIL+ ASNPH LPTPVYRP++QN+
Sbjct: 95 GFNEVATAEGLAEALMMFS-PPSG-QAQPSNDLKRHCILITASNPHILPTPVYRPRLQNV 152
Query: 137 DQNENNEAQAESRLSDAETVAKSFVQCSVSLSVICPKQLPKLTAIYNAAKRNPRAADPPV 196
++NEN +AQAESRLSDAETVA F +CSVSLSV+CPKQLP + A+YNA K N ++AD +
Sbjct: 153 ERNENGDAQAESRLSDAETVASYFAKCSVSLSVVCPKQLPTIRALYNAGKPNQQSADLSI 212
Query: 197 DNSKNPHFLVLISENFMEARAALSRPGVANLAPNQNPVKMD---IAPVTSVTGPAPTSIP 253
D +KN +LVLISENF+EA AALS NL Q+PVK+D +AP VTG P +
Sbjct: 213 DTAKNTFYLVLISENFVEACAALSH-SATNLPQTQSPVKVDRATVAPSIPVTGQPPAPVS 271
Query: 254 SVNGI--NRPPISVGNVPTATVKVEPSTVTSMVNGPTFPHIPSVPRPASQGVXXXXXXXX 311
S NG NR P+SVG VPTATVKVEPSTVTSM P+FPHIP+V RPA+Q +
Sbjct: 272 SANGPIQNRQPVSVGPVPTATVKVEPSTVTSMAPVPSFPHIPAVARPATQAIPSIQTSSA 331
Query: 312 XXXXXEMITSGDSVPEVKPLVSGMSQPLRPMAPAAANVNILNNLSQARQVMN--NAALTG 369
+M+++ ++ P++KP+V P P N+ N L+ QV ++A
Sbjct: 332 SPVSQDMVSNAENAPDIKPVVVSGMTPPLRTGPPGG-ANV-NLLNNLSQVRQVMSSAALA 389
Query: 370 GTSIGLQSMGQTPMAMHMSNMISSGMASSVPTSQPVFSSAQXXXXXXXXXXXXXXXXQVP 429
G + S+GQ+ +AMHMSNMIS+GMA+S+P SQ VFS+ Q Q
Sbjct: 390 GAA---SSVGQSAVAMHMSNMISTGMATSLPPSQTVFSTGQQGITSMAGSGALMGSAQTG 446
Query: 430 QNSGLNSFTSAPSNLSGNSNPSISQPMGTLQGGASMGQSVGMSQGNHSGGQMVQNGISMN 489
Q+ G N+ S + + SN +SQPM GM+QG+HSG M+Q GISMN
Sbjct: 447 QSPGPNNAFSPQTTSNVASNLGVSQPMQ------------GMNQGSHSGA-MMQGGISMN 493
Query: 490 QNMMSGLGPSGVSSGTGTMIPTPGMSQQAQSGMQPLSVNNNTAVNMQLSQQTSSALHSSQ 549
QNMMSGLG VSSGTG M+PTPG+ QQAQSG+Q L +N++A NMQLSQ +S A+ +SQ
Sbjct: 494 QNMMSGLGQGNVSSGTGGMMPTPGVGQQAQSGIQQLGGSNSSAPNMQLSQPSSGAMQTSQ 553
Query: 550 SKYVKVWEGSLSGQRQGQPVFITKLEGYRSASASETLAANWPPTMQIVRLISQDHMNNKQ 609
SKYVKVWEG+LSGQRQGQPV IT+LEGYRSASAS++LAANWPPTMQIVRLISQDHMNNKQ
Sbjct: 554 SKYVKVWEGNLSGQRQGQPVLITRLEGYRSASASDSLAANWPPTMQIVRLISQDHMNNKQ 613
Query: 610 YVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVV 669
YVGKADFLVFRAM+QHGFLGQLQ+KKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVV
Sbjct: 614 YVGKADFLVFRAMSQHGFLGQLQDKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVV 673
Query: 670 FK 671
FK
Sbjct: 674 FK 675
|
|
| UNIPROTKB|F1N3D4 MED25 "Mediator of RNA polymerase II transcription subunit 25" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RHT9 MED25 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1922863 Med25 "mediator of RNA polymerase II transcription, subunit 25 homolog (yeast)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A2VE44 MED25 "Mediator of RNA polymerase II transcription subunit 25" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q71SY5 MED25 "Mediator of RNA polymerase II transcription subunit 25" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2850 med25 "mediator of RNA polymerase II transcription, subunit 25 homolog (yeast)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00019435 K06A9.1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0286967 med25 "putative mediator complex subunit 25" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAPB1E7.04c SPAPB1E7.04c "chitinase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 818 | |||
| pfam11265 | 226 | pfam11265, Med25_VWA, Mediator complex subunit 25 | 5e-52 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 6e-16 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 5e-15 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 1e-14 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 2e-14 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 3e-14 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 5e-14 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 2e-13 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 2e-13 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 1e-12 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 4e-11 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 8e-11 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 8e-11 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 8e-11 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 5e-10 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 1e-09 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 2e-09 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 2e-09 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 4e-09 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 4e-09 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 7e-09 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 8e-09 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 1e-08 | |
| PRK00286 | 438 | PRK00286, xseA, exodeoxyribonuclease VII large sub | 1e-08 | |
| pfam11498 | 476 | pfam11498, Activator_LAG-3, Transcriptional activa | 1e-08 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 2e-08 | |
| PRK00286 | 438 | PRK00286, xseA, exodeoxyribonuclease VII large sub | 2e-08 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 3e-08 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 7e-08 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 1e-07 | |
| PRK00286 | 438 | PRK00286, xseA, exodeoxyribonuclease VII large sub | 1e-07 | |
| PRK00286 | 438 | PRK00286, xseA, exodeoxyribonuclease VII large sub | 1e-07 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 2e-07 | |
| PRK12757 | 256 | PRK12757, PRK12757, cell division protein FtsN; Pr | 2e-07 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 6e-07 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 6e-07 | |
| pfam04702 | 147 | pfam04702, Vicilin_N, Vicilin N terminal region | 6e-07 | |
| COG3264 | 835 | COG3264, COG3264, Small-conductance mechanosensiti | 1e-06 | |
| COG1570 | 440 | COG1570, XseA, Exonuclease VII, large subunit [DNA | 1e-06 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 2e-06 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 3e-06 | |
| COG3264 | 835 | COG3264, COG3264, Small-conductance mechanosensiti | 4e-06 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 4e-06 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 4e-06 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 4e-06 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 5e-06 | |
| pfam11498 | 476 | pfam11498, Activator_LAG-3, Transcriptional activa | 5e-06 | |
| TIGR00237 | 432 | TIGR00237, xseA, exodeoxyribonuclease VII, large s | 5e-06 | |
| PRK06800 | 228 | PRK06800, fliH, flagellar assembly protein H; Vali | 5e-06 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 6e-06 | |
| pfam11932 | 250 | pfam11932, DUF3450, Protein of unknown function (D | 6e-06 | |
| PRK10927 | 319 | PRK10927, PRK10927, essential cell division protei | 8e-06 | |
| pfam02050 | 122 | pfam02050, FliJ, Flagellar FliJ protein | 9e-06 | |
| COG1570 | 440 | COG1570, XseA, Exonuclease VII, large subunit [DNA | 1e-05 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 1e-05 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 1e-05 | |
| PRK10246 | 1047 | PRK10246, PRK10246, exonuclease subunit SbcC; Prov | 1e-05 | |
| pfam11498 | 476 | pfam11498, Activator_LAG-3, Transcriptional activa | 2e-05 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 2e-05 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 2e-05 | |
| PRK10246 | 1047 | PRK10246, PRK10246, exonuclease subunit SbcC; Prov | 2e-05 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 2e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-05 | |
| pfam03280 | 189 | pfam03280, Lipase_chap, Proteobacterial lipase cha | 2e-05 | |
| PRK12757 | 256 | PRK12757, PRK12757, cell division protein FtsN; Pr | 3e-05 | |
| COG3264 | 835 | COG3264, COG3264, Small-conductance mechanosensiti | 3e-05 | |
| PRK10927 | 319 | PRK10927, PRK10927, essential cell division protei | 3e-05 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 3e-05 | |
| PRK01294 | 336 | PRK01294, PRK01294, lipase chaperone; Provisional | 3e-05 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 4e-05 | |
| PRK10927 | 319 | PRK10927, PRK10927, essential cell division protei | 4e-05 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 4e-05 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 4e-05 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 5e-05 | |
| PRK10246 | 1047 | PRK10246, PRK10246, exonuclease subunit SbcC; Prov | 5e-05 | |
| TIGR02473 | 141 | TIGR02473, flagell_FliJ, flagellar export protein | 5e-05 | |
| pfam11068 | 131 | pfam11068, DUF2869, Protein of unknown function (D | 5e-05 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 6e-05 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 7e-05 | |
| pfam11068 | 131 | pfam11068, DUF2869, Protein of unknown function (D | 7e-05 | |
| PRK10920 | 390 | PRK10920, PRK10920, putative uroporphyrinogen III | 8e-05 | |
| COG2959 | 391 | COG2959, HemX, Uncharacterized enzyme of heme bios | 8e-05 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 9e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 9e-05 | |
| pfam03280 | 189 | pfam03280, Lipase_chap, Proteobacterial lipase cha | 9e-05 | |
| pfam12474 | 142 | pfam12474, PKK, Polo kinase kinase | 9e-05 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 1e-04 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 1e-04 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 1e-04 | |
| PRK12757 | 256 | PRK12757, PRK12757, cell division protein FtsN; Pr | 1e-04 | |
| pfam04702 | 147 | pfam04702, Vicilin_N, Vicilin N terminal region | 1e-04 | |
| pfam04702 | 147 | pfam04702, Vicilin_N, Vicilin N terminal region | 1e-04 | |
| TIGR00237 | 432 | TIGR00237, xseA, exodeoxyribonuclease VII, large s | 1e-04 | |
| pfam02050 | 122 | pfam02050, FliJ, Flagellar FliJ protein | 1e-04 | |
| pfam03280 | 189 | pfam03280, Lipase_chap, Proteobacterial lipase cha | 1e-04 | |
| TIGR02473 | 141 | TIGR02473, flagell_FliJ, flagellar export protein | 1e-04 | |
| COG1322 | 448 | COG1322, COG1322, Predicted nuclease of restrictio | 1e-04 | |
| PRK11448 | 1123 | PRK11448, hsdR, type I restriction enzyme EcoKI su | 1e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 1e-04 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 1e-04 | |
| pfam13904 | 261 | pfam13904, DUF4207, Domain of unknown function (DU | 1e-04 | |
| TIGR00237 | 432 | TIGR00237, xseA, exodeoxyribonuclease VII, large s | 2e-04 | |
| pfam11932 | 250 | pfam11932, DUF3450, Protein of unknown function (D | 2e-04 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 2e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 2e-04 | |
| COG3166 | 206 | COG3166, PilN, Tfp pilus assembly protein PilN [Ce | 2e-04 | |
| COG3166 | 206 | COG3166, PilN, Tfp pilus assembly protein PilN [Ce | 2e-04 | |
| pfam12795 | 239 | pfam12795, MscS_porin, Mechanosensitive ion channe | 2e-04 | |
| PRK11637 | 428 | PRK11637, PRK11637, AmiB activator; Provisional | 2e-04 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 3e-04 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 3e-04 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 3e-04 | |
| pfam11068 | 131 | pfam11068, DUF2869, Protein of unknown function (D | 3e-04 | |
| COG2959 | 391 | COG2959, HemX, Uncharacterized enzyme of heme bios | 3e-04 | |
| pfam12795 | 239 | pfam12795, MscS_porin, Mechanosensitive ion channe | 3e-04 | |
| COG3115 | 324 | COG3115, ZipA, Cell division protein [Cell divisio | 3e-04 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 4e-04 | |
| PRK10246 | 1047 | PRK10246, PRK10246, exonuclease subunit SbcC; Prov | 4e-04 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 4e-04 | |
| pfam11068 | 131 | pfam11068, DUF2869, Protein of unknown function (D | 4e-04 | |
| PRK10920 | 390 | PRK10920, PRK10920, putative uroporphyrinogen III | 4e-04 | |
| PRK10920 | 390 | PRK10920, PRK10920, putative uroporphyrinogen III | 4e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 4e-04 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 4e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 5e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 5e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-04 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 6e-04 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 6e-04 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 6e-04 | |
| PRK10920 | 390 | PRK10920, PRK10920, putative uroporphyrinogen III | 6e-04 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 6e-04 | |
| TIGR02302 | 851 | TIGR02302, aProt_lowcomp, TIGR02302 family protein | 6e-04 | |
| COG0845 | 372 | COG0845, AcrA, Membrane-fusion protein [Cell envel | 6e-04 | |
| PRK11637 | 428 | PRK11637, PRK11637, AmiB activator; Provisional | 7e-04 | |
| pfam12037 | 276 | pfam12037, DUF3523, Domain of unknown function (DU | 7e-04 | |
| pfam04702 | 147 | pfam04702, Vicilin_N, Vicilin N terminal region | 8e-04 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 8e-04 | |
| pfam11932 | 250 | pfam11932, DUF3450, Protein of unknown function (D | 8e-04 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 8e-04 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 8e-04 | |
| PRK10920 | 390 | PRK10920, PRK10920, putative uroporphyrinogen III | 8e-04 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 8e-04 | |
| pfam03938 | 157 | pfam03938, OmpH, Outer membrane protein (OmpH-like | 8e-04 | |
| pfam03938 | 157 | pfam03938, OmpH, Outer membrane protein (OmpH-like | 8e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 9e-04 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 0.001 | |
| TIGR00237 | 432 | TIGR00237, xseA, exodeoxyribonuclease VII, large s | 0.001 | |
| PRK10246 | 1047 | PRK10246, PRK10246, exonuclease subunit SbcC; Prov | 0.001 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 0.001 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 0.001 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 0.001 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.001 | |
| pfam12037 | 276 | pfam12037, DUF3523, Domain of unknown function (DU | 0.001 | |
| pfam11180 | 192 | pfam11180, DUF2968, Protein of unknown function (D | 0.001 | |
| TIGR01843 | 423 | TIGR01843, type_I_hlyD, type I secretion membrane | 0.001 | |
| PRK01741 | 332 | PRK01741, PRK01741, cell division protein ZipA; Pr | 0.001 | |
| COG5380 | 283 | COG5380, LimK, Lipase chaperone [Posttranslational | 0.001 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.001 | |
| COG1570 | 440 | COG1570, XseA, Exonuclease VII, large subunit [DNA | 0.002 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 0.002 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 0.002 | |
| pfam02050 | 122 | pfam02050, FliJ, Flagellar FliJ protein | 0.002 | |
| PRK10246 | 1047 | PRK10246, PRK10246, exonuclease subunit SbcC; Prov | 0.002 | |
| PRK01294 | 336 | PRK01294, PRK01294, lipase chaperone; Provisional | 0.002 | |
| PRK01294 | 336 | PRK01294, PRK01294, lipase chaperone; Provisional | 0.002 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 0.002 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 0.002 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 0.002 | |
| PRK11448 | 1123 | PRK11448, hsdR, type I restriction enzyme EcoKI su | 0.002 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.002 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 0.002 | |
| COG3166 | 206 | COG3166, PilN, Tfp pilus assembly protein PilN [Ce | 0.002 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 0.002 | |
| TIGR02302 | 851 | TIGR02302, aProt_lowcomp, TIGR02302 family protein | 0.002 | |
| TIGR02302 | 851 | TIGR02302, aProt_lowcomp, TIGR02302 family protein | 0.002 | |
| pfam07321 | 152 | pfam07321, YscO, Type III secretion protein YscO | 0.002 | |
| pfam07321 | 152 | pfam07321, YscO, Type III secretion protein YscO | 0.002 | |
| pfam07321 | 152 | pfam07321, YscO, Type III secretion protein YscO | 0.002 | |
| PRK11147 | 635 | PRK11147, PRK11147, ABC transporter ATPase compone | 0.002 | |
| pfam04375 | 372 | pfam04375, HemX, HemX | 0.002 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.002 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 0.003 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 0.003 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 0.003 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 0.003 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.003 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.003 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 0.003 | |
| COG3115 | 324 | COG3115, ZipA, Cell division protein [Cell divisio | 0.003 | |
| COG5380 | 283 | COG5380, LimK, Lipase chaperone [Posttranslational | 0.003 | |
| COG4487 | 438 | COG4487, COG4487, Uncharacterized protein conserve | 0.003 | |
| pfam12203 | 92 | pfam12203, HDAC4_Gln, Glutamine rich N terminal do | 0.003 | |
| PRK00286 | 438 | PRK00286, xseA, exodeoxyribonuclease VII large sub | 0.004 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 0.004 | |
| PRK01294 | 336 | PRK01294, PRK01294, lipase chaperone; Provisional | 0.004 | |
| COG3115 | 324 | COG3115, ZipA, Cell division protein [Cell divisio | 0.004 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 | |
| PRK01741 | 332 | PRK01741, PRK01741, cell division protein ZipA; Pr | 0.004 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.004 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 0.004 | |
| COG0760 | 320 | COG0760, SurA, Parvulin-like peptidyl-prolyl isome | 0.004 | |
| pfam04156 | 186 | pfam04156, IncA, IncA protein | 0.004 |
| >gnl|CDD|221051 pfam11265, Med25_VWA, Mediator complex subunit 25 von Willebrand factor type A | Back alignment and domain information |
|---|
Score = 180 bits (459), Expect = 5e-52
Identities = 67/200 (33%), Positives = 88/200 (44%), Gaps = 20/200 (10%)
Query: 17 RCFCVNELAGQKTSASN--VELSLVTFNTHGSYCACLVQRSGWTKDVDIFLHWLSTIPFA 74
F A + SLV FNT S VQ G T+DVD FLHWL +I F
Sbjct: 43 EYFNGGPPAETDFGGEYGGTQYSLVVFNTVASAPESYVQCHGPTRDVDEFLHWLDSIQFM 102
Query: 75 GGGFNDAA-IAEGLSEALMMFSVAPNGSQNQQNVDGQRHCILVAASNPHPLPTPVYRPQM 133
GGG + IAEGL+EAL +F Q D RHCIL+ S P+ LPT
Sbjct: 103 GGGGESCSLIAEGLAEALQLFDDFSEMRQQIGQTDLHRHCILICNSPPYLLPT------- 155
Query: 134 QNLDQNENNEAQAESRLSDAETVAKSFVQCSVSLSVICPKQLPKLTAIYNAAKRN-PRAA 192
A E + SD + + LS+I P++LP L ++ AK +
Sbjct: 156 -------VESASYEGKTSDQLAAI--IYERGIHLSIIAPRKLPALRLLFEKAKPDQQLPM 206
Query: 193 DPPVDNSKNPHFLVLISENF 212
+D +KNP +VL+ F
Sbjct: 207 KSSIDYAKNPFHMVLLRGIF 226
|
The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells. Human Med25 consists of several domains with different binding properties, the N-terminal, VWA domain which is this one, an SD2 domain from residues 229-381, a PTOV(B) or ACID domain from 395-545, an SD2 domain from residues 564-645 and a C-terminal NR box-containing domain (646-650) from 646-747. This VWA or von Willebrand factor type A domain when bound to RAR and the histone acetyltransferase CBP is responsible for recruiting Med1 to the rest of the Mediator complex. Length = 226 |
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|234714 PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|151935 pfam11498, Activator_LAG-3, Transcriptional activator LAG-3 | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|234714 PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|234714 PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234714 PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|237191 PRK12757, PRK12757, cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218218 pfam04702, Vicilin_N, Vicilin N terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224486 COG1570, XseA, Exonuclease VII, large subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|151935 pfam11498, Activator_LAG-3, Transcriptional activator LAG-3 | Back alignment and domain information |
|---|
| >gnl|CDD|161783 TIGR00237, xseA, exodeoxyribonuclease VII, large subunit | Back alignment and domain information |
|---|
| >gnl|CDD|180700 PRK06800, fliH, flagellar assembly protein H; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|204784 pfam11932, DUF3450, Protein of unknown function (DUF3450) | Back alignment and domain information |
|---|
| >gnl|CDD|236797 PRK10927, PRK10927, essential cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202101 pfam02050, FliJ, Flagellar FliJ protein | Back alignment and domain information |
|---|
| >gnl|CDD|224486 COG1570, XseA, Exonuclease VII, large subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|151935 pfam11498, Activator_LAG-3, Transcriptional activator LAG-3 | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|217472 pfam03280, Lipase_chap, Proteobacterial lipase chaperone protein | Back alignment and domain information |
|---|
| >gnl|CDD|237191 PRK12757, PRK12757, cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|236797 PRK10927, PRK10927, essential cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|234937 PRK01294, PRK01294, lipase chaperone; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|236797 PRK10927, PRK10927, essential cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131526 TIGR02473, flagell_FliJ, flagellar export protein FliJ | Back alignment and domain information |
|---|
| >gnl|CDD|220964 pfam11068, DUF2869, Protein of unknown function (DUF2869) | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220964 pfam11068, DUF2869, Protein of unknown function (DUF2869) | Back alignment and domain information |
|---|
| >gnl|CDD|236795 PRK10920, PRK10920, putative uroporphyrinogen III C-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225507 COG2959, HemX, Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|217472 pfam03280, Lipase_chap, Proteobacterial lipase chaperone protein | Back alignment and domain information |
|---|
| >gnl|CDD|204935 pfam12474, PKK, Polo kinase kinase | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237191 PRK12757, PRK12757, cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218218 pfam04702, Vicilin_N, Vicilin N terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|218218 pfam04702, Vicilin_N, Vicilin N terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|161783 TIGR00237, xseA, exodeoxyribonuclease VII, large subunit | Back alignment and domain information |
|---|
| >gnl|CDD|202101 pfam02050, FliJ, Flagellar FliJ protein | Back alignment and domain information |
|---|
| >gnl|CDD|217472 pfam03280, Lipase_chap, Proteobacterial lipase chaperone protein | Back alignment and domain information |
|---|
| >gnl|CDD|131526 TIGR02473, flagell_FliJ, flagellar export protein FliJ | Back alignment and domain information |
|---|
| >gnl|CDD|224241 COG1322, COG1322, Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236912 PRK11448, hsdR, type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) | Back alignment and domain information |
|---|
| >gnl|CDD|161783 TIGR00237, xseA, exodeoxyribonuclease VII, large subunit | Back alignment and domain information |
|---|
| >gnl|CDD|204784 pfam11932, DUF3450, Protein of unknown function (DUF3450) | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|225707 COG3166, PilN, Tfp pilus assembly protein PilN [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|225707 COG3166, PilN, Tfp pilus assembly protein PilN [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|221776 pfam12795, MscS_porin, Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >gnl|CDD|236942 PRK11637, PRK11637, AmiB activator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220964 pfam11068, DUF2869, Protein of unknown function (DUF2869) | Back alignment and domain information |
|---|
| >gnl|CDD|225507 COG2959, HemX, Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|221776 pfam12795, MscS_porin, Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >gnl|CDD|225657 COG3115, ZipA, Cell division protein [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|220964 pfam11068, DUF2869, Protein of unknown function (DUF2869) | Back alignment and domain information |
|---|
| >gnl|CDD|236795 PRK10920, PRK10920, putative uroporphyrinogen III C-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236795 PRK10920, PRK10920, putative uroporphyrinogen III C-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236795 PRK10920, PRK10920, putative uroporphyrinogen III C-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233816 TIGR02302, aProt_lowcomp, TIGR02302 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|223914 COG0845, AcrA, Membrane-fusion protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|236942 PRK11637, PRK11637, AmiB activator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523) | Back alignment and domain information |
|---|
| >gnl|CDD|218218 pfam04702, Vicilin_N, Vicilin N terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|204784 pfam11932, DUF3450, Protein of unknown function (DUF3450) | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|236795 PRK10920, PRK10920, putative uroporphyrinogen III C-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217803 pfam03938, OmpH, Outer membrane protein (OmpH-like) | Back alignment and domain information |
|---|
| >gnl|CDD|217803 pfam03938, OmpH, Outer membrane protein (OmpH-like) | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|161783 TIGR00237, xseA, exodeoxyribonuclease VII, large subunit | Back alignment and domain information |
|---|
| >gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523) | Back alignment and domain information |
|---|
| >gnl|CDD|221016 pfam11180, DUF2968, Protein of unknown function (DUF2968) | Back alignment and domain information |
|---|
| >gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >gnl|CDD|234977 PRK01741, PRK01741, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227671 COG5380, LimK, Lipase chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224486 COG1570, XseA, Exonuclease VII, large subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|202101 pfam02050, FliJ, Flagellar FliJ protein | Back alignment and domain information |
|---|
| >gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234937 PRK01294, PRK01294, lipase chaperone; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234937 PRK01294, PRK01294, lipase chaperone; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|236912 PRK11448, hsdR, type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225707 COG3166, PilN, Tfp pilus assembly protein PilN [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|233816 TIGR02302, aProt_lowcomp, TIGR02302 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|233816 TIGR02302, aProt_lowcomp, TIGR02302 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|148750 pfam07321, YscO, Type III secretion protein YscO | Back alignment and domain information |
|---|
| >gnl|CDD|148750 pfam07321, YscO, Type III secretion protein YscO | Back alignment and domain information |
|---|
| >gnl|CDD|148750 pfam07321, YscO, Type III secretion protein YscO | Back alignment and domain information |
|---|
| >gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|113156 pfam04375, HemX, HemX | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225657 COG3115, ZipA, Cell division protein [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|227671 COG5380, LimK, Lipase chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|204848 pfam12203, HDAC4_Gln, Glutamine rich N terminal domain of histone deacetylase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|234714 PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|234937 PRK01294, PRK01294, lipase chaperone; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225657 COG3115, ZipA, Cell division protein [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|234977 PRK01741, PRK01741, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|223831 COG0760, SurA, Parvulin-like peptidyl-prolyl isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|217933 pfam04156, IncA, IncA protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 818 | |||
| PF11265 | 226 | Med25_VWA: Mediator complex subunit 25 von Willebr | 100.0 | |
| cd01452 | 187 | VWA_26S_proteasome_subunit 26S proteasome plays a | 97.8 | |
| cd01480 | 186 | vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI | 97.79 | |
| cd01482 | 164 | vWA_collagen_alphaI-XII-like Collagen: The extrace | 97.66 | |
| cd01450 | 161 | vWFA_subfamily_ECM Von Willebrand factor type A (v | 97.58 | |
| cd01469 | 177 | vWA_integrins_alpha_subunit Integrins are a class | 97.43 | |
| cd01481 | 165 | vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(V | 97.28 | |
| cd01472 | 164 | vWA_collagen von Willebrand factor (vWF) type A do | 97.25 | |
| cd01453 | 183 | vWA_transcription_factor_IIH_type Transcription fa | 97.19 | |
| PF13519 | 172 | VWA_2: von Willebrand factor type A domain; PDB: 3 | 97.1 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 96.91 | |
| cd01476 | 163 | VWA_integrin_invertebrates VWA_integrin (invertebr | 96.5 | |
| cd01471 | 186 | vWA_micronemal_protein Micronemal proteins: The To | 96.46 | |
| cd01473 | 192 | vWA_CTRP CTRP for CS protein-TRAP-related protein: | 96.1 | |
| cd01474 | 185 | vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxi | 95.66 | |
| cd01458 | 218 | vWA_ku Ku70/Ku80 N-terminal domain. The Ku78 heter | 95.61 | |
| cd00198 | 161 | vWFA Von Willebrand factor type A (vWA) domain was | 95.58 | |
| cd01477 | 193 | vWA_F09G8-8_type VWA F09G8.8 type: Von Willebrand | 95.42 | |
| PF00092 | 178 | VWA: von Willebrand factor type A domain; InterPro | 95.34 | |
| KOG3598 | 2220 | consensus Thyroid hormone receptor-associated prot | 95.27 | |
| cd01456 | 206 | vWA_ywmD_type VWA ywmD type:Von Willebrand factor | 94.57 | |
| PF04056 | 193 | Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like pro | 94.57 | |
| smart00327 | 177 | VWA von Willebrand factor (vWF) type A domain. VWA | 94.35 | |
| cd01467 | 180 | vWA_BatA_type VWA BatA type: Von Willebrand factor | 94.0 | |
| PF11235 | 168 | Med25_SD1: Mediator complex subunit 25 synapsin 1; | 92.72 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 92.6 | |
| cd01451 | 178 | vWA_Magnesium_chelatase Magnesium chelatase: Mg-ch | 92.55 | |
| cd01463 | 190 | vWA_VGCC_like VWA Voltage gated Calcium channel li | 92.43 | |
| cd01470 | 198 | vWA_complement_factors Complement factors B and C2 | 92.37 | |
| PRK13685 | 326 | hypothetical protein; Provisional | 92.31 | |
| PF04811 | 243 | Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: I | 92.31 | |
| cd01454 | 174 | vWA_norD_type norD type: Denitrifying bacteria con | 91.64 | |
| PRK13406 | 584 | bchD magnesium chelatase subunit D; Provisional | 91.33 | |
| COG1240 | 261 | ChlD Mg-chelatase subunit ChlD [Coenzyme metabolis | 90.52 | |
| PTZ00441 | 576 | sporozoite surface protein 2 (SSP2); Provisional | 90.22 | |
| cd01461 | 171 | vWA_interalpha_trypsin_inhibitor vWA_interalpha tr | 89.85 | |
| TIGR03436 | 296 | acidobact_VWFA VWFA-related Acidobacterial domain. | 88.74 | |
| PF13768 | 155 | VWA_3: von Willebrand factor type A domain | 86.78 | |
| smart00187 | 423 | INB Integrin beta subunits (N-terminal portion of | 85.94 | |
| cd01466 | 155 | vWA_C3HC4_type VWA C3HC4-type: Von Willebrand fact | 85.02 | |
| cd01465 | 170 | vWA_subgroup VWA subgroup: Von Willebrand factor t | 81.56 | |
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 81.2 |
| >PF11265 Med25_VWA: Mediator complex subunit 25 von Willebrand factor type A; InterPro: IPR021419 The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.2e-65 Score=522.33 Aligned_cols=196 Identities=39% Similarity=0.580 Sum_probs=179.1
Q ss_pred CchhhHHHh-hhhHHHHHhhccccccccccCCC--cceEEEEEEccCCCCCcCceeeccCCCCHHHHHHHhccccCCCCC
Q 003455 1 MCIYFYAYS-KLSLYFHRCFCVNELAGQKTSAS--NVELSLVTFNTHGSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGG 77 (818)
Q Consensus 1 m~~Y~~~l~-~YI~p~ie~f~~~~~~e~~~~~~--~~~yaLVvf~~~~~~~~~~v~~~g~T~~~~~fl~wL~~i~f~GGG 77 (818)
|++||+.|| +||+|+||||++|+++|++++++ +++|||||||+|||||+|+|+|+|||+|+++|++|||+|+|+|||
T Consensus 26 lgpy~~~Lkt~Yl~P~le~f~~g~~~e~~~~~~~~~t~y~LVvf~t~d~~~~~~v~~~g~T~~~~~fl~~L~~I~f~GGG 105 (226)
T PF11265_consen 26 LGPYWNTLKTNYLDPILEYFNGGPIAERDFGGDYSNTEYGLVVFNTADCYPEPIVQRSGPTSSPQKFLQWLDAIQFSGGG 105 (226)
T ss_pred hhhhHHHHHHHHHHHHHHHhcCCCcccccccccCCCceEEEEEEeccCCCcccceeccCCcCCHHHHHHHHHccCcCCCC
Confidence 799999999 79999999999999999998555 899999999999999999999999999999999999999999999
Q ss_pred -CChhhHHHHHHHHHhhhccCCCCCCCCCCCCCccEEEEeecCCCCCCCCCCcCcccccccccchhhhhhhccCCCHHHH
Q 003455 78 -FNDAAIAEGLSEALMMFSVAPNGSQNQQNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNEAQAESRLSDAETV 156 (818)
Q Consensus 78 -~~~~aiaEGLa~AL~~~~~~~~~~~~~~~~~~qkhCILi~nSpP~~lp~~~~~p~~~~l~~~~~~~~~~~~~l~~~e~l 156 (818)
+++++|||||++||+||+.....++...+.++|||||||||||||++|+. |+..|++ +++|++
T Consensus 106 ~e~~a~iaEGLa~AL~~fd~~~~~r~~~~~~~~~khcILI~nSpP~~~p~~---------------~~~~~~~-~~~d~l 169 (226)
T PF11265_consen 106 FESCAAIAEGLAEALQCFDDFKQMRQQQQQTDVQKHCILICNSPPYRLPVN---------------ECPQYSG-KTCDQL 169 (226)
T ss_pred cccchhHHHHHHHHHHHhcchhhhccccCcccccceEEEEeCCCCcccccc---------------CCCcccC-CCHHHH
Confidence 55577999999999999833333444456789999999999999999986 5566655 799999
Q ss_pred HHHHhhcCceEEEeCCCcchHHHHHHHHhcCCCCC-CCCCCCCCCCCCeEEEeeccc
Q 003455 157 AKSFVQCSVSLSVICPKQLPKLTAIYNAAKRNPRA-ADPPVDNSKNPHFLVLISENF 212 (818)
Q Consensus 157 a~~~~~~~I~lSiIsPrklp~L~~lf~~a~~~~~~-~~~~~d~ak~p~hlVLl~g~~ 212 (818)
|.++.||+|+||||||||||+|++||||+++|++. +++++||||||||||||||+|
T Consensus 170 a~~~~~~~I~LSiisPrklP~l~~Lfeka~~~~~~~~~~~~~~ak~p~hlVLl~g~~ 226 (226)
T PF11265_consen 170 AVLISERNISLSIISPRKLPSLRSLFEKAKGNPRAAADPSKDYAKDPRHLVLLRGYF 226 (226)
T ss_pred HHHHHhcCceEEEEcCccCHHHHHHHHhcCCCcccccccccccccCCCeEEEeecCC
Confidence 99999999999999999999999999999999997 699999999999999999987
|
Human Med25 consists of several domains with different binding properties, the N-terminal, VWA domain which is this one, an SD2 domain from residues 229-381, a PTOV(B) or ACID domain from 395-545, an SD2 domain from residues 564-645 and a C-terminal NR box-containing domain (646-650) from 646-747. This VWA or von Willebrand factor type A domain when bound to RAR and the histone acetyltransferase CBP is responsible for recruiting Med1 to the rest of the Mediator complex []. |
| >cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins | Back alignment and domain information |
|---|
| >cd01480 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) type: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions | Back alignment and domain information |
|---|
| >cd01482 vWA_collagen_alphaI-XII-like Collagen: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions | Back alignment and domain information |
|---|
| >cd01450 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01469 vWA_integrins_alpha_subunit Integrins are a class of adhesion receptors that link the extracellular matrix to the cytoskeleton and cooperate with growth factor receptors to promote celll survival, cell cycle progression and cell migration | Back alignment and domain information |
|---|
| >cd01481 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) like: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions | Back alignment and domain information |
|---|
| >cd01472 vWA_collagen von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins | Back alignment and domain information |
|---|
| >cd01453 vWA_transcription_factor_IIH_type Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme | Back alignment and domain information |
|---|
| >PF13519 VWA_2: von Willebrand factor type A domain; PDB: 3IBS_B 3RAG_B 2X5N_A | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >cd01476 VWA_integrin_invertebrates VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions | Back alignment and domain information |
|---|
| >cd01471 vWA_micronemal_protein Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell | Back alignment and domain information |
|---|
| >cd01473 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhesion of Plasmodium to host cells is an important phenomenon in parasite invasion and in malaria associated pathology | Back alignment and domain information |
|---|
| >cd01474 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax | Back alignment and domain information |
|---|
| >cd01458 vWA_ku Ku70/Ku80 N-terminal domain | Back alignment and domain information |
|---|
| >cd00198 vWFA Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01477 vWA_F09G8-8_type VWA F09G8 | Back alignment and domain information |
|---|
| >PF00092 VWA: von Willebrand factor type A domain; InterPro: IPR002035 The von Willebrand factor is a large multimeric glycoprotein found in blood plasma | Back alignment and domain information |
|---|
| >KOG3598 consensus Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription] | Back alignment and domain information |
|---|
| >cd01456 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >PF04056 Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like proteins are 40 kDa subunits of the transcription factor II H complex | Back alignment and domain information |
|---|
| >smart00327 VWA von Willebrand factor (vWF) type A domain | Back alignment and domain information |
|---|
| >cd01467 vWA_BatA_type VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >PF11235 Med25_SD1: Mediator complex subunit 25 synapsin 1; InterPro: IPR021397 The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >cd01451 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto) | Back alignment and domain information |
|---|
| >cd01463 vWA_VGCC_like VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta | Back alignment and domain information |
|---|
| >cd01470 vWA_complement_factors Complement factors B and C2 are two critical proteases for complement activation | Back alignment and domain information |
|---|
| >PRK13685 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04811 Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: IPR006896 COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex [] | Back alignment and domain information |
|---|
| >cd01454 vWA_norD_type norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases | Back alignment and domain information |
|---|
| >PRK13406 bchD magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >COG1240 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PTZ00441 sporozoite surface protein 2 (SSP2); Provisional | Back alignment and domain information |
|---|
| >cd01461 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) | Back alignment and domain information |
|---|
| >TIGR03436 acidobact_VWFA VWFA-related Acidobacterial domain | Back alignment and domain information |
|---|
| >PF13768 VWA_3: von Willebrand factor type A domain | Back alignment and domain information |
|---|
| >smart00187 INB Integrin beta subunits (N-terminal portion of extracellular region) | Back alignment and domain information |
|---|
| >cd01466 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01465 vWA_subgroup VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 818 | |||
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-10 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 6e-10 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-09 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-09 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 5e-08 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 5e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 6e-07 | |
| 3lj5_A | 725 | Portal protein, protein GP1; DNA ejection, molecul | 1e-09 | |
| 3lj5_A | 725 | Portal protein, protein GP1; DNA ejection, molecul | 2e-09 | |
| 3lj5_A | 725 | Portal protein, protein GP1; DNA ejection, molecul | 2e-09 | |
| 3lj5_A | 725 | Portal protein, protein GP1; DNA ejection, molecul | 5e-09 | |
| 3lj5_A | 725 | Portal protein, protein GP1; DNA ejection, molecul | 7e-08 | |
| 3lj5_A | 725 | Portal protein, protein GP1; DNA ejection, molecul | 6e-06 | |
| 3lj5_A | 725 | Portal protein, protein GP1; DNA ejection, molecul | 8e-06 | |
| 3lj5_A | 725 | Portal protein, protein GP1; DNA ejection, molecul | 5e-04 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 1e-07 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 8e-06 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 1e-05 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 2e-05 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 3e-05 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 4e-05 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 3e-04 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 5e-04 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 6e-04 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 2e-07 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 2e-07 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 2e-07 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 4e-06 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 2e-05 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 6e-05 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 3e-07 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 4e-05 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 6e-05 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 5e-07 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 3e-06 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 3e-05 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 2e-06 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 4e-06 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 8e-06 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 2e-05 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 2e-05 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 3e-05 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 3e-05 | |
| 1uur_A | 473 | Stata protein, STAT protein; transcription activat | 4e-06 | |
| 1uur_A | 473 | Stata protein, STAT protein; transcription activat | 5e-06 | |
| 1uur_A | 473 | Stata protein, STAT protein; transcription activat | 2e-05 | |
| 1uur_A | 473 | Stata protein, STAT protein; transcription activat | 7e-04 | |
| 2es4_D | 332 | Lipase chaperone; protein-protein complex, steric | 4e-06 | |
| 2es4_D | 332 | Lipase chaperone; protein-protein complex, steric | 1e-04 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 8e-06 | |
| 3ibp_A | 302 | Chromosome partition protein MUKB; structural main | 8e-06 | |
| 3ibp_A | 302 | Chromosome partition protein MUKB; structural main | 3e-05 | |
| 3ibp_A | 302 | Chromosome partition protein MUKB; structural main | 2e-04 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 1e-05 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 1e-05 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 1e-05 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 4e-05 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 5e-05 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 7e-05 | |
| 1lwu_C | 323 | Fibrinogen gamma chain; heterotrimer, protein-pept | 2e-05 | |
| 1lwu_C | 323 | Fibrinogen gamma chain; heterotrimer, protein-pept | 6e-05 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 4e-05 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 8e-05 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 1e-04 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 2e-04 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 2e-04 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 5e-04 | |
| 1m1j_C | 409 | Fibrinogen gamma chain; coiled coils, disulfide ri | 1e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-04 | |
| 3c8j_A | 203 | Natural killer cell receptor LY49C; MHC, virus, im | 2e-04 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 2e-04 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 2e-04 | |
| 3ajw_A | 150 | Flagellar FLIJ protein; flagellum, type III secret | 3e-04 | |
| 1vt0_M | 602 | Portal protein, protein GP1; portal protein, DNA e | 4e-04 | |
| 1jad_A | 251 | PLC-beta, phospholipase C beta; alpha helical coil | 5e-04 | |
| 2h8n_A | 112 | HD4, histone deacetylase 4; alpha helix, polar zip | 6e-04 | |
| 4dci_A | 150 | Uncharacterized protein; PSI-biology, midwest cent | 6e-04 |
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
Score = 63.3 bits (153), Expect = 2e-10
Identities = 20/133 (15%), Positives = 36/133 (27%)
Query: 674 ISSQQQQQLQQQQQQQQHQQMQSQLQHQQLSQLQQQQQQLPQLQQQIPQLQQQQQIPQLQ 733
+S +++ Q Q Q Q Q + + Q +P + Q Q
Sbjct: 1 MSHHKKRVYPQAQLQYGQNATPLQQPAQFMPPQDPAAAGMSYGQMGMPPQGAVPSMGQQQ 60
Query: 734 QQSMPQLQQQQQLPQLQQQQQLPQMQQQQQLPQLQQQQQLSQPQQMVGSGMGQGYVQGPG 793
+ Q Q QQ+ Q + + Q Q Q + P
Sbjct: 61 FLTPAQEQLHQQIDQATTSMNDMHLHNVPLVDPNAYMQPQVPVQMGTPLQQQQQPMAAPA 120
Query: 794 RTQLVSQGQVSSQ 806
Q + + +
Sbjct: 121 YGQPSAAMGQNMR 133
|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 | Back alignment and structure |
|---|
| >3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 | Back alignment and structure |
|---|
| >3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 | Back alignment and structure |
|---|
| >3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 | Back alignment and structure |
|---|
| >3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 | Back alignment and structure |
|---|
| >3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 | Back alignment and structure |
|---|
| >3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 | Back alignment and structure |
|---|
| >3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Length = 464 | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Length = 464 | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Length = 464 | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 | Back alignment and structure |
|---|
| >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 | Back alignment and structure |
|---|
| >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 | Back alignment and structure |
|---|
| >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 | Back alignment and structure |
|---|
| >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 | Back alignment and structure |
|---|
| >2es4_D Lipase chaperone; protein-protein complex, steric chaperone, triacylglycerol hydrolase, all alpha helix protein, A/B hydrolase fold; 1.85A {Burkholderia glumae} SCOP: a.137.15.1 Length = 332 | Back alignment and structure |
|---|
| >2es4_D Lipase chaperone; protein-protein complex, steric chaperone, triacylglycerol hydrolase, all alpha helix protein, A/B hydrolase fold; 1.85A {Burkholderia glumae} SCOP: a.137.15.1 Length = 332 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 | Back alignment and structure |
|---|
| >3ibp_A Chromosome partition protein MUKB; structural maintenance of chromosomes, SMC, condensin, chromosome segregation, hinge, dimerization domain; 3.10A {Escherichia coli} Length = 302 | Back alignment and structure |
|---|
| >3ibp_A Chromosome partition protein MUKB; structural maintenance of chromosomes, SMC, condensin, chromosome segregation, hinge, dimerization domain; 3.10A {Escherichia coli} Length = 302 | Back alignment and structure |
|---|
| >3ibp_A Chromosome partition protein MUKB; structural maintenance of chromosomes, SMC, condensin, chromosome segregation, hinge, dimerization domain; 3.10A {Escherichia coli} Length = 302 | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 | Back alignment and structure |
|---|
| >1lwu_C Fibrinogen gamma chain; heterotrimer, protein-peptide complex, blood clotting; HET: NDG MAN NAG BMA GAL; 2.80A {Petromyzon marinus} SCOP: d.171.1.1 h.1.8.1 PDB: 1n73_C* Length = 323 | Back alignment and structure |
|---|
| >1lwu_C Fibrinogen gamma chain; heterotrimer, protein-peptide complex, blood clotting; HET: NDG MAN NAG BMA GAL; 2.80A {Petromyzon marinus} SCOP: d.171.1.1 h.1.8.1 PDB: 1n73_C* Length = 323 | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 | Back alignment and structure |
|---|
| >1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Length = 409 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >3c8j_A Natural killer cell receptor LY49C; MHC, virus, immune system; 2.60A {Mus musculus} SCOP: d.169.1.1 PDB: 3c8k_D 1p4l_D 1ja3_A 1p1z_D Length = 203 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Length = 562 | Back alignment and structure |
|---|
| >3ajw_A Flagellar FLIJ protein; flagellum, type III secretion, coiled-coil, protein transpor; 2.10A {Salmonella typhimurium} Length = 150 | Back alignment and structure |
|---|
| >1vt0_M Portal protein, protein GP1; portal protein, DNA ejection, molecular motor, DNA packaging podoviridae; 3.25A {Enterobacteria phage P22} PDB: 3lj4_A Length = 602 | Back alignment and structure |
|---|
| >1jad_A PLC-beta, phospholipase C beta; alpha helical coiled coil, hydrolase; 2.40A {Meleagris gallopavo} SCOP: h.4.10.1 Length = 251 | Back alignment and structure |
|---|
| >2h8n_A HD4, histone deacetylase 4; alpha helix, polar zipper, transcription; 2.60A {Homo sapiens} PDB: 2o94_A Length = 112 | Back alignment and structure |
|---|
| >4dci_A Uncharacterized protein; PSI-biology, midwest center for structural genomics, MCSG, S genomics, unknown function; 2.82A {Synechococcus SP} Length = 150 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 818 | |||
| 2iue_A | 212 | Pactolus I-domain; membrane protein, CD, ITC, limb | 98.17 | |
| 4b4t_W | 268 | RPN10, 26S proteasome regulatory subunit RPN10; hy | 97.66 | |
| 1ijb_A | 202 | VON willebrand factor; dinucleotide-binding fold, | 97.63 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 97.6 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 97.45 | |
| 1atz_A | 189 | VON willebrand factor; collagen-binding, hemostasi | 97.44 | |
| 1v7p_C | 200 | Integrin alpha-2; snake venom, C-type lectin, anta | 97.28 | |
| 2xgg_A | 178 | Microneme protein 2; A/I domain, cell adhesion, hy | 97.27 | |
| 3t3p_B | 472 | Integrin beta-3; integrin, cell adhesion, blood cl | 97.26 | |
| 3vi3_B | 454 | Integrin beta-1; beta propeller fold, rossman fold | 97.25 | |
| 2x5n_A | 192 | SPRPN10, 26S proteasome regulatory subunit RPN10; | 97.24 | |
| 3ibs_A | 218 | Conserved hypothetical protein BATB; structural ge | 97.02 | |
| 3v4v_B | 503 | Integrin beta-7; cell adhesion, madcam-1, membrane | 96.98 | |
| 2b2x_A | 223 | Integrin alpha-1; computational design, antibody-a | 96.94 | |
| 3n2n_F | 185 | Anthrax toxin receptor 1; rossmann fold; 1.80A {Ho | 96.81 | |
| 1pt6_A | 213 | Integrin alpha-1; cell adhesion; 1.87A {Homo sapie | 96.74 | |
| 1mf7_A | 194 | Integrin alpha M; cell adhesion; 1.25A {Homo sapie | 96.64 | |
| 1n3y_A | 198 | Integrin alpha-X; alpha/beta rossmann fold, cell a | 96.55 | |
| 1q0p_A | 223 | Complement factor B; VON willebrand factor, MAC-1, | 96.23 | |
| 1shu_X | 182 | Anthrax toxin receptor 2; alpha/beta rossmann fold | 95.9 | |
| 3zqk_A | 199 | VON willebrand factor; blood clotting, adamts-13, | 95.86 | |
| 4hqo_A | 266 | Sporozoite surface protein 2; malaria, gliding mot | 95.68 | |
| 2x31_A | 189 | Magnesium-chelatase 60 kDa subunit; ligase, bacter | 95.32 | |
| 1rrk_A | 497 | Complement factor B; BB, hydrolase; 2.00A {Homo sa | 95.31 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 95.1 | |
| 4hqf_A | 281 | Thrombospondin-related anonymous protein, trap; ma | 94.91 | |
| 3k6s_A | 1095 | Integrin alpha-X; cell receptor, adhesion molecule | 93.89 | |
| 2odp_A | 509 | Complement C2; C3/C5 convertase, complement serin | 93.35 | |
| 3iot_A | 449 | Maltose-binding protein, huntingtin fusion protei; | 93.07 | |
| 1jey_B | 565 | KU80; double-strand DNA break repair, non-homologo | 92.46 | |
| 1mjn_A | 179 | Integrin alpha-L; rossmann fold, immune system; 1. | 91.87 | |
| 4fx5_A | 464 | VON willebrand factor type A; structural genomics, | 90.31 | |
| 3rag_A | 242 | Uncharacterized protein; structural genomics, PSI- | 88.55 | |
| 1jey_A | 609 | KU70; double-strand DNA break repair, non-homologo | 87.2 |
| >2iue_A Pactolus I-domain; membrane protein, CD, ITC, limbs, midas, admidas, membrane, integrin, titration, rossman fold, cell adhesion, transmembrane; NMR {Mus musculus} | Back alignment and structure |
|---|
Probab=98.17 E-value=1.9e-05 Score=80.97 Aligned_cols=155 Identities=10% Similarity=0.072 Sum_probs=111.6
Q ss_pred CchhhHHHhhhhHHHHHhhccccccccccCCCcceEEEEEEccCCCCCcCceeeccCCCCHHHHHHHhccccCCCCCCCh
Q 003455 1 MCIYFYAYSKLSLYFHRCFCVNELAGQKTSASNVELSLVTFNTHGSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFND 80 (818)
Q Consensus 1 m~~Y~~~l~~YI~p~ie~f~~~~~~e~~~~~~~~~yaLVvf~~~~~~~~~~v~~~g~T~~~~~fl~wL~~i~f~GGG~~~ 80 (818)
|+.|++.+|+-+..+++-+.. ...++.+|++.|+++ .+.....+|+|..+|..+|+++..+||+...
T Consensus 16 M~~di~~lk~~~~~l~~~l~~--------~~~~~r~Gfg~f~Dk-----~~~~~l~lT~d~~~F~~~v~~~~vsg~~D~P 82 (212)
T 2iue_A 16 AQGHLSNVQTLGSDLLKALNE--------ISRSGRIGFGSIVNM-----TFQHILKLTADSSQFQRELRKQLVSGKLATP 82 (212)
T ss_dssp GTTTHHHHHHHHHHHHHHHHH--------HCSCEEEEEEEESSS-----CEEEEEEEESCHHHHHHHHHTCCCCCCSSSS
T ss_pred chhHHHHHHHHHHHHHHHHHh--------hCcCceEEEEEEEcC-----cceecCCcCCCHHHHHHHHhhccccCCCCCC
Confidence 889999999888888877742 123699999999998 2456788999999999999999999999777
Q ss_pred hhHHHHHHHHHhhhccCCCCCCCCCCCCCccEEEEeecCCCCCCCC----CCcCcc--cccccccchhhhhhhccCCCHH
Q 003455 81 AAIAEGLSEALMMFSVAPNGSQNQQNVDGQRHCILVAASNPHPLPT----PVYRPQ--MQNLDQNENNEAQAESRLSDAE 154 (818)
Q Consensus 81 ~aiaEGLa~AL~~~~~~~~~~~~~~~~~~qkhCILi~nSpP~~lp~----~~~~p~--~~~l~~~~~~~~~~~~~l~~~e 154 (818)
.+.-|||-.|+.|.+ ..+- +. ..|.+||++..+||...= ..+.|. -|.|.++.-..+..+ ...+++
T Consensus 83 E~g~dal~qa~~c~~--~i~W----r~-a~rllvl~TDa~~H~~gDg~l~gi~~pnd~~chl~~g~y~~s~~~-Dyps~~ 154 (212)
T 2iue_A 83 KGQLDAVVQVAICLG--EIGW----RN-GTRFLVLVTDNDFHLAKDKTLGTRQNTSDGRCHLDDGMYRSRGEP-DYQSVV 154 (212)
T ss_dssp BCHHHHHHHHHHCHH--HHTC----CS-SEEEEEEECSSCBCCTTGGGGGTCCSCCCSSCCBSSSBBGGGGSS-CCCCHH
T ss_pred chHHHHHHHHHHhhh--hccc----CC-ccEEEEEECcCCccccCCccccccccCCccccccCCCeeccCccc-CCCCHH
Confidence 788889999987732 0000 23 779999999999998531 122233 233332211111122 235999
Q ss_pred HHHHHHhhcCceEEEeCCCcch
Q 003455 155 TVAKSFVQCSVSLSVICPKQLP 176 (818)
Q Consensus 155 ~la~~~~~~~I~lSiIsPrklp 176 (818)
++.+.+.+++|.+-+...+...
T Consensus 155 q~~~~l~~~~i~~ifavt~~~~ 176 (212)
T 2iue_A 155 QLASKLAENNIQPIFVVPSRMV 176 (212)
T ss_dssp HHHHHHHHHTCEEEEEEEHHHH
T ss_pred HHHHHHHhcCCcEEEEEccchh
Confidence 9999999999998888776543
|
| >4b4t_W RPN10, 26S proteasome regulatory subunit RPN10; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 4dmu_B 2adf_A 1fe8_A 1ao3_A | Back alignment and structure |
|---|
| >1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhes glycoprotein, toxin-cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A | Back alignment and structure |
|---|
| >2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* | Back alignment and structure |
|---|
| >3vi3_B Integrin beta-1; beta propeller fold, rossman fold, beta sandwich, fibronecti receptor, cell adhesion-immune system complex; HET: NAG BMA MAN; 2.90A {Homo sapiens} PDB: 3vi4_B* | Back alignment and structure |
|---|
| >2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3ibs_A Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for S genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* | Back alignment and structure |
|---|
| >2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune syste; 2.20A {Rattus norvegicus} SCOP: c.62.1.1 | Back alignment and structure |
|---|
| >3n2n_F Anthrax toxin receptor 1; rossmann fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 | Back alignment and structure |
|---|
| >1pt6_A Integrin alpha-1; cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 4a0q_A 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A | Back alignment and structure |
|---|
| >1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 3q3g_G 1n9z_A 1bhq_1 1bho_1 1idn_1 3qa3_G | Back alignment and structure |
|---|
| >1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 | Back alignment and structure |
|---|
| >1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 | Back alignment and structure |
|---|
| >1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y* | Back alignment and structure |
|---|
| >3zqk_A VON willebrand factor; blood clotting, adamts-13, force sensor, VON willebrand DISE domain, haemostasis; HET: NAG; 1.70A {Homo sapiens} PDB: 3ppv_A 3ppx_A 3ppw_A 3ppy_A 3gxb_A* | Back alignment and structure |
|---|
| >4hqo_A Sporozoite surface protein 2; malaria, gliding motility, VWA domain, TSR domain, extensibl ribbon, receptor on sporozoite, vaccine target; HET: FUC BGC; 2.19A {Plasmodium vivax} PDB: 4hql_A* 4hqn_A* | Back alignment and structure |
|---|
| >2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* | Back alignment and structure |
|---|
| >4hqf_A Thrombospondin-related anonymous protein, trap; malaria, parasite motility, I domain, TSR domain, receptor O sporozoite, vaccine target; 2.20A {Plasmodium falciparum} PDB: 4hqk_A 2bbx_A | Back alignment and structure |
|---|
| >3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* | Back alignment and structure |
|---|
| >2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* | Back alignment and structure |
|---|
| >3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A | Back alignment and structure |
|---|
| >1jey_B KU80; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.2 c.62.1.4 PDB: 1jeq_B* | Back alignment and structure |
|---|
| >1mjn_A Integrin alpha-L; rossmann fold, immune system; 1.30A {Homo sapiens} SCOP: c.62.1.1 PDB: 3hi6_A 1mq8_B* 3eoa_I 3eob_I 1rd4_A* 1lfa_A 1zon_A 1zoo_A 1zop_A 1dgq_A 1xdd_A* 1xdg_A* 1xuo_A* 3e2m_A* 3bqn_B* 1cqp_A* 3bqm_B* 2ica_A* 2o7n_A* 3m6f_A* ... | Back alignment and structure |
|---|
| >4fx5_A VON willebrand factor type A; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, blood clotting; HET: MSE; 1.73A {Catenulispora acidiphila} | Back alignment and structure |
|---|
| >3rag_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tructural genomics; 1.80A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1jey_A KU70; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.1 c.62.1.3 PDB: 1jeq_A* 3rzx_B | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 818 | ||||
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 4e-09 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 2e-07 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 3e-07 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 1e-04 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 3e-08 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 4e-08 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 4e-08 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 1e-07 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 5e-07 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 6e-07 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 7e-07 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 1e-06 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 8e-06 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 2e-05 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 2e-05 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 2e-04 | |
| d1s6da_ | 103 | a.52.1.3 (A:) Methionine-rich 2S protein (albumin | 0.001 | |
| g1pnb.1 | 106 | a.52.1.3 (A:,B:) Napin BNIb {Rape (Brassica napus) | 0.001 | |
| d2oeza1 | 245 | e.68.1.1 (A:1-245) Uncharacterized protein VP2528 | 0.002 | |
| d1psya_ | 125 | a.52.1.3 (A:) 2S albumin RicC3 {Castor bean (Ricin | 0.002 | |
| d1fxka_ | 107 | a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Meth | 0.004 |
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain superfamily: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain family: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain domain: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 56.3 bits (135), Expect = 4e-09
Identities = 17/104 (16%), Positives = 44/104 (42%), Gaps = 3/104 (2%)
Query: 667 MVVFKPQISSQQQQQLQQQQQQQQHQQMQSQLQHQQLSQLQQQQQQLPQLQQQIPQLQQQ 726
+ + +I ++ + Q + +MQ + + + + Q+ L QL +++ + Q
Sbjct: 199 LTEKEKEIEVERVKAESAQASAKMLHEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQ 258
Query: 727 QQIPQLQQQSMPQLQQQQQLPQLQQQQQLPQMQQQQQLPQLQQQ 770
+Q+ L+ Q+Q L++ Q + ++ LQ +
Sbjct: 259 LLK---EQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTK 299
|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1s6da_ a.52.1.3 (A:) Methionine-rich 2S protein (albumin 8) {Common sunflower (Helianthus annuus) [TaxId: 4232]} Length = 103 | Back information, alignment and structure |
|---|
| >d1psya_ a.52.1.3 (A:) 2S albumin RicC3 {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 125 | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 107 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 818 | |||
| d1tyeb2 | 248 | Integrin beta A domain {Human (Homo sapiens) [TaxI | 98.75 | |
| d1ijba_ | 202 | von Willebrand factor A1 domain, vWA1 {Human (Homo | 97.43 | |
| d1pt6a_ | 192 | Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId | 97.42 | |
| d1atza_ | 184 | von Willebrand factor A3 domain, vWA3 {Human (Homo | 97.38 | |
| d1v7pc_ | 193 | Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId | 97.38 | |
| d1n3ya_ | 189 | Integrin alpha-x beta2 {Human (Homo sapiens) [TaxI | 97.3 | |
| d1mf7a_ | 194 | Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha sub | 96.61 | |
| d1shux_ | 181 | Capillary morphogenesis protein 2 domain {Human (H | 96.6 | |
| d1q0pa_ | 209 | Complement factor B domain {Human (Homo sapiens) [ | 96.38 | |
| d1mjna_ | 179 | Integrin CD11a/CD18 (Leukocyte function associated | 95.8 | |
| d1jeyb2 | 236 | Ku80 subunit N-terminal domain {Human (Homo sapien | 95.42 | |
| d1jeya2 | 220 | Ku70 subunit N-terminal domain {Human (Homo sapien | 86.13 |
| >d1tyeb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: vWA-like superfamily: vWA-like family: Integrin A (or I) domain domain: Integrin beta A domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.75 E-value=8.1e-08 Score=97.37 Aligned_cols=172 Identities=9% Similarity=0.011 Sum_probs=119.2
Q ss_pred CchhhHHHhhhhHHHHHhhccccccccccCCCcceEEEEEEccCCCCCcCc------------------------eeecc
Q 003455 1 MCIYFYAYSKLSLYFHRCFCVNELAGQKTSASNVELSLVTFNTHGSYCACL------------------------VQRSG 56 (818)
Q Consensus 1 m~~Y~~~l~~YI~p~ie~f~~~~~~e~~~~~~~~~yaLVvf~~~~~~~~~~------------------------v~~~g 56 (818)
|+.|++.+|+-|..+++.+.. ......+|||.|+++...+... .....
T Consensus 18 M~~~i~~vk~~i~~i~~~l~~--------~~~~~r~g~~~f~D~~~~p~~~~~~~~~~~~p~~~~~~~~~~~f~~~~~~~ 89 (248)
T d1tyeb2 18 MKDDLWSIQNLGTKLATQMRK--------LTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLT 89 (248)
T ss_dssp GGGGHHHHHHHHHHHHHHHHH--------HCSCEEEEEEEECCCSSTTTSCCCSGGGGTCGGGGGTSCCCCCCSEEEEEE
T ss_pred HHHHHHHHHHHHHHHHHHHHh--------hCcCceEEEEEEEecccCccccccchhhccCccccccccccccccceecCC
Confidence 899999999999999998853 1236899999999986433111 12358
Q ss_pred CCCCHHHHHHHhccccCCCCCCChhhHHHHHHHHHhhhccCCCCCCCCCCCCCccEEEEeecCCCCCCCCC------CcC
Q 003455 57 WTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQQNVDGQRHCILVAASNPHPLPTP------VYR 130 (818)
Q Consensus 57 ~T~~~~~fl~wL~~i~f~GGG~~~~aiaEGLa~AL~~~~~~~~~~~~~~~~~~qkhCILi~nSpP~~lp~~------~~~ 130 (818)
||+|..+|..+|+++...|||....+.-+||..|+.|.+ ..+ =+....|..|||+..|||...-- -++
T Consensus 90 ~t~d~~~f~~~l~~~~~~GggD~pE~~~~Al~~a~~~~~--~i~----Wr~~a~r~viliTDA~~H~~~d~~l~g~~~~~ 163 (248)
T d1tyeb2 90 LTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDE--KIG----WRNDASHLLVFTTDAKTHIALDGRLAGIVQPN 163 (248)
T ss_dssp EESCHHHHHHHHTTCCCCCCSSSSBCHHHHHHHHHHCHH--HHT----CCTTSEEEEEEEESSCBCCTTGGGGGTCCSCC
T ss_pred CCCCHHHHHHHHhheecccCCCCcchHHHHHHHHHHHhh--hCC----CCCCccEEEEEECCCCcccccccccccccccC
Confidence 999999999999999999999888899999999886642 011 13567789999999999953210 011
Q ss_pred cccccccccchhhhhhhccCCCHHHHHHHHhhcCceEEEeCCCc-chHHHHHHHHhc
Q 003455 131 PQMQNLDQNENNEAQAESRLSDAETVAKSFVQCSVSLSVICPKQ-LPKLTAIYNAAK 186 (818)
Q Consensus 131 p~~~~l~~~~~~~~~~~~~l~~~e~la~~~~~~~I~lSiIsPrk-lp~L~~lf~~a~ 186 (818)
...|.+...............+++++++.+.+++|.+-++..++ +..+++|-+...
T Consensus 164 d~~~~~~~~~~~~~~~~~dyps~~ql~~~l~~~~i~~ifavt~~~~~~Y~~l~~~~~ 220 (248)
T d1tyeb2 164 DGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIP 220 (248)
T ss_dssp CCCCCBCTTSBBGGGGTSCCCCHHHHHHHHHHTTEEEEEEECGGGHHHHHHHHHTST
T ss_pred CCccccCCCCcccccccccCCCHHHHHHHHHHhCcEEEEEECchhhHHHHHHHHhcC
Confidence 22222221111111222233479999999999999987777654 566666666553
|
| >d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mjna_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|