Citrus Sinensis ID: 003496


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-----
MFLDIACFLKGEDKDYVTKIQDDPNFAHYCLSVLVDKSLVTISCNNKVQMHDLLQKMGREIVRQESVKEPGKRSRLWHYEDVYHVLKKNKGTDAIEGILLNLSKTRDIHLDGNVFVNMSNLRFLKFYMPEYKGVPIMSSKVHLDQGLRYLPEELRYLHWHQYSLKTLPLNFDPENLIELNLPYSNVEQIWEGKKQAFKLKFIDLHHSQYLTKIPDLVETPNLERINLLNCTNLPYISSSIQNFNNLSVLSLAGCRSLVSFPRNIYFRSPIAVDFSDCVNLTEFPLVSGNIIELRLWNTRIEEVPSSIECLTNLETLDLSFCKRLKRVSTSICKLKSLCWLELGGCSNLETFPEILEKMEHLLEIDLRETAIRNLPSSIEYLEGLRKLDLGDCSELASLPEKLENLKSLKYLNAEFSAIGQLPSSISDLNQLKKLKFSGCRGLVLPPLLSGLSSLTELHLTDCNITEIPADIGSLSSIVWLALSGNHFERLPTSVKQLSQLRYLHLSNCNMLQSLPELPIYLVYLEAKNCKRLQTLPEIPSSVEELDASMLESIYEHSSGIMDGILFFDFTNCLKLNEKEAHKKILADSQQRIQHMASASLRLCYEMVHYTPYGLCNCFPGSEIPDWFSNQCSGSSLTIQLPRRSCGRNLVGFALCAVIQFEEDIDASGKYCNVKCNYNFETKTRLEANNNVDDYYNLSLNGSMDSDHVLLGFEPCWNTEVPDDGNNQTTISFEFSVECKNEKCHQVKCCGVCPVYANPNDNKPNTLKLILGSEEECTKIRILHDKVGMSGSYDDEDEMEPSPKRICRDQINTHQQ
cEEEEEEEcccccHHHHHHHHcccccccccHHHHcccccEEEccccEEEccHHHHHHHHHHHHHccccccccccccccHHHHHHHHccccccccEEEEEEEcccccEEEEcHHHHcccccccEEEEEcccccccccccccEEcccccccccccccEEEEcccccccccccccccccEEEEccccccccccccccccccccEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccccccccEEEcccccccccccEEEEEcccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEEccccccccccccccccccHHHHcccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccEEEcccccccEEccccccccccccccccccEEccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEcccccccccccccccccEEEEEcccccccccccEEEEEEEEEEcccccccccEEEEEEEEEEcccccccccccccccccccccccccccEEEEEEEccccccccccccccEEEEEEEEEEEcccccEEEEEEEEEEEEcccccccccccccccccccccccEEEEEEccccccccccccccccccHHHHHcccccccc
ccHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHcEEEEEcccccEEHHHHHHHHHHHHHHHcccccccccEEcccHHHHHHHHHccccccEEEEEEEEccccccccccHHHHHHccccEEEEEEccccccccccccEEEcccccccccHHcEEEEccccccccccccccHHHEEEEcccccHHHHHccccccHHcccEEEccccccccccccccccccHHEEEcccccccccccccHHHHHHccEEEccccccHccccccccHHHHHHEcccccccHHcccHHcccccEEEcccccHEccccHHHHcccccEEEcccccccccccccHcccccccEEEccccccHHcccHHHccHHHHHEEEccccccccccccHHHHHHccEEEccccccHccccccccccccccEEEccccccccccccHHcHHcccEEEccccccccccccccccccccEEEccccccEcccccHcccccccEEEccccccccccccHHHHHHccEEcccccccHcccccccccccEEEccccccHcccccccHHHHHHHHccccccccccccccccccEEEccccHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEcccccccHHHcccccccEEEEEccccccccccccEEEEEEEEcccccccccccEEEEEEEEEcccccccccccccccccccccccccccEEEEEEccccccccHHccccccEEEEEEEEEccccccEEEEEcEEEEEEEcccccccccccccccccccccccEEEEccccccccccccccccccccHHHHHHHccccc
MFLDIACflkgedkdyvtkiqddpnfaHYCLSVLVDKSLVTISCNNKVQMHDLLQKMGREIVrqesvkepgkrsrlwhYEDVYHVLKKNKGTDAIEGILLNLsktrdihldgnVFVNMSNLRFlkfympeykgvpimsskvhldqglrylpeELRYLHWHQYSlktlplnfdpenlielnlpysnveQIWEGKKQAFKLKFIDLHHSqyltkipdlvetpnlerinllnctnlpyisssiqnfnnlsVLSLAgcrslvsfprniyfrspiavdfsdcvnltefplvsgnIIELRLWNtrieevpssiecltnletldlSFCKRLKRVSTSIcklkslcwlelggcsnleTFPEILEKMEHLLEIDLRETAIRNLPSSIEYLEGLrkldlgdcselasLPEKLENLKSLKYLNAEFsaigqlpssisdlnqlkklkfsgcrglvlppllsglssltelhltdcniteipadigsLSSIVWLALsgnhferlptsvkQLSQLRYLHLSNcnmlqslpelpIYLVYLEAknckrlqtlpeipssVEELDASMLESIYEhssgimdgilffDFTNCLKLNEKEAHKKILADSQQRIQHMASASLRLCYEMvhytpyglcncfpgseipdwfsnqcsgssltiqlprrscgrnlVGFALCAVIQFEedidasgkycnvkcNYNFETKtrleannnvddyynlslngsmdsdhvllgfepcwntevpddgnnqttiSFEFSVEcknekchqvkccgvcpvyanpndnkpntLKLILGSEEECTKIRILhdkvgmsgsyddedemepspkricRDQINTHQQ
MFLDIACFLKGEDKDYVTKIQDDPNFAHYCLSVLVDKSLVTISCNNKVQMHDLLQKMGreivrqesvkepgkrsrlwhYEDVYHVlkknkgtdaIEGILLNLSKTRDIHLDGNVFVNMSNLRFLKFYMPEYKGVPIMSSKVHLDQGLRYLPEELRYLHWHQYSLKTLPLNFDPENLIELNLPYSNVEQIWEGKKQAFKLKFIDLHHSQYLTKIPDLVETPNLERINLLNCTNLPYISSSIQNFNNLSVLSLAGCRSLVSFPRNIYFRSPIAVDFSDCVNLTEFPLVSGNIIELRLWNTRIEEVPSSIECLTNLETLDLSFCKRLKRVStsicklkslcwlelggcSNLETFPEILEKMEHLLEIDLRETAIRNLPSSIEYLEGLRKLDLGDCSELASLPEKLENLKSLKYLNAEFSAIGQLPSSISDLNQLKKLKFSGCRGLVLPPLLSGLSSLTELHLTDCNITEIPADIGSLSSIVWLALSGNHFERLPTSVKQLSQLRYLHLSNCNMLQSLPELPIYLVYLEAKNCKRLQTLPEIPSSVEELDASMLESIYEHSSGIMDGILFFDFTNCLKLNEKEAHKKILADSQQRIQHMASASLRLCYEMVHYTPYGLCNCFPGSEIPDWFSNQCSGSSLTIQLPRRSCGRNLVGFALCAVIQFEEDIDASGKYCNVKCNYNFEtktrleannNVDDYYNLSLNGSMDSDHVLLGFEPCWNTEVPDDGNNQTTISFEFSVECKNEKCHQVKCCGVCPvyanpndnkPNTLKLILGSEEECTKIRIlhdkvgmsgsyddedemepspkricrdqinthqq
MFLDIACFLKGEDKDYVTKIQDDPNFAHYCLSVLVDKSLVTISCNNKVQMHDLLQKMGREIVRQESVKEPGKRSRLWHYEDVYHVLKKNKGTDAIEGILLNLSKTRDIHLDGNVFVNMSNLRFLKFYMPEYKGVPIMSSKVHLDQGLRYLPEELRYLHWHQYSLKTLPLNFDPENLIELNLPYSNVEQIWEGKKQAFKLKFIDLHHSQYLTKIPDLVETPNLERINLLNCTNLPYISSSIQNFNNLSVLSLAGCRSLVSFPRNIYFRSPIAVDFSDCVNLTEFPLVSGNIIELRLWNTRIEEVPSSIECLTNLETLDLSFCKRLKRVSTSICKLKSLCWLELGGCSNLETFPEILEKMEHLLEIDLRETAIRNLPSSIEYLEGLRKLDLGDCSELASLPEKLENLKSLKYLNAEFSAIGQLPSSISDLNQLKKLKFSGCRglvlppllsglssltelhltDCNITEIPADIGSLSSIVWLALSGNHFERLPTSVKQLSQLRYLHLSNCNMLQSLPELPIYLVYLEAKNCKRLQTLPEIPSSVEELDASMLESIYEHSSGIMDGILFFDFTNCLKLNEKEAHKKILADSQQRIQHMASASLRLCYEMVHYTPYGLCNCFPGSEIPDWFSNQCSGSSLTIQLPRRSCGRNLVGFALCAVIQFEEDIDASGKYCNVKCNYNFETKTRLEANNNVDDYYNLSLNGSMDSDHVLLGFEPCWNTEVPDDGNNQTTISFEFSVECKNEKCHQVKCCGVCPVYANPNDNKPNTLKLILGSEEECTKIRILHDKVGMSGSYDDEDEMEPSPKRICRDQINTHQQ
*FLDIACFLKGEDKDYVTKIQDDPNFAHYCLSVLVDKSLVTISCNNKVQMHDLLQKMGREIV***********SRLWHYEDVYHVLKKNKGTDAIEGILLNLSKTRDIHLDGNVFVNMSNLRFLKFYMPEYKGVPIMSSKVHLDQGLRYLPEELRYLHWHQYSLKTLPLNFDPENLIELNLPYSNVEQIWEGKKQAFKLKFIDLHHSQYLTKIPDLVETPNLERINLLNCTNLPYISSSIQNFNNLSVLSLAGCRSLVSFPRNIYFRSPIAVDFSDCVNLTEFPLVSGNIIELRLWNTRIEEVPSSIECLTNLETLDLSFCKRLKRVSTSICKLKSLCWLELGGCSNLETFPEILEKMEHLLEIDLRETAIRNLPSSIEYLEGLRKLDLGDCSELASLPEKLENLKSLKYLNAEFSAIGQLPSSISDLNQLKKLKFSGCRGLVLPPLLSGLSSLTELHLTDCNITEIPADIGSLSSIVWLALSGNHFERLPTSVKQLSQLRYLHLSNCNMLQSLPELPIYLVYLEAKNCKRLQTLPEIP**VEELDASMLESIYEHSSGIMDGILFFDFTNCLKLNEKEAHKKILADSQQRIQHMASASLRLCYEMVHYTPYGLCNCFPGSEIPDWFSNQCSGSSLTIQLPRRSCGRNLVGFALCAVIQFEEDIDASGKYCNVKCNYNFETKTRLEANNNVDDYYNLSLNGSMDSDHVLLGFEPCWNTEVPDDGNNQTTISFEFSVECKNEKCHQVKCCGVCPVYANPNDNKPNTLKLILGSEEECTKIRILHDK******************************
MFLDIACFLKGEDKDYVTKIQDDPNFAHYCLSVLVDKSLVTISCNNKVQMHDLLQKMGREIVRQESVKEPGKRSRLWHYEDVYHVLKKNKGTDAIEGILLNLSKTRDIHLDGNVFVNMSNLRFLKFYMPEYKGVPIMSSKVHLDQGLRYLPEELRYLHWHQYSLKTLPLNFDPENLIELNLPYSNVEQIWEGKKQAFKLKFIDLHHSQYLTKIPDLVETPNLERINLLNCTNLPYISSSIQNFNNLSVLSLAGCRSLVSFPRNIYFRSPIAVDFSDCVNLTEFPLVSGNIIELRLWNTRIEEVPSSIECLTNLETLDLSFCKRLKRVSTSICKLKSLCWLELGGCSNLETFPEILEKMEHLLEIDLRETAIRNLPSSIEYLEGLRKLDLGDCSELASLPEKLENLKSLKYLNAEFSAIGQLPSSISDLNQLKKLKFSGCRGLVLPPLLSGLSSLTELHLTDCNITEIPADIGSLSSIVWLALSGNHFERLPTSVKQLSQLRYLHLSNCNMLQSLPELPIYLVYLEAKNCKRLQTLPEIPSSVEELDASMLESIYEHSSGIMDGILFFDFTNCLKLNEKEAHKKILADSQQRIQHMASASLRLCYEMVHYTPYGLCNCFPGSEIPDWFSNQCSGSSLTIQLPRRSCGRNLVGFALCAVIQFEEDIDASGKYCNVKCNYNFETKTRLEANNNVDDYYNLSLNGSMDSDHVLLGFEPCWNTEVPDDGNNQTTISFEFSVECKNEKCHQVKCCGVCPVYA***********************************************************
MFLDIACFLKGEDKDYVTKIQDDPNFAHYCLSVLVDKSLVTISCNNKVQMHDLLQKMGREIVR*********RSRLWHYEDVYHVLKKNKGTDAIEGILLNLSKTRDIHLDGNVFVNMSNLRFLKFYMPEYKGVPIMSSKVHLDQGLRYLPEELRYLHWHQYSLKTLPLNFDPENLIELNLPYSNVEQIWEGKKQAFKLKFIDLHHSQYLTKIPDLVETPNLERINLLNCTNLPYISSSIQNFNNLSVLSLAGCRSLVSFPRNIYFRSPIAVDFSDCVNLTEFPLVSGNIIELRLWNTRIEEVPSSIECLTNLETLDLSFCKRLKRVSTSICKLKSLCWLELGGCSNLETFPEILEKMEHLLEIDLRETAIRNLPSSIEYLEGLRKLDLGDCSELASLPEKLENLKSLKYLNAEFSAIGQLPSSISDLNQLKKLKFSGCRGLVLPPLLSGLSSLTELHLTDCNITEIPADIGSLSSIVWLALSGNHFERLPTSVKQLSQLRYLHLSNCNMLQSLPELPIYLVYLEAKNCKRLQTLPEIPSSVEELDASMLESIYEHSSGIMDGILFFDFTNCLKLNEKEAHKKILADSQQRIQHMASASLRLCYEMVHYTPYGLCNCFPGSEIPDWFSNQCSGSSLTIQLPRRSCGRNLVGFALCAVIQFEEDIDASGKYCNVKCNYNFETKTRLEANNNVDDYYNLSLNGSMDSDHVLLGFEPCWNTEVPDDGNNQTTISFEFSVECKNEKCHQVKCCGVCPVYANPNDNKPNTLKLILGSEEECTKIRILHDKVGMSG***********PKRICRDQINTHQQ
MFLDIACFLKGEDKDYVTKIQDDPNFAHYCLSVLVDKSLVTISCNNKVQMHDLLQKMGREIVRQESVKEPGKRSRLWHYEDVYHVLKKNKGTDAIEGILLNLSKTRDIHLDGNVFVNMSNLRFLKFYMPEYKGVPIMSSKVHLDQGLRYLPEELRYLHWHQYSLKTLPLNFDPENLIELNLPYSNVEQIWEGKKQAFKLKFIDLHHSQYLTKIPDLVETPNLERINLLNCTNLPYISSSIQNFNNLSVLSLAGCRSLVSFPRNIYFRSPIAVDFSDCVNLTEFPLVSGNIIELRLWNTRIEEVPSSIECLTNLETLDLSFCKRLKRVSTSICKLKSLCWLELGGCSNLETFPEILEKMEHLLEIDLRETAIRNLPSSIEYLEGLRKLDLGDCSELASLPEKLENLKSLKYLNAEFSAIGQLPSSISDLNQLKKLKFSGCRGLVLPPLLSGLSSLTELHLTDCNITEIPADIGSLSSIVWLALSGNHFERLPTSVKQLSQLRYLHLSNCNMLQSLPELPIYLVYLEAKNCKRLQTLPEIPSSVEELDASMLESIYEHSSGIMDGILFFDFTNCLKLNEKEAHKKILADSQQRIQHMASASLRLCYEMVHYTPYGLCNCFPGSEIPDWFSNQCSGSSLTIQLPRRSCGRNLVGFALCAVIQFEEDIDASGKYCNVKCNYNFETKTRLEANNNVDDYYNLSLNGSMDSDHVLLGFEPCWNTEVPDDGNNQTTISFEFSVECKNEKCHQVKCCGVCPVYANP*********************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLDIACFLKGEDKDYVTKIQDDPNFAHYCLSVLVDKSLVTISCNNKVQMHDLLQKMGREIVRQESVKEPGKRSRLWHYEDVYHVLKKNKGTDAIEGILLNLSKTRDIHLDGNVFVNMSNLRFLKFYMPEYKGVPIMSSKVHLDQGLRYLPEELRYLHWHQYSLKTLPLNFDPENLIELNLPYSNVEQIWEGKKQAFKLKFIDLHHSQYLTKIPDLVETPNLERINLLNCTNLPYISSSIQNFNNLSVLSLAGCRSLVSFPRNIYFRSPIAVDFSDCVNLTEFPLVSGNIIELRLWNTRIEEVPSSIECLTNLETLDLSFCKRLKRVSTSICKLKSLCWLELGGCSNLETFPEILEKMEHLLEIDLRETAIRNLPSSIEYLEGLRKLDLGDCSELASLPEKLENLKSLKYLNAEFSAIGQLPSSISDLNQLKKLKFSGCRGLVLPPLLSGLSSLTELHLTDCNITEIPADIGSLSSIVWLALSGNHFERLPTSVKQLSQLRYLHLSNCNMLQSLPELPIYLVYLEAKNCKRLQTLPEIPSSVEELDASMLESIYEHSSGIMDGILFFDFTNCLKLNEKEAHKKILADSQQRIQHMASASLRLCYEMVHYTPYGLCNCFPGSEIPDWFSNQCSGSSLTIQLPRRSCGRNLVGFALCAVIQFEEDIDASGKYCNVKCNYNFETKTRLEANNNVDDYYNLSLNGSMDSDHVLLGFEPCWNTEVPDDGNNQTTISFEFSVECKNEKCHQVKCCGVCPVYANPNDNKPNTLKLILGSEEECTKIRILHDKVGMSGSYDDEDEMEPSPKRICRDQINTHQQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query815 2.2.26 [Sep-21-2011]
Q9SZ671895 Probable WRKY transcripti no no 0.468 0.201 0.452 3e-76
O235301301 Protein SUPPRESSOR OF npr no no 0.626 0.392 0.318 2e-62
Q403921144 TMV resistance protein N N/A no 0.592 0.422 0.348 4e-61
O825001095 Putative disease resistan no no 0.467 0.347 0.329 1e-52
Q9FH831288 Probable WRKY transcripti no no 0.503 0.318 0.351 9e-52
Q9FL92 1372 Probable WRKY transcripti no no 0.477 0.283 0.345 5e-50
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.467 0.236 0.298 8e-35
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.375 0.298 0.290 3e-19
P0CB161201 Putative disease resistan no no 0.338 0.229 0.292 2e-17
Q9BTT6524 Leucine-rich repeat-conta yes no 0.273 0.425 0.330 4e-16
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function desciption
 Score =  287 bits (734), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 179/396 (45%), Positives = 228/396 (57%), Gaps = 14/396 (3%)

Query: 1    MFLDIACFLKGEDKDYVTKIQDDPNF-AHYCLSVLVDKSLVTISCNNKVQMHDLLQKMGR 59
            +FLDIACF    DKD V  + D   F AH     LVDKSL+TIS +N V M   +Q  GR
Sbjct: 1058 IFLDIACFFNRIDKDNVAMLLDGCGFSAHVGFRGLVDKSLLTISQHNLVDMLSFIQATGR 1117

Query: 60   EIVRQESVKEPGKRSRLWHYEDVYHVLKKNKGTDAIEGILLNLSKTRDIHLDGNVFVNMS 119
            EIVRQES   PG RSRLW+ + + HV   + GT AIEGI L++   +    + NVF  M 
Sbjct: 1118 EIVRQESADRPGDRSRLWNADYIRHVFINDTGTSAIEGIFLDMLNLK-FDANPNVFEKMC 1176

Query: 120  NLRFLKFYMPEYKGVPIMSSKVHLDQGLRYLPEELRYLHWHQYSLKTLPLNFDPENLIEL 179
            NLR LK Y  + +        V   QGL YLP +LR LHW  Y L +LP +F+PENL+EL
Sbjct: 1177 NLRLLKLYCSKAE----EKHGVSFPQGLEYLPSKLRLLHWEYYPLSSLPKSFNPENLVEL 1232

Query: 180  NLPYSNVEQIWEGKKQAF--------KLKFIDLHHSQYLTKIPDLVETPNLERINLLNCT 231
            NLP S  +++W+GKK  F        KLK + L +S  LTKIP L    NLE I+L  C 
Sbjct: 1233 NLPSSCAKKLWKGKKARFCTTNSSLEKLKKMRLSYSDQLTKIPRLSSATNLEHIDLEGCN 1292

Query: 232  NLPYISSSIQNFNNLSVLSLAGCRSLVSFPRNIYFRSPIAVDFSDCVNLTEFPLVSGNII 291
            +L  +S SI     L  L+L GC  L + P  +   S   ++ S C  L  FP +S N+ 
Sbjct: 1293 SLLSLSQSISYLKKLVFLNLKGCSKLENIPSMVDLESLEVLNLSGCSKLGNFPEISPNVK 1352

Query: 292  ELRLWNTRIEEVPSSIECLTNLETLDLSFCKRLKRVSTSICKLKSLCWLELGGCSNLETF 351
            EL +  T I+E+PSSI+ L  LE LDL   + LK + TSI KLK L  L L GC +LE F
Sbjct: 1353 ELYMGGTMIQEIPSSIKNLVLLEKLDLENSRHLKNLPTSIYKLKHLETLNLSGCISLERF 1412

Query: 352  PEILEKMEHLLEIDLRETAIRNLPSSIEYLEGLRKL 387
            P+   +M+ L  +DL  T I+ LPSSI YL  L +L
Sbjct: 1413 PDSSRRMKCLRFLDLSRTDIKELPSSISYLTALDEL 1448




Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. May act also as a disease resistance protein with a serine/threonine-protein kinase activity.
Arabidopsis thaliana (taxid: 3702)
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query815
359486071 1261 PREDICTED: TMV resistance protein N-like 0.880 0.569 0.381 1e-121
359486073 1296 PREDICTED: TMV resistance protein N-like 0.872 0.548 0.381 1e-121
359486075 1291 PREDICTED: TMV resistance protein N-like 0.907 0.573 0.367 1e-120
147770134 1414 hypothetical protein VITISV_040107 [Viti 0.907 0.523 0.364 1e-118
359487015 1610 PREDICTED: TMV resistance protein N-like 0.923 0.467 0.367 1e-117
224145016 1254 tir-nbs-lrr resistance protein [Populus 0.844 0.548 0.362 1e-115
255537139 1137 leucine-rich repeat-containing protein, 0.782 0.561 0.376 1e-114
451798990 1335 TMV resistance protein N-like protein 7 0.793 0.484 0.393 1e-114
451798988 1219 TMV resistance protein N-like protein 6 0.787 0.526 0.393 1e-113
255563202 1158 leucine-rich repeat containing protein, 0.705 0.496 0.393 1e-111
>gi|359486071|ref|XP_002272667.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  443 bits (1139), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 311/815 (38%), Positives = 428/815 (52%), Gaps = 97/815 (11%)

Query: 1    MFLDIACFLKGEDKDYVTKIQDDPNF-AHYCLSVLVDKSLVTISCNNKVQMHDLLQKMGR 59
            +FLDIACF KG+DKDYV K+    +F     +  L+DKSLVTIS  NK+ MHDL+Q+MG 
Sbjct: 440  IFLDIACFFKGQDKDYVIKLLKSCDFFPEIEIRNLIDKSLVTIS-YNKLCMHDLIQEMGW 498

Query: 60   EIVRQESVKEPGKRSRLWHYEDVYHVLKKNKGTDAIEGILLNLSKTRDIHLDGNVFVNMS 119
            EIVRQES+K+PGKRSRLW  +DV  +L  N GT+A+EG++LNLS  +++H   NVF  M+
Sbjct: 499  EIVRQESIKDPGKRSRLWVNDDVIDMLTTNTGTEAVEGMVLNLSTLKELHFSVNVFTKMN 558

Query: 120  NLRFLKFYMPEYKGV------------PIMSSKVHLDQGLRYLPEELRYLHWHQYSLKTL 167
             LR L+FY  +  G             P    K HL    ++L   LR LHW  Y LK+L
Sbjct: 559  KLRVLRFYDAQIWGSSWIGRHNDRYKSPYTECKFHLSGDFKFLSNHLRSLHWDGYPLKSL 618

Query: 168  PLNFDPENLIELNLPYSNVEQIWEGKKQAFKLKFIDLHHSQYLTKIPDLVETPNLERINL 227
            P NF PE L+EL + +S +EQ+WEG K   KLKFI+L HSQ+L K PD    P L RI L
Sbjct: 619  PSNFHPEKLLELKMCFSQLEQLWEGNKSFQKLKFIELSHSQHLIKTPDFSGAPKLRRIIL 678

Query: 228  LNCTNLPYISSSIQNFNNLSVLSLAGCRSLVSFPRNIYFRSPIAVDFSDCVNLTEFPLVS 287
              CT+L  +  SI     L  L+L GC++L SF  +I+  S   +  S C  L +FP V 
Sbjct: 679  EGCTSLVKVHPSIGALKKLIFLNLEGCKNLKSFSSSIHLESLQTITLSGCSKLKKFPEVQ 738

Query: 288  G---NIIELRLWNTRIEEVPSSIECLTNLETLDLSFCKRLKRVSTSICKLKSLCWLELGG 344
            G   N+ EL L  T I+ +P SIE L  L  L+L  CK L+ +   I KLKSL  L L  
Sbjct: 739  GAMDNLPELSLKGTAIKGLPLSIEYLNGLSLLNLEECKSLESLPGCIFKLKSLKTLILSN 798

Query: 345  CSNLETFPEILEKMEHLLEIDLRETAIRNLPSSIEYLEG--------------------- 383
            CS L+  PEI E ME L ++ L +T +R LPSSIE+L G                     
Sbjct: 799  CSRLKKLPEIQENMESLKKLFLDDTGLRELPSSIEHLNGLVLLKLKNCKKLASLPESICK 858

Query: 384  ---LRKLDLGDCSELASLPEKLENLKSLKYLNAEFSAIGQLPSSISDLNQLKKLKFSGCR 440
               L+ L L  CSEL  LP+ + +L+ L  L A  + I ++P+SI+ L +L+ L  +GC+
Sbjct: 859  LTSLQTLTLSGCSELKKLPDDMGSLQCLVKLKANGTGIQEVPTSITLLTKLEVLSLAGCK 918

Query: 441  G-------LVL-----------PPLLSGLSSLTELHLTDCNITE--IPADIGSLSSIVWL 480
            G       L L           P  L  L SL +L+L+ CN+ E  +P+D+ SLS +  L
Sbjct: 919  GGESKSRNLALCLRSSPTKGLRPSFLPVLYSLRKLNLSGCNLLEGALPSDLSSLSWLECL 978

Query: 481  ALSGNHFERLPTSVKQLSQLRYLHLSNCNMLQSLPELPIYLVYLEAKNCKRLQTLPEIPS 540
             LS N F  +P ++ +L +L+ L L +C  L+SLPELP  +  L A +C  L+T    PS
Sbjct: 979  DLSRNSFITVP-NLSRLPRLKRLILEHCKSLRSLPELPSNIEKLLANDCTSLETFSN-PS 1036

Query: 541  SVEELDASMLESIYEHSSGIMDGILFFDFTNCLKLNEKEAHKKILADSQQRIQHMASASL 600
            S      S       H        L F F NC +L E E    + A   + I+ +AS S 
Sbjct: 1037 SAYAWRNS------RH--------LNFQFYNCFRLVENEQSDNVEA-ILRGIRLVASIS- 1080

Query: 601  RLCYEMVHYTPYGLCNCFPGSEIPDWFSNQCSGSSLTIQLPRRSCGRNLVGFALCAVIQF 660
               +   HY         PGS IP+WF++Q  G S+T++LP   C   L+G A+C V  F
Sbjct: 1081 --NFVAPHYELKWYDAVVPGSSIPEWFTDQSLGCSVTVELPPHWCTTRLMGLAVCFV--F 1136

Query: 661  EEDIDASGKYCNVKCNYNFETKTRLEANNNVDDYYNLSLNGSMDSDHVLLGFEPCWNTEV 720
              +I   GK+   +  ++         +N    +++        +DH+  G+ P +  EV
Sbjct: 1137 HPNI-GMGKFGRSE-YFSMNESGGFSLHNTASTHFS-------KADHIWFGYRPLYG-EV 1186

Query: 721  PDDGNNQTTISFEFSVECKNEKCHQVKCCGVCPVY 755
                 +   +SF  S    N     VK CG   V+
Sbjct: 1187 FSPSIDHLKVSFAGS----NRAGEVVKKCGARLVF 1217




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359486073|ref|XP_002272820.2| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147770134|emb|CAN76615.1| hypothetical protein VITISV_040107 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487015|ref|XP_003633506.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224145016|ref|XP_002325496.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862371|gb|EEE99877.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|451798990|gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca] Back     alignment and taxonomy information
>gi|451798988|gb|AGF69192.1| TMV resistance protein N-like protein 6 [Vitis labrusca] Back     alignment and taxonomy information
>gi|255563202|ref|XP_002522604.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223538080|gb|EEF39691.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query815
TAIR|locus:21759911294 AT5G17680 [Arabidopsis thalian 0.655 0.412 0.361 1.6e-93
TAIR|locus:21181161895 WRKY19 [Arabidopsis thaliana ( 0.468 0.201 0.452 2.1e-74
TAIR|locus:21181061219 AT4G12010 [Arabidopsis thalian 0.533 0.356 0.382 4.7e-71
TAIR|locus:2155189980 AT5G49140 [Arabidopsis thalian 0.493 0.410 0.364 2.1e-64
TAIR|locus:2146243900 AT5G18360 [Arabidopsis thalian 0.483 0.437 0.371 2.3e-64
TAIR|locus:21533631261 AT5G45200 [Arabidopsis thalian 0.534 0.345 0.355 2.7e-64
TAIR|locus:21530721229 AT5G51630 [Arabidopsis thalian 0.652 0.432 0.324 7.5e-62
TAIR|locus:2827629 1355 AT2G17050 [Arabidopsis thalian 0.515 0.309 0.344 6.5e-61
TAIR|locus:21229651210 AT4G19510 [Arabidopsis thalian 0.482 0.324 0.367 1.1e-60
TAIR|locus:21703331197 CSA1 "constitutive shade-avoid 0.512 0.349 0.360 1.3e-60
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 810 (290.2 bits), Expect = 1.6e-93, Sum P(2) = 1.6e-93
 Identities = 201/556 (36%), Positives = 303/556 (54%)

Query:     1 MFLDIACFLKGEDKDYVTKIQDDPNFA-HYCLSVLVDKSLVTISCNNKVQMHDLLQKMGR 59
             +FL I+CF   +  DYV K+ D   +A    +++L +KSL+ +  N  V++HDLL++MGR
Sbjct:   433 IFLYISCFYNMKQVDYVRKLLDLCGYAAEIGITILTEKSLI-VESNGCVKIHDLLEQMGR 491

Query:    60 EIVRQESVKEPGKRSRLWHYEDVYHVLKKNKGTDAIEGILLNLSKTRDIHLDGNVFVNMS 119
             E+VRQ++V  P +R  LW  ED+ H+L +N GT  +EGI LNLS+  ++      F  +S
Sbjct:   492 ELVRQQAVNNPAQRLLLWDPEDICHLLSENSGTQLVEGISLNLSEISEVFASDRAFEGLS 551

Query:   120 NLRFLKFYMPEYKGVPIMSSKVHLDQGLRYLPEELRYLHWHQYSLKTLPLNFDPENLIEL 179
             NL+ L FY   + G     ++VHL  GL YLP +LRYL W  Y LKT+P  F PE L+EL
Sbjct:   552 NLKLLNFYDLSFDG----ETRVHLPNGLSYLPRKLRYLRWDGYPLKTMPSRFFPEFLVEL 607

Query:   180 NLPYSNVEQIWEGKKQAFKLKFIDLHHSQYLTKIPDLVETPNLERINLLNCTNLPYISSS 239
              +  SN+E++W+G +    LK +DL   +YL ++PDL +  NLE +NL  C +L  ++ S
Sbjct:   608 CMSNSNLEKLWDGIQPLRNLKKMDLSRCKYLVEVPDLSKATNLEELNLSYCQSLVEVTPS 667

Query:   240 IQNFNNLSVLSLAGCRSLVSFPRNIYFRSPIAVDFSDCVNLTEFPLVSGNIIELRLWNTR 299
             I+N   LS   L  C  L   P  I  +S   V  S C +L  FP +S N   L L +T+
Sbjct:   668 IKNLKGLSCFYLTNCIQLKDIPIGIILKSLETVGMSGCSSLKHFPEISWNTRRLYLSSTK 727

Query:   300 IEEVPSSIECLTNLETLDLSFCKRLKRVSTSICKLKSLCWLELGGCSNLETFPEILEKME 359
             IEE+PSSI  L+ L  LD+S C+RL+ + + +  L SL  L L GC  LE  P+ L+ + 
Sbjct:   728 IEELPSSISRLSCLVKLDMSDCQRLRTLPSYLGHLVSLKSLNLDGCRRLENLPDTLQNLT 787

Query:   360 HLLEIDLRETA-IRNLPSSIEYLEGLRKLDLGDCSELASLPEKLENLKSLKYLN-AEFSA 417
              L  +++     +   P     +E LR   + + S +  +P ++ NL  L+ L+ +E   
Sbjct:   788 SLETLEVSGCLNVNEFPRVSTSIEVLR---ISETS-IEEIPARICNLSQLRSLDISENKR 843

Query:   418 IGQLPSSISDLNQLKKLKFSGCRXXXXXXXXXXXXXXXXX-XXXD-CNITEIPADIGSLS 475
             +  LP SIS+L  L+KLK SGC                      D  +I E+P +IG+L 
Sbjct:   844 LASLPVSISELRSLEKLKLSGCSVLESFPLEICQTMSCLRWFDLDRTSIKELPENIGNLV 903

Query:   476 SIVWLALSGNHFERLPTSVKQLSQLRYLHLSNC-----NMLQSL-PELPIYLVYLEAKNC 529
             ++  L  S     R P S+ +L++L+ L + N       +L SL P L  +   L A + 
Sbjct:   904 ALEVLQASRTVIRRAPWSIARLTRLQVLAIGNSFFTPEGLLHSLCPPLSRF-DDLRALSL 962

Query:   530 KRLQTLPEIPSSVEEL 545
               +  + EIP+S+  L
Sbjct:   963 SNMN-MTEIPNSIGNL 977


GO:0005622 "intracellular" evidence=IEA
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155189 AT5G49140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146243 AT5G18360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153072 AT5G51630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827629 AT2G17050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query815
PLN032101153 PLN03210, PLN03210, Resistant to P 6e-74
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-13
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-07
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 2e-07
PRK15387788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 3e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
pfam0772520 pfam07725, LRR_3, Leucine Rich Repeat 0.002
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score =  262 bits (670), Expect = 6e-74
 Identities = 202/685 (29%), Positives = 310/685 (45%), Gaps = 112/685 (16%)

Query: 1    MFLDIACFLKGEDKDYVTKIQDDPNF-AHYCLSVLVDKSLVTISCNNKVQMHDLLQKMGR 59
            +F  IAC   GE  + +  +  + +   +  L  LVDKSL+ +   + V+MH LLQ+MG+
Sbjct: 441  IFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVR-EDIVEMHSLLQEMGK 499

Query: 60   EIVRQESVKEPGKRSRLWHYEDVYHVLKKNKGTDAIEGILLNLSKTRDIHLDGNVFVNMS 119
            EIVR +S  EPG+R  L   +D+  VL+ N GT  + GI L++ +  ++H+  N F  M 
Sbjct: 500  EIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHENAFKGMR 558

Query: 120  NLRFLKFYMPEYKGVPIMSSKV--HLDQGLRYLPEELRYLHWHQYSLKTLPLNFDPENLI 177
            NL FLKFY  ++        +V  HL +G  YLP +LR L W +Y L+ +P NF PENL+
Sbjct: 559  NLLFLKFYTKKWD----QKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLV 614

Query: 178  ELNLPYSNVEQIWEGKKQAFKLKFIDLHHSQYLTKIPDLVETPNLERINLLNCTNLPYIS 237
            +L +  S +E++W+G      L+ IDL  S+ L +IPDL    NLE + L +C++L  + 
Sbjct: 615  KLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVELP 674

Query: 238  SSIQNFNNLSVLSLAGCRSLVSFPRNIYFRSPIAVDFSDCVNLTEFPLVSGNIIELRLWN 297
            SSIQ  N L  L ++ C +L   P  I  +S   ++ S C  L  FP +S NI  L L  
Sbjct: 675  SSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPDISTNISWLDLDE 734

Query: 298  TRIEEVPSSIECLTNLETLDLSFCKRLKRVSTSICKLKSLCWLELGGCSNLETFPEILEK 357
            T IEE PS++  L NL+ L              +C++KS           L    + L  
Sbjct: 735  TAIEEFPSNLR-LENLDEL-------------ILCEMKS---------EKLWERVQPLTP 771

Query: 358  MEHLLEIDLRETAIRNLPSSIEYLEGLRKLDLGDCSELASLPEKLENLKSLKYLNAEFSA 417
            +  +L   L    + ++PS +E                                      
Sbjct: 772  LMTMLSPSLTRLFLSDIPSLVE-------------------------------------- 793

Query: 418  IGQLPSSISDLNQLKKLKFSGCRGLVLPPLLSGLSSLTELHLTDCNITEIPADIGSLSSI 477
               LPSSI +L++L+ L+   C  L   P    L SL  L L+ C+      DI +  +I
Sbjct: 794  ---LPSSIQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGCSRLRTFPDIST--NI 848

Query: 478  VWLALSGNHFERLPTSVKQLSQLRYLHLSNCNMLQSLPELPIYLVYLEA---KNCKRLQT 534
              L LS    E +P  +++ S L +L ++ CN LQ +      L +LE     +C  L  
Sbjct: 849  SDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTE 908

Query: 535  LPEIPSSVEELDASMLESIYEHSSGIMDGILFFDFTNCLKLNEKEAHKKILADSQQRIQH 594
                 S  E   A+  ++I+      +   +  +F NC  L+     + +L       Q 
Sbjct: 909  ASWNGSPSEVAMAT--DNIHSK----LPSTVCINFINCFNLD----QEALL------QQQ 952

Query: 595  MASASLRLCYEMVHYTPYGLCNCFPGSEIPDWFSNQCSGSSLT-IQLPRRSCGRNLVGFA 653
                 L L                 G E+P +F+++ +G+SLT I L   S  +    F 
Sbjct: 953  SIFKQLIL----------------SGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFR 996

Query: 654  LCAVIQFEE-DIDASGKYCNVKCNY 677
             CAV+  E   I +      V C +
Sbjct: 997  ACAVVDSESFFIISVSFDIQVCCRF 1021


syringae 6; Provisional. Length = 1153

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|191828 pfam07725, LRR_3, Leucine Rich Repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 815
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.95
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.92
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.92
PLN032101153 Resistant to P. syringae 6; Provisional 99.9
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.89
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.77
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.75
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.66
KOG4237498 consensus Extracellular matrix protein slit, conta 99.65
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.51
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.47
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.47
KOG0617264 consensus Ras suppressor protein (contains leucine 99.45
KOG4237498 consensus Extracellular matrix protein slit, conta 99.38
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.23
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.97
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.94
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.91
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.89
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.89
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.84
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.8
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.71
PRK15386426 type III secretion protein GogB; Provisional 98.67
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.62
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.62
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.57
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.54
PLN03150623 hypothetical protein; Provisional 98.32
PLN03150623 hypothetical protein; Provisional 98.26
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.21
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.21
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.19
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.17
PRK15386426 type III secretion protein GogB; Provisional 98.08
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.07
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.02
KOG4341483 consensus F-box protein containing LRR [General fu 97.96
KOG4341483 consensus F-box protein containing LRR [General fu 97.95
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.83
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.82
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.78
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.74
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.68
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.56
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.54
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.52
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.48
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.3
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.0
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.0
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.99
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.82
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.54
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.23
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.91
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.67
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.44
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.24
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.66
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.97
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.79
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.48
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.29
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 90.61
PF0772520 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le 89.59
KOG4308478 consensus LRR-containing protein [Function unknown 87.85
smart0037026 LRR Leucine-rich repeats, outliers. 85.82
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.82
smart0037026 LRR Leucine-rich repeats, outliers. 81.8
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 81.8
KOG0473326 consensus Leucine-rich repeat protein [Function un 81.74
>PLN03210 Resistant to P Back     alignment and domain information
Probab=100.00  E-value=3.2e-71  Score=681.32  Aligned_cols=644  Identities=31%  Similarity=0.493  Sum_probs=483.2

Q ss_pred             CEeEEeeecCCCChhHHHHhhcCCCc-hhhcHHhhhcCccEEEccCCeEEecHHHHHHHHHHHHhcccCCCCCcccccch
Q 003496            1 MFLDIACFLKGEDKDYVTKIQDDPNF-AHYCLSVLVDKSLVTISCNNKVQMHDLLQKMGREIVRQESVKEPGKRSRLWHY   79 (815)
Q Consensus         1 iFl~~a~F~~~~~~~~l~~lw~a~gf-~~~~i~~L~~rsli~~~~~~~~~MHDLl~d~a~~i~~~e~~~~~~~~~~l~~~   79 (815)
                      +|+||||||+|++++++..++.++|+ ++.|++.|++||||++. +++++||||+||||++|+++++ .+|++|+|+|++
T Consensus       441 ~Fl~ia~ff~~~~~~~v~~~l~~~~~~~~~~l~~L~~ksLi~~~-~~~~~MHdLl~~~~r~i~~~~~-~~~~~r~~l~~~  518 (1153)
T PLN03210        441 IFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVR-EDIVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDA  518 (1153)
T ss_pred             hhheehhhcCCCCHHHHHHHHHhcCCCchhChHHHHhcCCEEEc-CCeEEhhhHHHHHHHHHHHhhc-CCCCcceeEeCH
Confidence            69999999999999999999999999 99999999999999998 7899999999999999999998 799999999999


Q ss_pred             hHHHHHHhhCccccceeEEEecCCCCcceeeccccccccCCceEEEEeCCCCCCccccCcccccCCCCCCCCcCcceEEe
Q 003496           80 EDVYHVLKKNKGTDAIEGILLNLSKTRDIHLDGNVFVNMSNLRFLKFYMPEYKGVPIMSSKVHLDQGLRYLPEELRYLHW  159 (815)
Q Consensus        80 ~di~~vl~~~~~~~~v~~i~l~~~~~~~~~l~~~~f~~~~~Lr~L~l~~~~l~~~~~~~~~~~l~~~l~~l~~~Lr~L~l  159 (815)
                      +||++|+.+++|++++++|+++.+...+..+...+|.+|++|++|+++.+.+..  .......+|.++..+|.+||+|+|
T Consensus       519 ~di~~vl~~~~g~~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~~~--~~~~~~~lp~~~~~lp~~Lr~L~~  596 (1153)
T PLN03210        519 KDICDVLEDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQ--KKEVRWHLPEGFDYLPPKLRLLRW  596 (1153)
T ss_pred             HHHHHHHHhCcccceeeEEEeccCccceeeecHHHHhcCccccEEEEecccccc--cccceeecCcchhhcCcccEEEEe
Confidence            999999999999999999999999999999999999999999999998765421  122446789999999999999999


Q ss_pred             CCCCCCCCCCCCCCccceeeecCCCCcccccccccCCCCccEEecCCCCCCCcCCCCCCCCCCcEEecCCCCCCCCcccc
Q 003496          160 HQYSLKTLPLNFDPENLIELNLPYSNVEQIWEGKKQAFKLKFIDLHHSQYLTKIPDLVETPNLERINLLNCTNLPYISSS  239 (815)
Q Consensus       160 ~~~~l~~lp~~~~l~~L~~L~L~~~~i~~lp~~~~~l~~L~~L~L~~~~~~~~~p~l~~l~~L~~L~L~~~~~~~~~~~~  239 (815)
                      .+|+++.+|..|.+.+|++|+|+++.++.+|.++..+++|+.|+|+++..+..+|+++.+++|+.|++++|..+..+|.+
T Consensus       597 ~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~ls~l~~Le~L~L~~c~~L~~lp~s  676 (1153)
T PLN03210        597 DKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVELPSS  676 (1153)
T ss_pred             cCCCCCCCCCcCCccCCcEEECcCccccccccccccCCCCCEEECCCCCCcCcCCccccCCcccEEEecCCCCccccchh
Confidence            99999999999999999999999999999999999999999999999998899999999999999999999999999999


Q ss_pred             cCCCCcccEEecCCCCCCcccCCcccCCCCcEEEecCCCCCCccCCCcccceEEEecCccccccchhhhccCCCCEEecc
Q 003496          240 IQNFNNLSVLSLAGCRSLVSFPRNIYFRSPIAVDFSDCVNLTEFPLVSGNIIELRLWNTRIEEVPSSIECLTNLETLDLS  319 (815)
Q Consensus       240 l~~l~~L~~L~l~~~~~l~~lp~~~~l~~L~~L~l~~~~~l~~l~~~~~~L~~L~l~~~~i~~lp~~l~~l~~L~~L~L~  319 (815)
                      ++++++|+.|++++|..++.+|..+.+++|+.|++++|..+..+|....+++.|++.++.+..+|..+ .+++|+.|.+.
T Consensus       677 i~~L~~L~~L~L~~c~~L~~Lp~~i~l~sL~~L~Lsgc~~L~~~p~~~~nL~~L~L~~n~i~~lP~~~-~l~~L~~L~l~  755 (1153)
T PLN03210        677 IQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEFPSNL-RLENLDELILC  755 (1153)
T ss_pred             hhccCCCCEEeCCCCCCcCccCCcCCCCCCCEEeCCCCCCccccccccCCcCeeecCCCccccccccc-ccccccccccc
Confidence            99999999999999999999999888999999999999999999998899999999999999998776 57888888887


Q ss_pred             CCcCccccccccCCCCCCCEEeeCCCcCCCCccHHHhccccCCEEeccCC-CccccCchhccCCCCcEEecCCCCCCCcc
Q 003496          320 FCKRLKRVSTSICKLKSLCWLELGGCSNLETFPEILEKMEHLLEIDLRET-AIRNLPSSIEYLEGLRKLDLGDCSELASL  398 (815)
Q Consensus       320 ~~~~~~~lp~~l~~l~~L~~L~Ls~~~~~~~~p~~l~~l~~L~~L~L~~~-~l~~lp~~l~~l~~L~~L~L~~~~~~~~l  398 (815)
                      ++.... +...+..+                .+......++|+.|++++| .+.++|.+++++++|+.|++++|..++.+
T Consensus       756 ~~~~~~-l~~~~~~l----------------~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~L  818 (1153)
T PLN03210        756 EMKSEK-LWERVQPL----------------TPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETL  818 (1153)
T ss_pred             ccchhh-cccccccc----------------chhhhhccccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCee
Confidence            654211 11111100                0111222356666666666 34467777777777888888777766655


Q ss_pred             chhhhccccccccccccccCCCCCchhhhhcccceEEecCCCCccCCcccCCCCCCCEEEecCCCC-cccCcccCCCCCC
Q 003496          399 PEKLENLKSLKYLNAEFSAIGQLPSSISDLNQLKKLKFSGCRGLVLPPLLSGLSSLTELHLTDCNI-TEIPADIGSLSSI  477 (815)
Q Consensus       399 ~~~l~~l~~L~~L~l~~~~~~~~p~~l~~l~~L~~L~l~~~~~~~lp~~l~~l~~L~~L~Ls~~~l-~~lp~~l~~l~~L  477 (815)
                      |..+ ++                                              ++|+.|++++|.. ..+|..   .++|
T Consensus       819 P~~~-~L----------------------------------------------~sL~~L~Ls~c~~L~~~p~~---~~nL  848 (1153)
T PLN03210        819 PTGI-NL----------------------------------------------ESLESLDLSGCSRLRTFPDI---STNI  848 (1153)
T ss_pred             CCCC-Cc----------------------------------------------cccCEEECCCCCcccccccc---cccc
Confidence            5422 22                                              3344444444421 112221   2456


Q ss_pred             CeeeccCCcCccCchhhhccCCcceecccccccccCCCCcc---cccceeccccccccCCCCC--CCCchhhhhhhhhhh
Q 003496          478 VWLALSGNHFERLPTSVKQLSQLRYLHLSNCNMLQSLPELP---IYLVYLEAKNCKRLQTLPE--IPSSVEELDASMLES  552 (815)
Q Consensus       478 ~~L~Ls~n~l~~lp~~l~~l~~L~~L~l~~c~~L~~lp~l~---~sL~~L~i~~C~~L~~l~~--~p~~l~~L~~~~~~~  552 (815)
                      +.|+|++|.++.+|.++..+++|+.|++++|+.++.+|..+   .+|+.|++.+|++|+.++.  .|.....+  .    
T Consensus       849 ~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~~~--~----  922 (1153)
T PLN03210        849 SDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMA--T----  922 (1153)
T ss_pred             CEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccccCCCCchhhhhh--c----
Confidence            66666666666666666667777777777777777666533   3455566677777765542  22211111  0    


Q ss_pred             hhccCCCcccccceeccccccccchhhhhhhhhhhhHHHHHHhhcccccccccceeccCCceeEecCCCCCCCccccCCC
Q 003496          553 IYEHSSGIMDGILFFDFTNCLKLNEKEAHKKILADSQQRIQHMASASLRLCYEMVHYTPYGLCNCFPGSEIPDWFSNQCS  632 (815)
Q Consensus       553 l~~~~~~~~~~~~~l~~~nC~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Pg~~iP~Wf~~~~~  632 (815)
                        .......+....+.|.||++|++...              ++..   ..         ...+++||.++|+||.||+.
T Consensus       923 --~n~~~~~p~~~~l~f~nC~~L~~~a~--------------l~~~---~~---------~~~~~l~g~evp~~f~hr~~  974 (1153)
T PLN03210        923 --DNIHSKLPSTVCINFINCFNLDQEAL--------------LQQQ---SI---------FKQLILSGEEVPSYFTHRTT  974 (1153)
T ss_pred             --ccccccCCchhccccccccCCCchhh--------------hccc---cc---------ceEEECCCccCchhccCCcc
Confidence              00001122235578999999976211              0000   00         12357999999999999999


Q ss_pred             CcEEE-EEcCCCCCCCceeeEEEEEEEeecCccccCCCeeeeEEEEEecCcccc-cC--CccccccccccCCCCCCCCcE
Q 003496          633 GSSLT-IQLPRRSCGRNLVGFALCAVIQFEEDIDASGKYCNVKCNYNFETKTRL-EA--NNNVDDYYNLSLNGSMDSDHV  708 (815)
Q Consensus       633 g~s~~-i~lp~~~~~~~~~gf~~c~v~~~~~~~~~~~~~~~~~c~~~~~~~~~~-~~--~~~~~~~~~~~~~~~~~sdH~  708 (815)
                      |++++ |.+|+.|+...+.||++|+|+++...... ...+.++|.|+|++..+. ..  ...+.|.+      ....+|+
T Consensus       975 g~sl~~i~l~~~~~~~~~~~f~~c~v~~~~~~~~~-~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~------~~~~~~l 1047 (1153)
T PLN03210        975 GASLTNIPLLHISPCQPFFRFRACAVVDSESFFII-SVSFDIQVCCRFIDRLGNHFDSPYQPHVFSV------TKKGSHL 1047 (1153)
T ss_pred             cceeeeeccCCcccCCCccceEEEEEEecCccccC-CCceeEEEEEEEECCCCCccccCCCceeEee------eccccce
Confidence            99999 99999999888999999999998765332 236788999999874321 00  00011111      1234555


Q ss_pred             EEecccCCCCCCC---CCCCCceeeEEEEEEecCCCCccEEEeccCeeeecCCC
Q 003496          709 LLGFEPCWNTEVP---DDGNNQTTISFEFSVECKNEKCHQVKCCGVCPVYANPN  759 (815)
Q Consensus       709 ~~~~~~~~~~~~~---~~~~~~~~~~~~f~~~~~~~~~~~Vk~CGv~lvy~~~~  759 (815)
                      ++.-..+ .....   ....+++.++|+|.|...... ++||+|||+++|+.+.
T Consensus      1048 ~~~~~~~-~~~~~~~~~~~~~~~~~~~~f~~~~~~~~-~~~~~cg~~~~~~~~~ 1099 (1153)
T PLN03210       1048 VIFDCCF-PLNEDNAPLAELNYDHVDIQFRLTNKNSQ-LKLKGCGIRLSEDDSS 1099 (1153)
T ss_pred             EEecccc-cccccccchhccCCceeeEEEEEecCCCC-eEEEeeeEEEeccCCC
Confidence            5211111 10010   112356778899998775544 4999999999997754



syringae 6; Provisional

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query815
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 9e-09
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Iteration: 1

Score = 59.3 bits (142), Expect = 9e-09, Method: Compositional matrix adjust. Identities = 51/184 (27%), Positives = 76/184 (41%), Gaps = 11/184 (5%) Query: 345 CSNLETFPEILEKMEHLLEIDLRETAIRNLPSSIEYLEGLRKLDLGDCSELASLPEKL-- 402 + L P+ ++ L + L +R LP+SI L LR+L + C EL LPE L Sbjct: 113 AAGLXELPDTXQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLAS 172 Query: 403 -------ENLKSLKYLNAEFSAIGQLPSSISDLNQLKKLKFSGCRXXXXXXXXXXXXXXX 455 + L +L+ L E++ I LP+SI++L LK LK Sbjct: 173 TDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLE 232 Query: 456 XXXXXDCN-ITEIPADIGSLSSIVWLALSG-NHFERLPTSVKQLSQLRYLHLSNCNMLQS 513 C + P G + + L L ++ LP + +L+QL L L C L Sbjct: 233 ELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSR 292 Query: 514 LPEL 517 LP L Sbjct: 293 LPSL 296

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query815
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-58
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-43
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-38
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-35
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-37
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-36
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-30
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-34
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-34
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-33
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-30
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-33
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-32
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-19
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-30
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-30
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-29
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-30
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-29
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-27
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-29
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-28
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-28
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-27
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-20
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-26
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-08
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-24
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-24
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-24
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-24
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-23
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-20
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-16
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-20
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-15
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-16
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-15
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-14
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-15
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-13
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-10
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  199 bits (509), Expect = 6e-58
 Identities = 73/321 (22%), Positives = 120/321 (37%), Gaps = 20/321 (6%)

Query: 239 SIQNFNNLSVLSLAGCRSLVSFPRNI-YFRSPIAVDFSDCVNLTEFPLVSGNIIELRLWN 297
              + +    L   G  +L  +   +  ++     D +   +       S N        
Sbjct: 7   HHHHSSGRENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQAN-SNNPQIETRTG 65

Query: 298 TRIEEVPSSIECLT--NLETLDLSFCKRLKRVSTSICKLKSLCWLELGGCSNLETFPEIL 355
             ++     +E  T      L+L     L +      +L  L  + +     L   P+ +
Sbjct: 66  RALKATADLLEDATQPGRVALELRSVP-LPQFPDQAFRLSHLQHMTIDAAG-LMELPDTM 123

Query: 356 EKMEHLLEIDLRETAIRNLPSSIEYLEGLRKLDLGDCSELASLPE---------KLENLK 406
           ++   L  + L    +R LP+SI  L  LR+L +  C EL  LPE         + + L 
Sbjct: 124 QQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLV 183

Query: 407 SLKYLNAEFSAIGQLPSSISDLNQLKKLKFSGCRGLVLPPLLSGLSSLTELHLTDCN-IT 465
           +L+ L  E++ I  LP+SI++L  LK LK        L P +  L  L EL L  C  + 
Sbjct: 184 NLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALR 243

Query: 466 EIPADIGSLSSIVWLALSG-NHFERLPTSVKQLSQLRYLHLSNCNMLQSLPELPIYLV-- 522
             P   G  + +  L L   ++   LP  + +L+QL  L L  C  L  LP L   L   
Sbjct: 244 NYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPAN 303

Query: 523 -YLEAKNCKRLQTLPEIPSSV 542
             +      + Q     P + 
Sbjct: 304 CIILVPPHLQAQLDQHRPVAR 324


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 815
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.002
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.004
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 65.4 bits (158), Expect = 5e-12
 Identities = 47/242 (19%), Positives = 93/242 (38%), Gaps = 7/242 (2%)

Query: 279 NLTEFPL-VSGNIIELRLWNTRIEEV-PSSIECLTNLETLDLSFCKRLKRVSTSICKLKS 336
            L + P  +  +   L L N +I E+     + L NL TL L   K  K    +   L  
Sbjct: 21  GLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVK 80

Query: 337 LCWLELGGCSNLETFPEILEKMEHLLEIDLRETAIRNLPSSIEYLEGLRKLDLGDCSELA 396
           L  L L      E   ++ + ++ L   +   T +R    +      + +L         
Sbjct: 81  LERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSG 140

Query: 397 SLPEKLENLKSLKYLNAEFSAIGQLPSSISDLNQLKKLKFSGCR-GLVLPPLLSGLSSLT 455
                 + +K L Y+    + I  +P  +     L +L   G +   V    L GL++L 
Sbjct: 141 IENGAFQGMKKLSYIRIADTNITTIPQGL--PPSLTELHLDGNKITKVDAASLKGLNNLA 198

Query: 456 ELHLTDCNITEIPADIGSLSSIVW-LALSGNHFERLPTSVKQLSQLRYLHLSNCNMLQSL 514
           +L L+  +I+ +     + +  +  L L+ N   ++P  +     ++ ++L N N + ++
Sbjct: 199 KLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHN-NNISAI 257

Query: 515 PE 516
             
Sbjct: 258 GS 259


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query815
d2bhua3420 Glycosyltrehalose trehalohydrolase, central domain 100.0
d1ejda_419 UDP-N-acetylglucosamine enolpyruvyl transferase (E 100.0
d2df7a1419 Birnavirus VP2 {Infectious bursal disease virus [T 100.0
d1om4a_418 Nitric oxide (NO) synthase oxygenase domain {Rat ( 100.0
d2gp4a2418 6-phosphogluconate dehydratase EDD {Shewanella one 100.0
d1f61a_418 Isocitrate lyase {Mycobacterium tuberculosis [TaxI 100.0
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 100.0
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 100.0
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 100.0
d1q7ea_417 Hypothetical protein YfdW {Escherichia coli [TaxId 100.0
d3bona1417 Botulinum neurotoxin {Clostridium botulinum, serot 100.0
d1w6ga1417 Copper amine oxidase, domain 3 {Arthrobacter globi 100.0
d2csga1417 Hypothetical protein YbiU {Salmonella typhimurium 100.0
d1ltka_417 Phosphoglycerate kinase {Malaria parasite (Plasmod 100.0
d1gff1_417 Microvirus capsid proteins {Bacteriophage G4 [TaxI 100.0
d1vema2417 Bacterial beta-amylase {Bacillus cereus [TaxId: 13 100.0
d1q2oa_416 Nitric oxide (NO) synthase oxygenase domain {Cow ( 100.0
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 100.0
d1d8wa_416 L-rhamnose isomerase {Escherichia coli [TaxId: 562 100.0
d2vnud4416 Exosome complex exonuclease RRP44 {Saccharomyces c 100.0
d1igwa_416 Isocitrate lyase {Escherichia coli [TaxId: 562]} 100.0
d1pb1a_416 Isocitrate dehydrogenase, ICDH {Escherichia coli [ 100.0
d1dnva_415 Densovirus capsid protein {Galleria mellonella den 100.0
d1so2a_415 cGMP-inhibited 3',5'-cyclic phosphodiesterase B, p 100.0
d16pka_415 Phosphoglycerate kinase {Trypanosoma brucei [TaxId 100.0
d2ieaa2415 Pyruvate dehydrogenase E1 component, PP module {Es 100.0
d1qpga_415 Phosphoglycerate kinase {Baker's yeast (Saccharomy 100.0
d2qeec1415 Uncharacterized protein BH0493 {Bacillus haloduran 100.0
d1s5ja2415 Family B DNA polymerase {Sulfolobus solfataricus [ 100.0
d2b8na1414 Putative glycerate kinase (hypothetical protein TM 100.0
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 100.0
d1o20a_414 Gamma-glutamyl phosphate reductase {Thermotoga mar 100.0
d1t0la_414 NADP-dependent isocitrate dehydrogenase {Human (Ho 100.0
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 100.0
d1vh4a_413 Stabilizer of iron transporter SufD {Escherichia c 100.0
d1hdia_413 Phosphoglycerate kinase {Pig (Sus scrofa) [TaxId: 100.0
d2qgma1413 Succinoglycan biosynthesis protein BC3205 {Bacillu 100.0
d1lwda_413 NADP-dependent isocitrate dehydrogenase {Pig (Sus 100.0
d1zjca1413 Aminopeptidase S, AMPS {Staphylococcus aureus [Tax 100.0
d1a0tp_413 Sucrose-specific porin {Enterobacterium (Salmonell 100.0
d1ulva1413 Glucodextranase, domain A {Arthrobacter globiformi 100.0
d1ocka_412 Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 100.0
d1yzya1412 Hypothetical protein HI1011 {Haemophilus influenza 100.0
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 100.0
d1rxxa_412 Arginine deiminase {Pseudomonas aeruginosa [TaxId: 100.0
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 100.0
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 100.0
d1ufaa2412 Hypothetical protein TT1467, N-terminal domain {Th 100.0
d1t3ca_411 Botulinum neurotoxin {Clostridium botulinum, serot 100.0
d2afaa1411 Putative NAG isomerase YihS {Salmonella typhimuriu 100.0
d1ux5a_411 Bni1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d2ccaa1410 Catalase-peroxidase KatG {Mycobacterium tuberculos 100.0
d1p1ja1410 Myo-inositol 1-phosphate synthase {Baker's yeast ( 100.0
d1kfsa2410 DNA polymerase I (Klenow fragment) {Escherichia co 100.0
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 100.0
d1s5ja1410 Exonuclease domain of family B DNA polymerases {Su 100.0
d2cmza1409 Spike glycoprotein {Vesicular stomatitis indiana v 100.0
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 100.0
d1qtma2409 DNA polymerase I (Klenow fragment) {Thermus aquati 100.0
d2g0da1409 Nisin biosynthesis protein NisC {Lactococcus lacti 100.0
d1b25a1409 Formaldehyde ferredoxin oxidoreductase {Archaeon P 100.0
d1s9ra_409 Arginine deiminase {Mycoplasma arginini [TaxId: 20 100.0
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 100.0
d1dkla_409 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 100.0
d1wzaa2409 Bacterial alpha-amylase {Halothermothrix orenii [T 100.0
d1r76a_408 Polygalacturonic acid lyase (pectate lyase) {Azosp 100.0
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 100.0
d1f1oa_408 Adenylosuccinate lyase {Bacillus subtilis [TaxId: 100.0
d2hhva2408 DNA polymerase I (Klenow fragment) {Bacillus stear 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 100.0
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 100.0
d1qs0a_407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 100.0
d1eu8a_407 D-maltodextrin-binding protein, MBP {Archaeon Ther 100.0
d1qhoa4407 Cyclodextrin glycosyltransferase {Bacillus stearot 100.0
d1mwva1406 Catalase-peroxidase KatG {Burkholderia pseudomalle 100.0
d1itka1406 Catalase-peroxidase KatG {Archaeon Haloarcula mari 100.0
d1ub2a1406 Catalase-peroxidase KatG {Synechococcus sp. pcc 79 100.0
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 100.0
d1ei6a_406 Phosphonoacetate hydrolase {Pseudomonas fluorescen 100.0
d2ayia1406 Aminopeptidase T {Thermus thermophilus [TaxId: 274 100.0
d3bmva4406 Cyclodextrin glycosyltransferase {Thermoanaerobact 100.0
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 100.0
d2nwwa1405 Proton glutamate symport protein {Pyrococcus horik 100.0
d1h6za3405 Pyruvate phosphate dikinase, N-terminal domain {Tr 100.0
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 100.0
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 100.0
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 100.0
d1uyra2404 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 100.0
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d2b5dx2404 Alpha-amylase AmyC {Thermotoga maritima [TaxId: 23 100.0
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 100.0
d1h12a_404 Endo-1,4-beta-xylanase {Pseudoalteromonas haloplan 100.0
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1xksa_403 Nuclear pore complex protein Nup133 {Human (Homo s 100.0
d1hx0a2403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d3b55a1403 Succinoglycan biosynthesis protein BC3120 {Bacillu 100.0
d2g5da1402 Membrane-bound lytic murein transglycosylase A, ML 100.0
d1xk7a1402 Crotonobetainyl-CoA:carnitine CoA-transferase, Cai 100.0
d1dofa_402 Adenylosuccinate lyase {Archaeon Pyrobaculum aerop 100.0
d1fp3a_402 N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
g1w2w.1402 Putative methylthioribose-1-phosphate isomerase Yp 100.0
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 100.0
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 100.0
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 100.0
d2h6fb1401 Protein farnesyltransferase, beta-subunit {Human ( 100.0
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1jdpa_401 Hormone binding domain of the atrial natriuretic p 100.0
d1a12a_401 Regulator of chromosome condensation RCC1 {Human ( 100.0
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 100.0
d2r7da2401 Ribonuclease II family protein DR0020 {Deinococcus 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 100.0
d1ru4a_400 Pectate transeliminase {Erwinia chrysanthemi [TaxI 100.0
d3ovwa_400 Cellobiohydrolase I (cellulase, Endoglucanase I, C 100.0
d1inpa_400 Inositol polyphosphate 1-phosphatase {Cow (Bos tau 100.0
d2olua2400 Penicillin-binding protein 2, PBP2 {Staphylococcus 100.0
d1eh9a3400 Glycosyltrehalose trehalohydrolase, central domain 100.0
d1oyaa_399 Old yellow enzyme (OYE) {Lager yeast (Saccharomyce 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d2ah2a2399 Trypanosoma sialidase {Parasitic flagellate protoz 100.0
d1bn8a_399 Pectate lyase {Bacillus subtilis [TaxId: 1423]} 100.0
d1ojja_399 Cellobiohydrolase I (cellulase, Endoglucanase I, C 100.0
d1vpea_398 Phosphoglycerate kinase {Thermotoga maritima [TaxI 100.0
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 100.0
d1vlja_398 NADH-dependent butanol dehydrogenase A (TM0820) {T 100.0
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 100.0
d1q1la_397 Chorismate synthase, AroC {Aquifex aeolicus [TaxId 100.0
d1vkoa1397 Myo-inositol 1-phosphate synthase {Caenorhabditis 100.0
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 100.0
d1vjva_397 Ubiquitin carboxyl-terminal hydrolase 6 {Baker's y 100.0
d1lf6a1397 Bacterial glucoamylase, C-terminal domain {Thermoa 100.0
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 100.0
d1m7xa3396 1,4-alpha-glucan branching enzyme, central domain 100.0
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 100.0
d1io1a_395 Phase 1 flagellin {Salmonella typhimurium [TaxId: 100.0
g1f8v.1395 Alphanodavirus capsid protein {Pariacoto virus [Ta 100.0
d2bfda1395 Branched-chain alpha-keto acid dehydrogenase, PP m 100.0
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 100.0
d1aora1395 Aldehyde ferredoxin oxidoreductase {Archaeon Pyroc 100.0
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 100.0
d1w36b2395 Exodeoxyribonuclease V beta chain (RecB), N-termin 100.0
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 100.0
d1phpa_394 Phosphoglycerate kinase {Bacillus stearothermophil 100.0
d1u1ha1394 5-methyltetrahydropteroyltriglutamate--homocystein 100.0
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 100.0
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 100.0
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 100.0
d1atia2394 Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil 100.0
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 100.0
d2d3na2394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 100.0
d1q8ia2394 Family B DNA polymerase {Escherichia coli [TaxId: 100.0
d1ldja2394 Cullin homolog 1, Cul-1 {Human (Homo sapiens) [Tax 100.0
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 100.0
d1xlma_393 D-xylose isomerase {Arthrobacter, strain b3728 [Ta 100.0
d1kwga2393 A4 beta-galactosidase {Thermus thermophilus [TaxId 100.0
d1g8ma2393 AICAR transformylase domain of bifunctional purine 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 100.0
d1hvxa2393 Bacterial alpha-amylase {Bacillus stearothermophil 100.0
d1e43a2393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 100.0
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 100.0
d2d0ta1392 Indoleamine 2,3-dioxygenase {Human (Homo sapiens) 100.0
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 100.0
d1xima_392 D-xylose isomerase {Actinoplanes missouriensis [Ta 100.0
d1yvua2392 Argonaute homologue Aq_1447 {Aquifex aeolicus [Tax 100.0
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 100.0
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 100.0
d1nt4a_391 Glucose-1-phosphatase {Escherichia coli [TaxId: 56 100.0
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 100.0
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 100.0
d1lwha2391 4-alpha-glucanotransferase {Thermotoga maritima [T 100.0
d4ubpc2390 alpha-subunit of urease, catalytic domain {Bacillu 100.0
d1v6sa_390 Phosphoglycerate kinase {Thermus thermophilus [Tax 100.0
d1nsca_390 Influenza neuraminidase {Influenza B virus, differ 100.0
d1qopb_390 Tryptophan synthase, beta-subunit {Salmonella typh 100.0
d1oj7a_390 Hypothetical oxidoreductase yqhD {Escherichia coli 100.0
d1ud2a2390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 100.0
d1sg6a_389 Dehydroquinate synthase, DHQS {Aspergillus nidulan 100.0
d1jiha2389 DNA polymerase eta {Baker's yeast (Saccharomyces c 100.0
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 100.0
d1e9yb2389 alpha-subunit of urease, catalytic domain {Helicob 100.0
d2o3ia1389 Hypothetical protein CV3147 {Chromobacterium viola 100.0
d1f8ea_388 Influenza neuraminidase {Influenza A virus, differ 100.0
d1u7la_388 Vacuolar ATP synthase subunit C {Baker's yeast (Sa 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1qxoa_388 Chorismate synthase, AroC {Streptococcus pneumonia 100.0
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 100.0
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 100.0
d2dcfa1388 6-aminohexanoate-dimer hydrolase NylC {Flavobacter 100.0
d1q8ia1388 Exonuclease domain of family B DNA polymerases {Es 100.0
d2py5a2388 phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 100.0
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 100.0
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 100.0
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 100.0
d1x38a1388 Beta-D-glucan exohydrolase, N-terminal domain {Bar 100.0
d1zeea1387 Hypothetical protein SO4414 {Shewanella oneidensis 100.0
d2aepa1387 Influenza neuraminidase {Influenza A virus, differ 100.0
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1zsqa2387 Myotubularin-related protein 2, C-terminal domain 100.0
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 100.0
d1bxba_387 D-xylose isomerase {Thermus aquaticus, subsp. Ther 100.0
d2qp8a1387 beta-secretase (memapsin) {Human (Homo sapiens) [T 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 100.0
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 100.0
d2ex0a1387 Alpha-2,3/2,6-sialyltransferase/sialidase {Pasteur 100.0
d1v8za1386 Tryptophan synthase, beta-subunit {Archaeon Pyroco 100.0
d1r6ta2386 Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo 100.0
d1muwa_386 D-xylose isomerase {Streptomyces olivochromogenes 100.0
d3c10a1386 Histone deacetylase 7, HDAC7 {Human (Homo sapiens) 100.0
d1v5da_386 Chitosanase {Bacillus sp., strain k17 [TaxId: 1409 100.0
d1rrma_385 Lactaldehyde reductase FucO {Escherichia coli [Tax 100.0
d1uhga_385 Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} 100.0
d1xmxa_385 Hypothetical protein VC1899 {Vibrio cholerae [TaxI 100.0
d1ir6a_385 Exonuclease RecJ {Thermus thermophilus [TaxId: 274 100.0
d1ejxc2385 alpha-subunit of urease, catalytic domain {Klebsie 100.0
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 100.0
d2c5wb1385 Penicillin-binding protein 1a, transpeptidase doma 100.0
d2ix0a4385 Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 100.0
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 100.0
d1mtyb_384 Methane monooxygenase hydrolase beta subunit {Meth 100.0
d3c0na2384 (Pro)aerolysin, pore-forming lobe {Aeromonas hydro 100.0
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 100.0
d1hn0a1384 Chondroitin ABC lyase I {Proteus vulgaris [TaxId: 100.0
d2fvka2384 Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Sacc 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1vz6a_383 Glutamate N-acetyltransferase 2 (ornithine acetylt 100.0
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 100.0
d1u7ga_383 Ammonium transporter AmtB {Escherichia coli [TaxId 100.0
d1mhyb_383 Methane monooxygenase hydrolase beta subunit {Meth 100.0
d1bo1a_383 Phosphatidylinositol phosphate kinase IIbeta, PIPK 100.0
d1imva_383 Pigment epithelium-derived factor, PEDF {Human (Ho 100.0
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 100.0
d2ayna1383 Ubiquitin carboxyl-terminal hydrolase 14 {Human (H 100.0
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 100.0
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 100.0
d1wkva1382 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1ea9c3382 Maltogenic amylase, central domain {Bacillus sp., 100.0
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 100.0
d1t1ua1382 Choline O-acetyltransferase {Rat (Rattus norvegicu 100.0
d1xl7a1382 Peroxisomal carnitine O-octanoyltransferase, COT { 100.0
d1wzla3382 Maltogenic amylase, central domain {Thermoactinomy 100.0
d1j0ha3382 Neopullulanase, central domain {Bacillus stearothe 100.0
d1by7a_381 Plasminogen activator inhibitor-2 {Human (Homo sap 100.0
d3bvua3381 Golgi alpha-mannosidase II {Fruit fly (Drosophila 100.0
d1odza_381 Mannanase A, ManA {Pseudomonas cellulosa (Cellvibr 100.0
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 100.0
d2bo4a1381 Mannosylglycerate synthase, MGS {Rhodothermus mari 100.0
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 100.0
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 100.0
d2guya2381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 100.0
d2aaaa2381 Fungal alpha-amylases {Aspergillus niger, acid amy 100.0
d1t6ex_381 Xylanase inhibitor TAXI-I {Wheat (Triticum aestivu 100.0
d1vbga3380 Pyruvate phosphate dikinase, N-terminal domain {Ma 100.0
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 100.0
d1q45a_380 12-oxophytodienoate reductase (OPR, OYE homolog) { 100.0
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 100.0
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 100.0
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 100.0
d1elja_380 D-maltodextrin-binding protein, MBP {Archaeon Pyro 100.0
d1lj5a_379 Plasminogen activator inhibitor-1 {Human (Homo sap 100.0
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 100.0
d3sila_379 Salmonella sialidase {Salmonella typhimurium, stra 100.0
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 100.0
d1xqga_378 Maspin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2icya2378 UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale c 100.0
d1jaea2378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 100.0
d1a59a_377 Citrate synthase {Antarctic bacterium DS2-3R [TaxI 100.0
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 100.0
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 100.0
d2d5ja1377 Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 100.0
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 100.0
d2i71a1377 Hypothetical protein SSO1389 {Sulfolobus solfatari 100.0
d1ci9a_377 Esterase EstB {Burkholderia gladioli [TaxId: 28095 100.0
d1jmma_377 V-region of surface antigen I/II (SA I/II, PAC) {S 100.0
d1nm8a1377 Carnitine acetyltransferase {Human (Homo sapiens) 100.0
d1k9oi_376 Alaserpin (serpin 1) {Tobacco hornworm (Manduca se 100.0
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 100.0
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 100.0
d1f6da_376 UDP-N-acetylglucosamine 2-epimerase {Escherichia c 100.0
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 100.0
d1wu4a1376 Xylanase Y {Bacillus halodurans [TaxId: 86665]} 100.0
d2v3qa1376 PstS-like phosphate-binding protein {Human (Homo s 100.0
d1bhea_376 Polygalacturonase {Erwinia carotovora, subsp. caro 100.0
d2fug41375 NADH-quinone oxidoreductase chain 4, Nqo4 {Thermus 100.0
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 100.0
g1hle.1375 Elastase inhibitor {Horse (Equus caballus) [TaxId: 100.0
d1ih7a1375 Exonuclease domain of family B DNA polymerases {Ba 100.0
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 100.0
d1kbla3375 Pyruvate phosphate dikinase, N-terminal domain {Cl 100.0
d1txka2374 Glucans biosynthesis protein G (MdoG, OpgG), N-ter 100.0
d1ioma_374 Citrate synthase {Thermus thermophilus [TaxId: 274 100.0
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 100.0
d2a0ua1374 Initiation factor 2b {Leishmania major [TaxId: 566 100.0
d1nd7a_374 WW domain-containing protein 1, WWP1 {Human (Homo 100.0
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 100.0
d1rp4a_374 Endoplasmic oxidoreductin 1, Ero1p {Baker's yeast 100.0
d2bvca2374 Glutamine synthetase, C-terminal domain {Mycobacte 100.0
d1so7a_374 Sialidase 2 (Neu2) {Human (Homo sapiens) [TaxId: 9 100.0
d1kfwa1374 Psychrophilic chitinase B {Arthrobacter sp., tad20 100.0
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 100.0
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 100.0
d1ogmx2373 Dextranase, catalytic domain {Penicillium miniolut 100.0
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 100.0
d1miqa_373 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 100.0
d1qo0a_373 Amide receptor/negative regulator of the amidase o 100.0
d1m0wa2373 Eukaryotic glutathione synthetase ATP-binding doma 100.0
d1r5ya_372 Queosine tRNA-guanine transglycosylase {Zymomonas 100.0
d1c3pa_372 HDAC homologue {Aquifex aeolicus [TaxId: 63363]} 100.0
d1noya_372 Exonuclease domain of family B DNA polymerases {Ba 100.0
d1qlpa_372 Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 100.0
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 100.0
d1vkpa_372 Agmatine iminohydrolase {Thale-cress (Arabidopsis 100.0
d1teda_372 Polyketide synthase PKS18 {Mycobacterium tuberculo 100.0
g1htr.1372 Pepsin(ogen) {Human (Homo sapiens), progastricsin 100.0
d1mkfa_371 Viral chemokine binding protein m3 {Murid herpesvi 100.0
d1r53a_371 Chorismate synthase, AroC {Baker's yeast (Saccharo 100.0
d1to6a_371 Glycerate kinase GlxK {Neisseria meningitidis, (se 100.0
d1aj8a_371 Citrate synthase {Archaeon Pyrococcus furiosus [Ta 100.0
d1n7oa1371 Hyaluronate lyase {Streptococcus pneumoniae [TaxId 100.0
d1f1sa1371 Hyaluronate lyase {Streptococcus agalactiae [TaxId 100.0
d1c8ba_371 Germination protease {Bacillus megaterium [TaxId: 100.0
d1eg1a_371 Cellobiohydrolase I (cellulase, Endoglucanase I, C 100.0
d1r85a_371 Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 100.0
d2dexx3370 Peptidylarginine deiminase Pad4, catalytic C-termi 100.0
d2gx8a1370 Nif3-related protein BC4286 {Bacillus cereus [TaxI 100.0
d2hgsa4370 Eukaryotic glutathione synthetase ATP-binding doma 100.0
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 100.0
d3psga_370 Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 100.0
d1iq0a2370 Arginyl-tRNA synthetase (ArgRS) {Thermus thermophi 100.0
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 100.0
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 100.0
d1itua_369 Renal dipeptidase {Human (Homo sapiens) [TaxId: 96 100.0
d1rwha1369 Chondroitinase AC {Arthrobacter aurescens [TaxId: 100.0
d2heka1369 Hypothetical protein aq_1910 {Aquifex aeolicus [Ta 100.0
d2ewoa1369 Agmatine iminohydrolase {Streptococcus mutans [Tax 100.0
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 100.0
g1as4.1369 Antichymotrypsin, alpha-1 {Human (Homo sapiens) [T 100.0
d1ga6a_369 Serine-carboxyl proteinase, SCP {Pseudomonas sp., 100.0
d1laxa_369 D-maltodextrin-binding protein, MBP {Escherichia c 100.0
d1e7ua4369 Phoshoinositide 3-kinase (PI3K), catalytic domain 100.0
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 100.0
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 100.0
d1r8ga_368 Carboxylate-amine ligase YbdK {Escherichia coli [T 100.0
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 100.0
d1f52a2368 Glutamine synthetase, C-terminal domain {Salmonell 100.0
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 100.0
d1pyya4368 Penicillin-binding protein 2x (pbp-2x), transpepti 100.0
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 100.0
d1o7xa_367 Citrate synthase {Archaeon Sulfolobus solfataricus 100.0
d1iuqa_367 Glycerol-3-phosphate (1)-acyltransferase {Cushaw s 100.0
d1b65a_367 L-aminopeptidase D-Ala-esterase/amidase DmpA {Ochr 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 100.0
d1ursa_367 D-maltodextrin-binding protein, MBP {Alicyclobacil 100.0
d1qw9a2367 Alpha-L-arabinofuranosidase, catalytic domain {Bac 100.0
d1hz4a_366 Transcription factor MalT domain III {Escherichia 100.0
d1moqa_366 "Isomerase domain" of glucosamine 6-phosphate synt 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
d1h6za1366 Pyruvate phosphate dikinase, C-terminal domain {Tr 100.0
d2bvya2366 Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708] 100.0
d1jq5a_366 Glycerol dehydrogenase {Bacillus stearothermophilu 100.0
d1u5ua_366 Allene oxide synthase-lipoxygenase protein, N-term 100.0
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 100.0
d1fn9a_365 Outer capsid protein sigma 3 {Reovirus [TaxId: 108 100.0
d1um0a_365 Chorismate synthase, AroC {Helicobacter pylori [Ta 100.0
d2pnwa1365 Membrane-bound lytic murein transglycosylase A, ML 100.0
d1w85a_365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 100.0
d1u1ha2365 5-methyltetrahydropteroyltriglutamate--homocystein 100.0
d1zkda1365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 100.0
d3c8ya1365 Fe-only hydrogenase, catalytic domain {Clostridium 100.0
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 100.0
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 100.0
d2jera1364 Agmatine iminohydrolase {Enterococcus faecalis [Ta 100.0
d1t64a_364 Histone deacetylase 8, HDAC8 {Human (Homo sapiens) 100.0
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 100.0
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 100.0
d1kbla1364 Pyruvate phosphate dikinase, C-terminal domain {Cl 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1kq3a_364 Glycerol dehydrogenase {Thermotoga maritima [TaxId 100.0
d1oc7a_364 Cellobiohydrolase II (Cel6) {Humicola insolens, Ce 100.0
d1us3a2364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 100.0
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 100.0
d1w0pa3364 Vibrio cholerae sialidase {Vibrio cholerae [TaxId: 100.0
d1m7va_363 Nitric oxide (NO) synthase oxygenase domain {Bacil 100.0
d1zaia1363 Fructose-1,6-bisphosphate aldolase {Rabbit (Orycto 100.0
d1khba1363 Cytosolic phosphoenolpyruvate carboxykinase (GTP-h 100.0
d1zq1a2363 Glutamyl-tRNA(Gln) amidotransferase subunit D, Gat 100.0
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 100.0
d1onha_363 AMPC beta-Lactamase, class C {Enterobacter cloacae 100.0
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 100.0
d1nc5a_363 Hypothetical protein YteR {Bacillus subtilis [TaxI 100.0
d1cnza_363 3-isopropylmalate dehydrogenase, IPMDH {Salmonella 100.0
d1kwfa_363 CelA cellulase {Clostridium thermocellum [TaxId: 1 100.0
d2a1ha1363 Branched-chain aminoacid aminotransferase {Human ( 100.0
d1umga_362 ST0318 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1gqea_362 Polypeptide chain release factor 2 (RF2) {Escheric 100.0
d1umda_362 Branched-chain alpha-keto acid dehydrogenase, PP m 100.0
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 100.0
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 100.0
d3thia_362 Thiaminase I {Paenibacillus thiaminolyticus [TaxId 100.0
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 100.0
d1vlca_362 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga 100.0
d2drwa1362 D-Amino acid amidase DaaA {Ochrobactrum anthropi [ 100.0
d1svma_362 Papillomavirus large T antigen helicase domain {Si 100.0
d1nqka_362 Alkanesulfonate monooxygenase SsuD {Escherichia co 100.0
d2gjxa1362 beta-hexosaminidase A {Human (Homo sapiens) [TaxId 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1qjwa_362 Cellobiohydrolase II (Cel6) {Trichoderma reesei, C 100.0
d2ozla1361 E1-beta subunit of pyruvate dehydrogenase (PP modu 100.0
d1dhsa_361 Deoxyhypusine synthase, DHS {Human (Homo sapiens) 100.0
d1x1ia1361 Xanthan lyase {Bacillus sp. gl1 [TaxId: 84635]} 100.0
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 100.0
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 100.0
d1lt7a_361 Betaine-homocysteine S-methyltransferase {Human (H 100.0
d1rqga2361 Methionyl-tRNA synthetase (MetRS) {Pyrococcus abys 100.0
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 100.0
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 100.0
d1mxga2361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 100.0
d1pe9a_361 Pectate lyase {Erwinia chrysanthemi, type A [TaxId 100.0
d1sq1a_360 Chorismate synthase, AroC {Campylobacter jejuni [T 100.0
d1qo5a_360 Fructose-1,6-bisphosphate aldolase {Human (Homo sa 100.0
d1jdwa_360 L-arginine: glycine amidinotransferase {Human (Hom 100.0
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 100.0
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 100.0
d1xfia_360 Hypothetical protein At2g17340 {Thale cress (Arabi 100.0
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 100.0
d1oxwa_360 Patatin {Heartleaf nightshade (Solanum cardiophyll 100.0
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 100.0
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 100.0
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 100.0
d4bcla_359 Bacteriochlorophyll A protein {Prosthecochloris ae 100.0
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 100.0
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 100.0
d1x74a1359 2-methylacyl-CoA racemase Mcr {Mycobacterium tuber 100.0
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 100.0
d1yvra1359 60-kda SS-aARo ribonucleoprotein {African clawed f 100.0
d2hrca1359 Ferrochelatase {Human (Homo sapiens) [TaxId: 9606] 100.0
d1qcxa_359 Pectin lyase {Aspergillus niger, type B [TaxId: 50 100.0
d1idka_359 Pectin lyase {Aspergillus niger, type A [TaxId: 50 100.0
d1o2da_359 Alcohol dehydrogenase TM0920 {Thermotoga maritima 100.0
g1lq8.1358 Protein C inhibitor {Human (Homo sapiens) [TaxId: 100.0
d2hdsa1358 AMPC beta-Lactamase, class C {Escherichia coli, ce 100.0
d1m7ja3358 N-acyl-D-aminoacid amidohydrolase, catalytic domai 100.0
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 100.0
d1dosa_358 Fructose-bisphosphate aldolase (FBP aldolase) {Esc 100.0
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 100.0
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 100.0
d1edqa2358 Chitinase A, catalytic domain {Serratia marcescens 100.0
d2qapa1357 Fructose-1,6-bisphosphate aldolase {Trypanosome (L 100.0
d1taza_357 Catalytic domain of cyclic nucleotide phosphodiest 100.0
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 100.0
d1t1ga_357 Serine-carboxyl proteinase, SCP {Bacillus novosp. 100.0
d1a05a_357 3-isopropylmalate dehydrogenase, IPMDH {Thiobacill 100.0
d2amxa1357 Adenosine deaminase (ADA) {Plasmodium yoelii [TaxI 100.0
d1yyda1357 Fungal peroxidase (ligninase) {Basidomycetos fungu 100.0
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 100.0
d1mppa_357 Pepsin {Mucor pusillus [TaxId: 4840]} 100.0
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 100.0
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 100.0
d16vpa_356 Conserved core of transcriptional regulatory prote 100.0
d1r3sa_356 Uroporphyrinogen decarboxylase, UROD {Human (Homo 100.0
d1w8oa3356 Micromonospora sialidase, N-terminal domain {Micro 100.0
d1l0wa3356 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 100.0
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 100.0
d1lbqa_356 Ferrochelatase {Baker's yeast (Saccharomyces cerev 100.0
d1v53a1356 3-isopropylmalate dehydrogenase, IPMDH {Bacillus c 100.0
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 100.0
d2ebsa2356 Oligoxyloglucan reducing end-specific cellobiohydr 100.0
d1jaka1356 beta-N-acetylhexosaminidase {Streptomyces plicatus 100.0
d1goia2356 Chitinase B, catalytic domain {Serratia marcescens 100.0
d1vbga1356 Pyruvate phosphate dikinase, C-terminal domain {Ma 100.0
d3bu7a1355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 100.0
d1fuia2355 L-fucose isomerase, N-terminal and second domains 100.0
d1luca_355 Bacterial luciferase alpha chain, LuxA {Vibrio har 100.0
d1jbqa_355 Cystathionine beta-synthase {Human (Homo sapiens) 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
g1mtp.1355 Thermopin {Thermobifida fusca [TaxId: 2021]} 100.0
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 100.0
d1iq8a1355 Archaeosine tRNA-guanine transglycosylase, N-termi 100.0
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Glycosyltrehalose trehalohydrolase, central domain
species: Deinococcus radiodurans [TaxId: 1299]
Probab=100.00  E-value=0  Score=31729.16  Aligned_cols=1  Identities=0%  Similarity=-0.825  Sum_probs=0.0

Q ss_pred             C-------------------------------------------------------------------------------
Q ss_conf             9-------------------------------------------------------------------------------
Q 003496          277 C-------------------------------------------------------------------------------  277 (815)
Q Consensus       277 ~-------------------------------------------------------------------------------  277 (815)
                      .                                                                               
T Consensus         1 ~~~w~~~~~~~~~~~~~viYe~~~~~f~~~Gd~~g~~~~ldyl~~LGv~~i~L~Pv~~~~~~~~~GY~~~d~~~vdp~~G   80 (420)
T d2bhua3           1 TFDWTDADWHGIKLADCVFYEVHVGTFTPEGTYRAAAEKLPYLKELGVTAIQVMPLAAFDGQRGWGYDGAAFYAPYAPYG   80 (420)
T ss_dssp             SSCCCCTTCCCCCGGGCCEEEECHHHHSSSCSHHHHHHTHHHHHHHTCCEEEECCCEECSSSCCCSTTCCEEEEECGGGC
T ss_pred             CCCCCCCCCCCCCCCCCEEEEEEHHHCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             96899989798884224899996002188999999998679999769998995998768888998888566888685659


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 003496          278 --------------------------------------------------------------------------------  277 (815)
Q Consensus       278 --------------------------------------------------------------------------------  277 (815)
                                                                                                      
T Consensus        81 ~~~d~~~lv~~aH~~gi~VilD~V~NH~~~~~~~~~~~~~~~~~~~~~~~~~~dlN~~np~v~~~~~~~~~~Wl~~~GVD  160 (420)
T d2bhua3          81 RPEDLMALVDAAHRLGLGVFLDVVYNHFGPSGNYLSSYAPSYFTDRFSSAWGMGLDYAEPHMRRYVTGNARMWLRDYHFD  160 (420)
T ss_dssp             CHHHHHHHHHHHHHTTCEEEEEECCSCCCSSSCCHHHHCGGGEEEEEECSSSEEECTTSHHHHHHHHHHHHHHHHHHCCS
T ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHEEEECCCCC
T ss_conf             99999999999974054534465535667777633334443334554322345545368699999988764032014653


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 003496          278 --------------------------------------------------------------------------------  277 (815)
Q Consensus       278 --------------------------------------------------------------------------------  277 (815)
                                                                                                      
T Consensus       161 GfR~D~~~~l~~~~~~~~~~~~~~~~~~~~p~~~~i~E~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (420)
T d2bhua3         161 GLRLDATPYMTDDSETHILTELAQEIHELGGTHLLLAEDHRNLPDLVTVNHLDGIWTDDFHHETRVTLTGEQEGYYAGYR  240 (420)
T ss_dssp             EEEETTGGGCCCCSSSCHHHHHHHHHHTTCSCCEEEEECSSCCTHHHHTTCCSEEECTHHHHHHHHHHHCCCSGGGGGCC
T ss_pred             EEEEEEEEEECCCCCCCCHHHHHHHHHHHCCCCEEEECCCCCCHHHHCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCC
T ss_conf             78873333202122310079998888764687425620357753121001125422323210444301334445312330


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 003496          278 --------------------------------------------------------------------------------  277 (815)
Q Consensus       278 --------------------------------------------------------------------------------  277 (815)
                                                                                                      
T Consensus       241 ~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~nHD~~~~~~~~~r~~~~~~~~~~~~k~a~~~ll  320 (420)
T d2bhua3         241 GGAEALAYTIRRGWRYEGQFWAVKGEEHERGHPSDALEAPNFVYCIQNHDQIGNRPLGERLHQSDGVTLHEYRGAAALLL  320 (420)
T ss_dssp             CSHHHHHHHHHHSSSCEEEEECCTTCCEEEECCCTTCCGGGEEEESCCHHHHHTSTTCCCGGGSTTCCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCCHHHHHCHHHHHCCCCCCCCHHHEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             26678999985144446520443153554126433455213034321566323553112356643565999999999998


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 003496          278 --------------------------------------------------------------------------------  277 (815)
Q Consensus       278 --------------------------------------------------------------------------------  277 (815)
                                                                                                      
T Consensus       321 t~pG~P~iy~GdEig~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~  400 (420)
T d2bhua3         321 TLPMTPLLFQGQEWAASTPFQFFSDHAGELGQAVSEGRKKEFGGFSGFSGEDVPDPQAEQTFLNSKLNWAEREGGEHART  400 (420)
T ss_dssp             HSSSEEEEETTGGGTCSSCCCCCCCCCHHHHHHHHHHHHHHC---------CCCCTTSHHHHHTTSCCSGGGGSHHHHHH
T ss_pred             HCCCCCEEECCHHHCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCHHH
T ss_conf             48998798577511789986323456402203544466311367776665557886555544456678788623476899


Q ss_pred             -------------------C
Q ss_conf             -------------------9
Q 003496          278 -------------------V  278 (815)
Q Consensus       278 -------------------~  278 (815)
                                         .
T Consensus       401 ~~~yr~Li~lRk~~p~l~~~  420 (420)
T d2bhua3         401 LRLYRDLLRLRREDPVLHNR  420 (420)
T ss_dssp             HHHHHHHHHHHHHCTTTTCC
T ss_pred             HHHHHHHHHHHHCCHHHHCC
T ss_conf             99999999999568987575



>d1ejda_ d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d2df7a1 b.121.4.9 (A:11-429) Birnavirus VP2 {Infectious bursal disease virus [TaxId: 10995]} Back     information, alignment and structure
>d1om4a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gp4a2 d.334.1.1 (A:1-418) 6-phosphogluconate dehydratase EDD {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d1f61a_ c.1.12.7 (A:) Isocitrate lyase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7ea_ c.123.1.1 (A:) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bona1 d.92.1.7 (A:3-419) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} Back     information, alignment and structure
>d1w6ga1 b.30.2.1 (A:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2csga1 b.82.2.12 (A:3-419) Hypothetical protein YbiU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ltka_ c.86.1.1 (A:) Phosphoglycerate kinase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gff1_ b.121.5.1 (1:) Microvirus capsid proteins {Bacteriophage G4 [TaxId: 10843]} Back     information, alignment and structure
>d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1q2oa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d8wa_ c.1.15.2 (A:) L-rhamnose isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vnud4 b.40.4.16 (D:495-910) Exosome complex exonuclease RRP44 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1igwa_ c.1.12.7 (A:) Isocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pb1a_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dnva_ b.121.5.3 (A:) Densovirus capsid protein {Galleria mellonella densovirus [TaxId: 37138]} Back     information, alignment and structure
>d1so2a_ a.211.1.2 (A:) cGMP-inhibited 3',5'-cyclic phosphodiesterase B, pde3b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d16pka_ c.86.1.1 (A:) Phosphoglycerate kinase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2ieaa2 c.36.1.10 (A:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qpga_ c.86.1.1 (A:) Phosphoglycerate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qeec1 c.1.9.8 (C:2-416) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1s5ja2 e.8.1.1 (A:450-864) Family B DNA polymerase {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2b8na1 c.118.1.1 (A:4-417) Putative glycerate kinase (hypothetical protein TM1585) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t0la_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1vh4a_ b.80.6.1 (A:) Stabilizer of iron transporter SufD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdia_ c.86.1.1 (A:) Phosphoglycerate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2qgma1 c.150.1.3 (A:33-445) Succinoglycan biosynthesis protein BC3205 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1lwda_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zjca1 e.60.1.1 (A:3-415) Aminopeptidase S, AMPS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1a0tp_ f.4.3.2 (P:) Sucrose-specific porin {Enterobacterium (Salmonella typhimurium) [TaxId: 90371]} Back     information, alignment and structure
>d1ulva1 a.102.1.5 (A:274-686) Glucodextranase, domain A {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1yzya1 c.146.1.1 (A:1-412) Hypothetical protein HI1011 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1rxxa_ d.126.1.4 (A:) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ufaa2 c.6.2.4 (A:1-412) Hypothetical protein TT1467, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t3ca_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium botulinum, serotype E [TaxId: 1491]} Back     information, alignment and structure
>d2afaa1 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ux5a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ccaa1 a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p1ja1 c.2.1.3 (A:9-322,A:438-533) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kfsa2 e.8.1.1 (A:519-928) DNA polymerase I (Klenow fragment) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1s5ja1 c.55.3.5 (A:40-449) Exonuclease domain of family B DNA polymerases {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2cmza1 e.76.1.2 (A:1-409) Spike glycoprotein {Vesicular stomatitis indiana virus [TaxId: 11277]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1qtma2 e.8.1.1 (A:423-831) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2g0da1 a.102.6.1 (A:7-415) Nisin biosynthesis protein NisC {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1b25a1 a.110.1.1 (A:211-619) Formaldehyde ferredoxin oxidoreductase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1s9ra_ d.126.1.4 (A:) Arginine deiminase {Mycoplasma arginini [TaxId: 2094]} Back     information, alignment and structure
>d1dkla_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f1oa_ a.127.1.1 (A:) Adenylosuccinate lyase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hhva2 e.8.1.1 (A:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1eu8a_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1mwva1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1itka1 a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1ub2a1 a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ei6a_ c.76.1.4 (A:) Phosphonoacetate hydrolase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2ayia1 e.60.1.1 (A:3-408) Aminopeptidase T {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2nwwa1 f.49.1.1 (A:12-416) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1h6za3 d.142.1.5 (A:1-405) Pyruvate phosphate dikinase, N-terminal domain {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1uyra2 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2b5dx2 c.6.2.4 (X:1-404) Alpha-amylase AmyC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h12a_ a.102.1.2 (A:) Endo-1,4-beta-xylanase {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1xksa_ b.69.14.1 (A:) Nuclear pore complex protein Nup133 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d3b55a1 c.150.1.3 (A:40-442) Succinoglycan biosynthesis protein BC3120 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2g5da1 b.52.1.4 (A:40-441) Membrane-bound lytic murein transglycosylase A, MLTA {Neisseria gonorrhoeae [TaxId: 485]} Back     information, alignment and structure
>d1xk7a1 c.123.1.1 (A:4-405) Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dofa_ a.127.1.1 (A:) Adenylosuccinate lyase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1fp3a_ a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fb1 a.102.4.3 (B:521-921) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a12a_ b.69.5.1 (A:) Regulator of chromosome condensation RCC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d2r7da2 b.40.4.16 (A:3-403) Ribonuclease II family protein DR0020 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ru4a_ b.80.1.9 (A:) Pectate transeliminase {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d3ovwa_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Fusarium oxysporum [TaxId: 5507]} Back     information, alignment and structure
>d1inpa_ e.7.1.1 (A:) Inositol polyphosphate 1-phosphatase {Cow (Bos taurus), brain [TaxId: 9913]} Back     information, alignment and structure
>d2olua2 e.3.1.1 (A:293-692) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2ah2a2 b.68.1.1 (A:1-399) Trypanosoma sialidase {Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId: 5693]} Back     information, alignment and structure
>d1bn8a_ b.80.1.1 (A:) Pectate lyase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vpea_ c.86.1.1 (A:) Phosphoglycerate kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1q1la_ d.258.1.1 (A:) Chorismate synthase, AroC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vkoa1 c.2.1.3 (A:11-314,A:429-521) Myo-inositol 1-phosphate synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vjva_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lf6a1 a.102.1.5 (A:288-684) Bacterial glucoamylase, C-terminal domain {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1io1a_ e.32.1.1 (A:) Phase 1 flagellin {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1aora1 a.110.1.1 (A:211-605) Aldehyde ferredoxin oxidoreductase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1phpa_ c.86.1.1 (A:) Phosphoglycerate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u1ha1 c.1.22.2 (A:2-395) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase MetE {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1atia2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1q8ia2 e.8.1.1 (A:390-783) Family B DNA polymerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldja2 a.118.17.1 (A:17-410) Cullin homolog 1, Cul-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xlma_ c.1.15.3 (A:) D-xylose isomerase {Arthrobacter, strain b3728 [TaxId: 1663]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8ma2 c.97.1.4 (A:201-593) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2d0ta1 a.266.1.2 (A:12-403) Indoleamine 2,3-dioxygenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xima_ c.1.15.3 (A:) D-xylose isomerase {Actinoplanes missouriensis [TaxId: 1866]} Back     information, alignment and structure
>d1yvua2 c.55.3.10 (A:315-706) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1nt4a_ c.60.1.2 (A:) Glucose-1-phosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d4ubpc2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii [TaxId: 1474]} Back     information, alignment and structure
>d1v6sa_ c.86.1.1 (A:) Phosphoglycerate kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nsca_ b.68.1.1 (A:) Influenza neuraminidase {Influenza B virus, different strains [TaxId: 11520]} Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oj7a_ e.22.1.2 (A:) Hypothetical oxidoreductase yqhD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1sg6a_ e.22.1.1 (A:) Dehydroquinate synthase, DHQS {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1jiha2 e.8.1.7 (A:1-389) DNA polymerase eta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e9yb2 c.1.9.2 (B:132-431,B:481-569) alpha-subunit of urease, catalytic domain {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2o3ia1 e.73.1.1 (A:2-390) Hypothetical protein CV3147 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d1f8ea_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]} Back     information, alignment and structure
>d1u7la_ e.57.1.1 (A:) Vacuolar ATP synthase subunit C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxoa_ d.258.1.1 (A:) Chorismate synthase, AroC {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d2dcfa1 e.3.1.1 (A:5-392) 6-aminohexanoate-dimer hydrolase NylC {Flavobacterium sp. [TaxId: 239]} Back     information, alignment and structure
>d1q8ia1 c.55.3.5 (A:2-389) Exonuclease domain of family B DNA polymerases {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2py5a2 e.8.1.1 (A:188-575) phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1x38a1 c.1.8.7 (A:1-388) Beta-D-glucan exohydrolase, N-terminal domain {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1zeea1 a.266.1.2 (A:6-392) Hypothetical protein SO4414 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d2aepa1 b.68.1.1 (A:83-469) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bxba_ c.1.15.3 (A:) D-xylose isomerase {Thermus aquaticus, subsp. Thermophilus [TaxId: 271]} Back     information, alignment and structure
>d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d2ex0a1 c.87.1.9 (A:26-412) Alpha-2,3/2,6-sialyltransferase/sialidase {Pasteurella multocida [TaxId: 747]} Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r6ta2 c.26.1.1 (A:82-467) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1muwa_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces olivochromogenes [TaxId: 1963]} Back     information, alignment and structure
>d3c10a1 c.42.1.2 (A:515-900) Histone deacetylase 7, HDAC7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5da_ a.102.1.2 (A:) Chitosanase {Bacillus sp., strain k17 [TaxId: 1409]} Back     information, alignment and structure
>d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uhga_ e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1xmxa_ c.52.1.26 (A:) Hypothetical protein VC1899 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ir6a_ c.107.1.2 (A:) Exonuclease RecJ {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ejxc2 c.1.9.2 (C:1130-1422,C:1476-1567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes [TaxId: 28451]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d2c5wb1 e.3.1.1 (B:266-650) Penicillin-binding protein 1a, transpeptidase domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ix0a4 b.40.4.16 (A:173-557) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mtyb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d3c0na2 f.8.1.1 (A:85-468) (Pro)aerolysin, pore-forming lobe {Aeromonas hydrophila [TaxId: 644]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1hn0a1 a.102.3.2 (A:235-618) Chondroitin ABC lyase I {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2fvka2 c.1.9.6 (A:57-440) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1vz6a_ d.154.1.2 (A:) Glutamate N-acetyltransferase 2 (ornithine acetyltransferase) {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u7ga_ f.44.1.1 (A:) Ammonium transporter AmtB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mhyb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylosinus trichosporium [TaxId: 426]} Back     information, alignment and structure
>d1bo1a_ d.143.1.2 (A:) Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t1ua1 c.43.1.3 (A:20-401) Choline O-acetyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xl7a1 c.43.1.3 (A:11-392) Peroxisomal carnitine O-octanoyltransferase, COT {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bvua3 c.6.2.1 (A:31-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1odza_ c.1.8.3 (A:) Mannanase A, ManA {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1vbga3 d.142.1.5 (A:3-382) Pyruvate phosphate dikinase, N-terminal domain {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1elja_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lj5a_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d3sila_ b.68.1.1 (A:) Salmonella sialidase {Salmonella typhimurium, strain lt2 [TaxId: 90371]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1a59a_ a.103.1.1 (A:) Citrate synthase {Antarctic bacterium DS2-3R [TaxId: 56673]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2d5ja1 a.102.1.7 (A:1-377) Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [TaxId: 84635]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2i71a1 e.72.1.1 (A:1-377) Hypothetical protein SSO1389 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ci9a_ e.3.1.1 (A:) Esterase EstB {Burkholderia gladioli [TaxId: 28095]} Back     information, alignment and structure
>d1jmma_ b.30.6.1 (A:) V-region of surface antigen I/II (SA I/II, PAC) {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1nm8a1 c.43.1.3 (A:9-385) Carnitine acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wu4a1 a.102.1.2 (A:6-381) Xylanase Y {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2v3qa1 c.94.1.1 (A:1-376) PstS-like phosphate-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhea_ b.80.1.3 (A:) Polygalacturonase {Erwinia carotovora, subsp. carotovora [TaxId: 554]} Back     information, alignment and structure
>d2fug41 e.18.1.2 (4:35-409) NADH-quinone oxidoreductase chain 4, Nqo4 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ih7a1 c.55.3.5 (A:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kbla3 d.142.1.5 (A:2-376) Pyruvate phosphate dikinase, N-terminal domain {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1txka2 b.30.5.9 (A:23-396) Glucans biosynthesis protein G (MdoG, OpgG), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ioma_ a.103.1.1 (A:) Citrate synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2a0ua1 c.124.1.5 (A:10-383) Initiation factor 2b {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1nd7a_ d.148.1.1 (A:) WW domain-containing protein 1, WWP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rp4a_ a.227.1.1 (A:) Endoplasmic oxidoreductin 1, Ero1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bvca2 d.128.1.1 (A:105-478) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1so7a_ b.68.1.1 (A:) Sialidase 2 (Neu2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ogmx2 b.80.1.10 (X:202-574) Dextranase, catalytic domain {Penicillium minioluteum [TaxId: 28574]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1m0wa2 d.142.1.6 (A:6-210,A:324-491) Eukaryotic glutathione synthetase ATP-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5ya_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1c3pa_ c.42.1.2 (A:) HDAC homologue {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1noya_ c.55.3.5 (A:) Exonuclease domain of family B DNA polymerases {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1qlpa_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vkpa_ d.126.1.6 (A:) Agmatine iminohydrolase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mkfa_ b.116.1.1 (A:) Viral chemokine binding protein m3 {Murid herpesvirus 4, MuHV-4 [TaxId: 33708]} Back     information, alignment and structure
>d1r53a_ d.258.1.1 (A:) Chorismate synthase, AroC {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1to6a_ c.141.1.1 (A:) Glycerate kinase GlxK {Neisseria meningitidis, (serogroup A) [TaxId: 487]} Back     information, alignment and structure
>d1aj8a_ a.103.1.1 (A:) Citrate synthase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1n7oa1 a.102.3.2 (A:170-540) Hyaluronate lyase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1f1sa1 a.102.3.2 (A:249-619) Hyaluronate lyase {Streptococcus agalactiae [TaxId: 1311]} Back     information, alignment and structure
>d1c8ba_ c.56.1.2 (A:) Germination protease {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1eg1a_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Endoglucanase I [TaxId: 51453]} Back     information, alignment and structure
>d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2dexx3 d.126.1.5 (X:294-663) Peptidylarginine deiminase Pad4, catalytic C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gx8a1 c.135.1.1 (A:4-373) Nif3-related protein BC4286 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2hgsa4 d.142.1.6 (A:3-201,A:304-474) Eukaryotic glutathione synthetase ATP-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iq0a2 c.26.1.1 (A:97-466) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1itua_ c.1.9.7 (A:) Renal dipeptidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwha1 a.102.3.2 (A:4-372) Chondroitinase AC {Arthrobacter aurescens [TaxId: 43663]} Back     information, alignment and structure
>d2heka1 a.211.1.1 (A:1-369) Hypothetical protein aq_1910 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ewoa1 d.126.1.6 (A:2-370) Agmatine iminohydrolase {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ga6a_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Pseudomonas sp., sedolisin [TaxId: 306]} Back     information, alignment and structure
>d1laxa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1r8ga_ d.128.1.3 (A:) Carboxylate-amine ligase YbdK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1f52a2 d.128.1.1 (A:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pyya4 e.3.1.1 (A:264-631) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o7xa_ a.103.1.1 (A:) Citrate synthase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1iuqa_ c.112.1.1 (A:) Glycerol-3-phosphate (1)-acyltransferase {Cushaw squash (Cucurbita moschata) [TaxId: 3662]} Back     information, alignment and structure
>d1b65a_ d.154.1.1 (A:) L-aminopeptidase D-Ala-esterase/amidase DmpA {Ochrobactrum anthropi [TaxId: 529]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1ursa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1qw9a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moqa_ c.80.1.1 (A:) "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1h6za1 c.1.12.2 (A:538-903) Pyruvate phosphate dikinase, C-terminal domain {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2bvya2 c.1.8.3 (A:5-370) Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u5ua_ e.5.1.2 (A:) Allene oxide synthase-lipoxygenase protein, N-terminal domain {Black sea rod (Plexaura homomalla) [TaxId: 47982]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fn9a_ d.196.1.1 (A:) Outer capsid protein sigma 3 {Reovirus [TaxId: 10891]} Back     information, alignment and structure
>d1um0a_ d.258.1.1 (A:) Chorismate synthase, AroC {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pnwa1 b.52.1.4 (A:5-369) Membrane-bound lytic murein transglycosylase A, MLTA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u1ha2 c.1.22.2 (A:396-760) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase MetE {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d3c8ya1 c.96.1.1 (A:210-574) Fe-only hydrogenase, catalytic domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2jera1 d.126.1.6 (A:2-365) Agmatine iminohydrolase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1t64a_ c.42.1.2 (A:) Histone deacetylase 8, HDAC8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kbla1 c.1.12.2 (A:510-873) Pyruvate phosphate dikinase, C-terminal domain {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kq3a_ e.22.1.2 (A:) Glycerol dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oc7a_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Humicola insolens, Cel6a [TaxId: 34413]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1w0pa3 b.68.1.1 (A:217-346,A:544-777) Vibrio cholerae sialidase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1m7va_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zaia1 c.1.10.1 (A:1-363) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]} Back     information, alignment and structure
>d1khba1 c.91.1.1 (A:260-622) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq1a2 c.88.1.1 (A:76-438) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1onha_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1nc5a_ a.102.1.6 (A:) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cnza_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kwfa_ a.102.1.2 (A:) CelA cellulase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2a1ha1 e.17.1.1 (A:3-365) Branched-chain aminoacid aminotransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1umga_ d.280.1.1 (A:) ST0318 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1gqea_ e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d3thia_ c.94.1.1 (A:) Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 49283]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1vlca_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2drwa1 e.3.1.1 (A:2-363) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1nqka_ c.1.16.4 (A:) Alkanesulfonate monooxygenase SsuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjxa1 c.1.8.6 (A:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qjwa_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Trichoderma reesei, Cel6a [TaxId: 51453]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dhsa_ c.31.1.1 (A:) Deoxyhypusine synthase, DHS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ia1 a.102.3.2 (A:26-386) Xanthan lyase {Bacillus sp. gl1 [TaxId: 84635]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lt7a_ c.1.26.1 (A:) Betaine-homocysteine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1pe9a_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type A [TaxId: 556]} Back     information, alignment and structure
>d1sq1a_ d.258.1.1 (A:) Chorismate synthase, AroC {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qo5a_ c.1.10.1 (A:) Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens), liver isozyme [TaxId: 9606]} Back     information, alignment and structure
>d1jdwa_ d.126.1.2 (A:) L-arginine: glycine amidinotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1xfia_ e.50.1.1 (A:) Hypothetical protein At2g17340 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1oxwa_ c.19.1.3 (A:) Patatin {Heartleaf nightshade (Solanum cardiophyllum) [TaxId: 160510]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d4bcla_ b.75.1.1 (A:) Bacteriochlorophyll A protein {Prosthecochloris aestuarii, strain 2k [TaxId: 1102]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1x74a1 c.123.1.1 (A:2-360) 2-methylacyl-CoA racemase Mcr {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yvra1 a.118.25.1 (A:5-363) 60-kda SS-aARo ribonucleoprotein {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2hrca1 c.92.1.1 (A:65-423) Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcxa_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type B [TaxId: 5061]} Back     information, alignment and structure
>d1idka_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type A [TaxId: 5061]} Back     information, alignment and structure
>d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hdsa1 e.3.1.1 (A:4-361) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]} Back     information, alignment and structure
>d1m7ja3 c.1.9.11 (A:62-419) N-acyl-D-aminoacid amidohydrolase, catalytic domain {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1dosa_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2qapa1 c.1.10.1 (A:1-357) Fructose-1,6-bisphosphate aldolase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1taza_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 1b, PDE1B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1t1ga_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Bacillus novosp. MN-32, kumamolisin [TaxId: 198803]} Back     information, alignment and structure
>d1a05a_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d2amxa1 c.1.9.1 (A:20-376) Adenosine deaminase (ADA) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1yyda1 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) {Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d16vpa_ d.180.1.1 (A:) Conserved core of transcriptional regulatory protein vp16 {Herpes simplex virus type 1 [TaxId: 10298]} Back     information, alignment and structure
>d1r3sa_ c.1.22.1 (A:) Uroporphyrinogen decarboxylase, UROD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8oa3 b.68.1.1 (A:47-402) Micromonospora sialidase, N-terminal domain {Micromonospora viridifaciens [TaxId: 1881]} Back     information, alignment and structure
>d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1lbqa_ c.92.1.1 (A:) Ferrochelatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v53a1 c.77.1.1 (A:1-356) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans [TaxId: 1398]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ebsa2 b.69.13.1 (A:431-786) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]} Back     information, alignment and structure
>d1jaka1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus [TaxId: 1922]} Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1vbga1 c.1.12.2 (A:521-876) Pyruvate phosphate dikinase, C-terminal domain {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1fuia2 c.85.1.1 (A:1-355) L-fucose isomerase, N-terminal and second domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luca_ c.1.16.1 (A:) Bacterial luciferase alpha chain, LuxA {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1iq8a1 c.1.20.1 (A:6-360) Archaeosine tRNA-guanine transglycosylase, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure