Citrus Sinensis ID: 003515

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810----
MAVAFVGGALLGAVFGELLRAVSEAKDKAVMFKDLLEQLESTLQNSTPMIKEIEKLNQVLDLPKHETDTLIEMMRRGEHLVHKCSRVKWNCFKRYDYAKKIIKLDRSIDTFFRTYIPLQQTRDNRVIMVDLKEVHMMVKRLSGNDRTSWMFNQVGVAGACSAPDPPPVTPGLDVPLQELKLELFKDGRQVIVVSAPGGYGKTTLVKKLCKDDQVLGKFKDNIFFVTVSQTPNVKGIVQKVYQHKGYAVPEFQTDEDAINDLERLLKPIRPEAILLVLDDVWSGSESLLQKFKFQLPYYKILVTSRSVFPQFGSGYDLKPLNDEAARTLFRYSANLQDGNSYIPDENLVNKILRACKGCPLALTVVGGSLCGKHPAIWQKRVKEWTQDVSVFHSNKEILSCLERSLDALNNEVKECYMDLCSFPEDQRIPITALVDMWMELYELVDELFAIANLHELSNLNLANCVATRKYASDDSCYNDHFVMQHDLLRELAIYQSTLEPIKQRKRLIIDTSGNNFPEWWMDQKQHPLNASLLSISTDETFSSNWYDMEAPEVKVVVLNVRTKKYTLPKFLEKMDKLKVMIVTNYGFFPAELSNIQVFGALSNLKRIRLEHVSLPSLTTVRMKHLQNVSLVMCNVDQVVQNSTFHFSDAFPNLLEIDIDYCNDLIELPDGLCDIVSIKKLRITNCHKLSALPEGIGKLVNLQMLTLASCTDLSALPDTIGNLSNLNFLDISECLNIQELPERIGELCSLKTLCLKGCSMFELPSSILNLENLEVVKCDEETAYQWEYFQLGQAKFRIEVIQEDINLYWLHNPHL
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHcccccccccccccEEEEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHccccccccEEEEEccccccccccEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcHHHHHHHHHcccccccccccHHHHHHHHHHccccccHHHHcccHHHHHHHHHHHHHHHccccccccccccccEEEcHHHHHHHHHHcccccccccccEEEcccccccccccccccccccccEEEEEccccccccccccccccEEEEEEEEcccccccccccccccccccEEEEcccccccccccccccccccccccEEEccccccccccccccccccEEccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEEccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEcccccccccccccccccccEEEEcccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHccccEEEEEEccccccHHHHHHHHHccHHHHHHccccEEEEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHccccccccEEEEEEcccccccccEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEHHHHHHHHHHHHHcccccccccHEEcccccccccccccccccccEEEEEEEEEcccccccccccccccccEEEEEccccccccccHHHHHcHcccEEEEccccccccHHccccccccccHccEEEccccccccccccccHcccEEEEccccccccccccccHHccccccccEEEEcccccHHHccccccccccccEEEEcccccHHcccHHccccccccEEEEcccccHHcccHHHcccccccEEEEcccccHHcccHHccccccccEEEEcccccccccccHccccccEEEEcccccccccccccccccccEEEEccccccccccccccc
MAVAFVGGALLGAVFGELLRAVSEAKDKAVMFKDLLEQLESTLQNSTPMIKEIEKLNqvldlpkheTDTLIEMMRRGEHLvhkcsrvkwncfkryDYAKKIIKLDRSIDTFFRtyiplqqtrdnRVIMVDLKEVHMMVKRLSGNDRTSWMFNQVgvagacsapdpppvtpgldvplQELKLELFKDGRQVIvvsapggygktTLVKKLckddqvlgkfkdnIFFVTVSQTPNVKGIVQKVYqhkgyavpefqtdedAINDLERLLKPIRPEAILLVLDDVWSGSESLLQKFKFQLPYYKILVTsrsvfpqfgsgydlkplndEAARTLFRYSanlqdgnsyipdenLVNKILRACkgcplaltvvggslcgkhpAIWQKRVKEWTQDVSVFHSNKEILSCLERSLDALNNEVKECYMdlcsfpedqripITALVDMWMELYELVDELFAIANLHelsnlnlancvatrkyasddscyndhfvMQHDLLRELAIYQSTLEPIKQRKRLIIdtsgnnfpewwmdqkqhplnasllsistdetfssnwydmeapEVKVVVLNVrtkkytlpkflEKMDKLKVMIVTNYgffpaelsNIQVFGALSNLKRirlehvslpslttVRMKHLQNVSLVMCNVDQvvqnstfhfsdafpnLLEIDIDYCndlielpdglcdivsikklritnchklsalpegIGKLVNLQMLTLasctdlsalpdtignlsnlnfldiseclniqELPERIGELCSlktlclkgcsmfelpssilnlenlevvkcdeetAYQWEYFQLGQAKFRIEVIQEDINlywlhnphl
MAVAFVGGALLGAVFGELLRAVSEAKDKAVMFKDLLEQLESTLQNSTPMIKEIEklnqvldlpKHETDTLIEMMRRgehlvhkcsrvkwncfkRYDYAKKIIKLDRSIDTFFrtyiplqqtrdnrVIMVDLKEVHMMVKRLSGNDRTSWMFNQVGVAGACSAPDPPPVTPGLDVPLQELKLELFKDGRQVIVVsapggygkttlvkKLCKDDQVLGKFKDNIFFVTVSQTPNVKGIVQKVYQHKGYAVPEFQTDEDAINDLERLLKPIRPEAILLVLDDVWSGSESLLQKFKFQLPYYKILVTSRSVFPQFGSGYDLKPLNDEAARTLFRYSanlqdgnsyIPDENLVNKILRACKGCPLALTVVGGSLCGKHPAIWQKRVKEWTQDVSVFHSNKEILSCLERSLDALNNEVKECYMDLCSFPEDQRIPITALVDMWMELYELVDELFAIANLHELSNLNLANCVATRKYASDDSCYNDHFVMQHDLLRELAIYQSTLEPIKQRKRLIIDTSGNNFPEWWMDQKQHPLNASLLSISTDETFSSNWYDMEAPEVKVVVLNVRtkkytlpkflekmdkLKVMIVTNYGFFPAELSNIQVFGALSNLKRIRLEHVSLPSLTTVRMKHLQNVSLVMCNVDQVVQNSTFHFSDAFPNLLEIDIDYCNDLIELPDGLCDIVSIKKLRITNCHKLSALPEGIGKLVNLQMLTLASCTDLSALPDTIGNLSNLNFLDISECLNIQELPERIGELCSLKTLCLKGCSMFELPSSILNLENLEVVKCDEETAYQWEYFQLGQAKFRIEVIQEDINLywlhnphl
MavafvggallgavfgellRAVSEAKDKAVMFKDLLEQLESTLQNSTPMIKEIEKLNQVLDLPKHETDTLIEMMRRGEHLVHKCSRVKWNCFKRYDYAKKIIKLDRSIDTFFRTYIPLQQTRDNRVIMVDLKEVHMMVKRLSGNDRTSWMFNQVGVAGACSAPDPPPVTPGLDVPLQELKLELFKDGRQVIVVSAPGGYGKTTLVKKLCKDDQVLGKFKDNIFFVTVSQTPNVKGIVQKVYQHKGYAVPEFQTDEDAINDLERLLKPIRPEAILLVLDDVWSGSESLLQKFKFQLPYYKILVTSRSVFPQFGSGYDLKPLNDEAARTLFRYSANLQDGNSYIPDENLVNKILRACKGCPLALTVVGGSLCGKHPAIWQKRVKEWTQDVSVFHSNKEILSCLERSLDALNNEVKECYMDLCSFPEDQRIPITALVDMWMELYELVDELFAIANLHELSNLNLANCVATRKYASDDSCYNDHFVMQHDLLRELAIYQSTLEPIKQRKRLIIDTSGNNFPEWWMDQKQHPLNASLLSISTDETFSSNWYDMEAPEVKVVVLNVRTKKYTLPKFLEKMDKLKVMIVTNYGFFPAELSNIQVFGALSNLKRIRLEHVSLPSLTTVRMKHLQNVSLVMCNVDQVVQNSTFHFSDAFPNLLEIDIDYCNDLIELPDGLCDIVSIKKLRITNCHKLSALPEGIGKLVNLQMLTLASCTDLSALPDTIGNLSNLNFLDISECLNIQELPERIGELCSLKTLCLKGCSMFELPSSILNLENLEVVKCDEETAYQWEYFQLGQAKFRIEVIQEDINLYWLHNPHL
**VAFVGGALLGAVFGELLRAVSEAKDKAVMFKDLLEQLE********MIKEIEKLNQVLDLPKHETDTLIEMMRRGEHLVHKCSRVKWNCFKRYDYAKKIIKLDRSIDTFFRTYIPLQQTRDNRVIMVDLKEVHMMVKRLSGNDRTSWMFNQVGVAGACSA******TPGLDVPLQELKLELFKDGRQVIVVSAPGGYGKTTLVKKLCKDDQVLGKFKDNIFFVTVSQTPNVKGIVQKVYQHKGYAVPEFQTDEDAINDLERLLKPIRPEAILLVLDDVWSGSESLLQKFKFQLPYYKILVTSRSVFPQFGSGYDLKPLNDEAARTLFRYSANLQDGNSYIPDENLVNKILRACKGCPLALTVVGGSLCGKHPAIWQKRVKEWTQDVSVFHSNKEILSCLERSLDALNNEVKECYMDLCSFPEDQRIPITALVDMWMELYELVDELFAIANLHELSNLNLANCVATRKYASDDSCYNDHFVMQHDLLRELAIYQSTLEPIKQRKRLIIDTSGNNFPEWWMDQKQHPLNASLLSISTDETFSSNWYDMEAPEVKVVVLNVRTKKYTLPKFLEKMDKLKVMIVTNYGFFPAELSNIQVFGALSNLKRIRLEHVSLPSLTTVRMKHLQNVSLVMCNVDQVVQNSTFHFSDAFPNLLEIDIDYCNDLIELPDGLCDIVSIKKLRITNCHKLSALPEGIGKLVNLQMLTLASCTDLSALPDTIGNLSNLNFLDISECLNIQELPERIGELCSLKTLCLKGCSMFELPSSILNLENLEVVKCDEETAYQWEYFQLGQAKFRIEVIQEDINLYWLH****
MAVAFVGGALLGAVFGELLRAVSEAKDKAVMFKDLLEQLESTLQNSTPMIKEIEKLNQVLDLPKHETDTLIEMMRRGEHLVHKCSRVKWNC***************SIDTFFRTYIPLQQTRD********************************************VTPGLDVPLQELKLELFKDGRQVIVVSAPGGYGKTTLVKKLCKDDQVLGKFKDNIFFVTVSQTPNVKGIVQKVYQHK****************LERLLKPIRPEAILLVLDDVWSGSESLLQKFKFQLPYYKILVTSRSVFPQFGSGYDLKPLNDEAARTLFRYSANL******I**ENLVNKILRACKGCPLALTVVGGSLCGKHPAIWQKRVK*************EILSCLERSLDALNNEVKECYMDLCSFPEDQRIPITALVDMWMELYELVDELFAIANLHELSNLNLANCVATRKYASDDSCYNDHFVMQHDLLRELAIYQSTLEPIKQRKRLIIDTSGNNFPEWW***KQHPLNASLLSISTDETFSSNWYDMEAPEVKVVVLNVRTKKYTLPKFLEKMDKLKVMIVTNYGFFPAELSNIQVFGALSNLKRIRLEHVSLPSLTTVRMKHLQNVSLVMCNVDQVVQNSTFHFSDAFPNLLEIDIDYCNDLIELPDGLCDIVSIKKLRITNCHKLSALPEGIGKLVNLQMLTLASCTDLSALPDTIGNLSNLNFLDISECLNIQELPERIGELCSLKTLCLKGCSMFELPSSILNLENLEVVKCDEE***************RIEVIQEDINLYWLHN***
MAVAFVGGALLGAVFGELLRAVSEAKDKAVMFKDLLEQLESTLQNSTPMIKEIEKLNQVLDLPKHETDTLIEMMRRGEHLVHKCSRVKWNCFKRYDYAKKIIKLDRSIDTFFRTYIPLQQTRDNRVIMVDLKEVHMMVKRLSGNDRTSWMFNQVGVAGACSAPDPPPVTPGLDVPLQELKLELFKDGRQVIVVSAPGGYGKTTLVKKLCKDDQVLGKFKDNIFFVTVSQTPNVKGIVQKVYQHKGYAVPEFQTDEDAINDLERLLKPIRPEAILLVLDDVWSGSESLLQKFKFQLPYYKILVTSRSVFPQFGSGYDLKPLNDEAARTLFRYSANLQDGNSYIPDENLVNKILRACKGCPLALTVVGGSLCGKHPAIWQKRVKEWTQDVSVFHSNKEILSCLERSLDALNNEVKECYMDLCSFPEDQRIPITALVDMWMELYELVDELFAIANLHELSNLNLANCVATRKYASDDSCYNDHFVMQHDLLRELAIYQSTLEPIKQRKRLIIDTSGNNFPEWWMDQKQHPLNASLLSISTDETFSSNWYDMEAPEVKVVVLNVRTKKYTLPKFLEKMDKLKVMIVTNYGFFPAELSNIQVFGALSNLKRIRLEHVSLPSLTTVRMKHLQNVSLVMCNVDQVVQNSTFHFSDAFPNLLEIDIDYCNDLIELPDGLCDIVSIKKLRITNCHKLSALPEGIGKLVNLQMLTLASCTDLSALPDTIGNLSNLNFLDISECLNIQELPERIGELCSLKTLCLKGCSMFELPSSILNLENLEVVKCDEETAYQWEYFQLGQAKFRIEVIQEDINLYWLHNPHL
MAVAFVGGALLGAVFGELLRAVSEAKDKAVMFKDLLEQLESTLQNSTPMIKEIEKLNQVLDLPKHETDTLIEMMRRGEHLVHKCSRVKWNCFKRYDYAKKIIKLDRSIDTFFRTYIPLQQTRDNRVIMVDLKEVHMMVKRLSGNDRTSWMFNQVGVAGACSAPDPPPVTPGLDVPLQELKLELFKDGRQVIVVSAPGGYGKTTLVKKLCKDDQVLGKFKDNIFFVTVSQTPNVKGIVQKVYQHKGYAVPEFQTDEDAINDLERLLKPIRPEAILLVLDDVWSGSESLLQKFKFQLPYYKILVTSRSVFPQFGSGYDLKPLNDEAARTLFRYSANLQDGNSYIPDENLVNKILRACKGCPLALTVVGGSLCGKHPAIWQKRVKEWTQDVSVFHSNKEILSCLERSLDALNNEVKECYMDLCSFPEDQRIPITALVDMWMELYELVDELFAIANLHELSNLNLANCVATRKYASDDSCYNDHFVMQHDLLRELAIYQSTLEPIKQRKRLIIDTSGNNFPEWWMDQKQHPLNASLLSISTDETFSSNWYDMEAPEVKVVVLNVRTKKYTLPKFLEKMDKLKVMIVTNYGFFPAELSNIQVFGALSNLKRIRLEHVSLPSLTTVRMKHLQNVSLVMCNVDQVVQNSTFHFSDAFPNLLEIDIDYCNDLIELPDGLCDIVSIKKLRITNCHKLSALPEGIGKLVNLQMLTLASCTDLSALPDTIGNLSNLNFLDISECLNIQELPERIGELCSLKTLCLKGCSMFELPSSILNLENLEVVKCDEETAYQWEYFQLGQAKFRIEVIQEDINLYWLHN***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVAFVGGALLGAVFGELLRAxxxxxxxxxxxxxxxxxxxxxLQNSTPMIKEIEKLNQVLDLPKHETDTLIEMMRRGEHLVHKCSRVKWNCFKRYDYAKKIIKLDRSIDTFFRTYIPLQQTRDNRVIMVDLKEVHMMVKRLSGNDRTSWMFNQVGVAGACSAPDPPPVTPGLDVPLQELKLELFKDGRQVIVVSAPGGYGKTTLVKKLCKDDQVLGKFKDNIFFVTVSQTPNVKGIVQKVYQHKGYAVPEFQTDEDAINDLERLLKPIRPEAILLVLDDVWSGSESLLQKFKFQLPYYKILVTSRSVFPQFGSGYDLKPLNDEAARTLFRYSANLQDGNSYIPDENLVNKILRACKGCPLALTVVGGSLCGKHPAIWQKRVKEWTQDVSVFHSNKEIxxxxxxxxxxxxxxxxxxxxxLCSFPEDQRIPITALVDMWMELYELVDELFAIANLHELSNLNLANCVATRKYASDDSCYNDHFVMQHDLLRELAIYQSTLEPIKQRKRLIIDTSGNNFPEWWMDQKQHPLNASLLSISTDETFSSNWYDMEAPEVKVVVLNVRTKKYTLPKFLEKMDKLKVMIVTNYGFFPAELSNIQVFGALSNLKRIRLEHVSLPSLTTVRMKHLQNVSLVMCNVDQVVQNSTFHFSDAFPNLLEIDIDYCNDLIELPDGLCDIVSIKKLRITNCHKLSALPEGIGKLVNLQMLTLASCTDLSALPDTIGNLSNLNFLDISECLNIQELPERIGELCSLKTLCLKGCSMFELPSSILNLENLEVVKCDEETAYQWEYFQLGQAKFRIEVIQEDINLYWLHNPHL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query814 2.2.26 [Sep-21-2011]
Q9FKZ1809 Probable disease resistan yes no 0.964 0.970 0.423 1e-163
Q9FKZ0815 Probable disease resistan no no 0.961 0.960 0.404 1e-148
Q9SZA7816 Probable disease resistan no no 0.961 0.959 0.315 1e-113
Q9LZ25811 Probable disease resistan no no 0.955 0.959 0.297 1e-107
Q9FW44787 Disease resistance protei no no 0.947 0.979 0.293 1e-98
Q9LVT1623 Putative disease resistan no no 0.746 0.975 0.320 3e-96
Q9FKZ2415 Probable disease resistan no no 0.468 0.918 0.420 2e-77
Q84WJ0702 Protein DA1-related 5 OS= no no 0.423 0.491 0.391 2e-51
Q38834852 Disease resistance RPP13- no no 0.812 0.775 0.245 4e-22
P0C8S1 906 Probable disease resistan no no 0.652 0.586 0.255 1e-19
>sp|Q9FKZ1|DRL42_ARATH Probable disease resistance protein At5g66900 OS=Arabidopsis thaliana GN=At5g66900 PE=3 SV=1 Back     alignment and function desciption
 Score =  575 bits (1483), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 343/810 (42%), Positives = 484/810 (59%), Gaps = 25/810 (3%)

Query: 8   GALLGAVFGELLRAVSEAKDKAVMFKDLLEQLESTLQNSTPMIKEIEKLNQVLDLPKHET 67
           G++  AVF +LL+ V +   K   FK L + L ST++   P+ ++I+ + + LD    E 
Sbjct: 10  GSIGEAVFSKLLKVVIDEAKKFKAFKPLSKDLVSTMEILFPLTQKIDSMQKELDFGVKEL 69

Query: 68  DTLIEMMRRGEHLVHKCSRVKWNCFKRYDYAKKIIKLDRSIDTFFRTYIPLQQTRDNRVI 127
             L + + R +  V K  RVKW  +++  Y +KI ++++ +  F +  + L Q R+   +
Sbjct: 70  KELRDTIERADVAVRKFPRVKW--YEKSKYTRKIERINKDMLKFCQIDLQLLQHRNQLTL 127

Query: 128 MVD----LKEVHMMVKRLSGNDRTSWMFNQVGVAGACSAPDPPPVTPGLDVPLQELKLEL 183
           +      +  V  + KR+      + +F  +     CS P    V  GLD PL ELK  L
Sbjct: 128 LGLTGNLVNSVDGLSKRMDLLSVPAPVFRDL-----CSVPKLDKVIVGLDWPLGELKKRL 182

Query: 184 FKDGRQVIVVSAPGGYGKTTLVKKLCKDDQVLGKFKDNIFFVTVSQTPNVKGIVQKVYQH 243
             D    +VVSAP G GKTTLV +LC D  + GKFK +IFF  VS TPN + IVQ + QH
Sbjct: 183 LDDSVVTLVVSAPPGCGKTTLVSRLCDDPDIKGKFK-HIFFNVVSNTPNFRVIVQNLLQH 241

Query: 244 KGYAVPEFQTDEDAINDLERLLKPIRPEA-ILLVLDDVWSGSESLLQKFKFQLPYYKILV 302
            GY    F+ D  A   L +LL+ ++    ILLVLDDVW G++S LQKF+ +LP YKILV
Sbjct: 242 NGYNALTFENDSQAEVGLRKLLEELKENGPILLVLDDVWRGADSFLQKFQIKLPNYKILV 301

Query: 303 TSRSVFPQFGSGYDLKPLNDEAARTLFRYSANLQDGNSYIPDENLVNKILRACKGCPLAL 362
           TSR  FP F S Y LKPL D+ AR L  + A+     S    E+L+ KIL+ C G P+ +
Sbjct: 302 TSRFDFPSFDSNYRLKPLEDDDARALLIHWASRPCNTSPDEYEDLLQKILKRCNGFPIVI 361

Query: 363 TVVGGSLCGKHPAIWQKRVKEWTQDVSVF-HSNKEILSCLERSLDALNNEVKECYMDLCS 421
            VVG SL G+    W+ +V+ W++   +       +L CL+ S DAL+  +KEC++D+ S
Sbjct: 362 EVVGVSLKGRSLNTWKGQVESWSEGEKILGKPYPTVLECLQPSFDALDPNLKECFLDMGS 421

Query: 422 FPEDQRIPITALVDMWMELYELVDELFAIANLHELSNLNLANCVATRKYASDDSCYNDHF 481
           F EDQ+I  + ++DMW+ELY     +  +  L +L++ NL   V       +D  YND  
Sbjct: 422 FLEDQKIRASVIIDMWVELYGKGSSILYMY-LEDLASQNLLKLVPLGTNEHEDGFYNDFL 480

Query: 482 VMQHDLLRELAIYQSTLEPIKQRKRLIIDTSGNNFPEWWMDQKQHPLNASLLSISTDETF 541
           V QHD+LRELAI QS  +   +RKRL ++   N FP+W ++     +NASLLSISTD+ F
Sbjct: 481 VTQHDILRELAICQSEFKENLERKRLNLEILENTFPDWCLNT----INASLLSISTDDLF 536

Query: 542 SSNWYDMEAPEVKVVVLNVRTKKYTLPKFLEKMDKLKVMIVTNYGFFPAELSNIQVFGAL 601
           SS W +M+ P V+ +VLN+ +  Y LP F+  M KLKV+ +TN+GF+PA LSN     +L
Sbjct: 537 SSKWLEMDCPNVEALVLNLSSSDYALPSFISGMKKLKVLTITNHGFYPARLSNFSCLSSL 596

Query: 602 SNLKRIRLEHVS--LPSLTTVRMKHLQNVSLVMCNVDQVVQNST-FHFSDAFPNLLEIDI 658
            NLKRIRLE VS  L  +  +++  L+ +SLVMC+  +V  ++     S+A   L EIDI
Sbjct: 597 PNLKRIRLEKVSITLLDIPQLQLSSLKKLSLVMCSFGEVFYDTEDIVVSNALSKLQEIDI 656

Query: 659 DYCNDLIELPDGLCDIVSIKKLRITNCHKLSALPEGIGKLVNLQMLTLASCTDLSALPDT 718
           DYC DL ELP  + +IVS+K L ITNC+KLS LPE IG L  L++L L S  +LS LP+ 
Sbjct: 657 DYCYDLDELPYWISEIVSLKTLSITNCNKLSQLPEAIGNLSRLEVLRLCSSMNLSELPEA 716

Query: 719 IGNLSNLNFLDISECLNIQELPERIGELCSLKTLCLKGCSMFELPSSILNLENLEVVKCD 778
              LSNL FLDIS CL +++LP+ IG+L +LK + ++ CS  ELP S+ NLENLE VKCD
Sbjct: 717 TEGLSNLRFLDISHCLGLRKLPQEIGKLQNLKKISMRKCSGCELPESVTNLENLE-VKCD 775

Query: 779 EETAYQWEYFQLGQAKFRI--EVIQEDINL 806
           EET   WE  +      R+  E I+ ++NL
Sbjct: 776 EETGLLWERLKPKMRNLRVQEEEIEHNLNL 805
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FKZ0|DRL43_ARATH Probable disease resistance protein At5g66910 OS=Arabidopsis thaliana GN=At5g66910 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZA7|DRL29_ARATH Probable disease resistance protein At4g33300 OS=Arabidopsis thaliana GN=At4g33300 PE=2 SV=3 Back     alignment and function description
>sp|Q9LZ25|DRL30_ARATH Probable disease resistance protein At5g04720 OS=Arabidopsis thaliana GN=At5g04720 PE=2 SV=1 Back     alignment and function description
>sp|Q9FW44|ADR1_ARATH Disease resistance protein ADR1 OS=Arabidopsis thaliana GN=ADR1 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVT1|DRL39_ARATH Putative disease resistance protein At5g47280 OS=Arabidopsis thaliana GN=At5g47280 PE=3 SV=1 Back     alignment and function description
>sp|Q9FKZ2|DRL41_ARATH Probable disease resistance protein At5g66890 OS=Arabidopsis thaliana GN=At5g66890 PE=3 SV=1 Back     alignment and function description
>sp|Q84WJ0|DAR5_ARATH Protein DA1-related 5 OS=Arabidopsis thaliana GN=DAR5 PE=2 SV=2 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description
>sp|P0C8S1|RP8L2_ARATH Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query814
359480461801 PREDICTED: probable disease resistance p 0.970 0.986 0.519 0.0
224096806804 cc-nbs-lrr resistance protein [Populus t 0.975 0.987 0.522 0.0
225463693823 PREDICTED: probable disease resistance p 0.986 0.975 0.507 0.0
359480459814 PREDICTED: probable disease resistance p 0.982 0.982 0.518 0.0
359496922815 PREDICTED: probable disease resistance p 0.979 0.977 0.512 0.0
359480455 1175 PREDICTED: probable disease resistance p 0.979 0.678 0.510 0.0
345104748822 disease resistance protein [Vitis pseudo 0.980 0.970 0.503 0.0
359480457797 PREDICTED: probable disease resistance p 0.961 0.982 0.506 0.0
255562653813 leucine-rich repeat-containing protein, 0.965 0.966 0.524 0.0
359480445803 PREDICTED: probable disease resistance p 0.969 0.982 0.505 0.0
>gi|359480461|ref|XP_002268207.2| PREDICTED: probable disease resistance protein At5g66900-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/820 (51%), Positives = 572/820 (69%), Gaps = 30/820 (3%)

Query: 1   MAVAFVGGALLGAVFGELLRAVSEAKDKAVMFKDLLEQLESTLQNSTPMIKEIEKLNQVL 60
           MA+  +G  ++  + GEL++A+ +   KA  F+ + ++L+STL +  P I+EIE+LN+  
Sbjct: 1   MALELIGETVVETLIGELIKAILDEGKKAAEFQAIFDRLQSTLISIGPTIQEIERLNKES 60

Query: 61  DLPKHETDTLIEMMRRGEHLVHKCSRVKW-NCFKRYDYAKKIIKLDRSIDTFFRTYIPLQ 119
           D  K ET+ L++M++ G+ L+ KCS+V W +  K++ Y+ K++ LD S+  FF+  + +Q
Sbjct: 61  DRSK-ETEQLVQMLKDGKELIQKCSKVTWWHYHKKWKYSNKLLDLDESLLRFFQVDMAVQ 119

Query: 120 QTRDNRVIMVDLKEVHMMVKRLSGNDRTSWMFNQVGVAGACSAPDPPPVTPGLDVPLQEL 179
             RD + I +  ++ + +                    G C APDPPP+T GLD+PLQEL
Sbjct: 120 GFRDIKEIKLGQRDPYHLK------------------LGPCQAPDPPPLTVGLDIPLQEL 161

Query: 180 KLELFKDGRQVIVVSAPGGYGKTTLVKKLCKDDQVLGKFKDNIFFVTVSQTPNVKGIVQK 239
           K+ LF+D   VIVVSAPGG GKTTL K LC D QV  KFK+NIF+VTVS+  N+  IVQ 
Sbjct: 162 KMRLFRDDSSVIVVSAPGGCGKTTLAKMLCHDHQVKEKFKNNIFYVTVSKAFNLNAIVQS 221

Query: 240 VYQHKGYAVPEFQTDEDAINDLERLLKPIRPEAILLVLDDVWSGSESLLQKFKFQLPYYK 299
           ++QH G+ V  FQ DEDA+N LERLL  I P  ILLVLDDVW GSESLL  F F++P YK
Sbjct: 222 LFQHNGHGVRVFQNDEDAVNQLERLLNQIAPAPILLVLDDVWGGSESLLDNFVFKIPNYK 281

Query: 300 ILVTSRSVFPQFGSGYDLKPLNDEAARTLFRYSANLQDGNSYIPDENLVNKILRACKGCP 359
           ILVTSR  FP+FGS Y L  L DE A TLFR SA  QDG SY+PDE+LV KI++ CKG P
Sbjct: 282 ILVTSRFEFPRFGSTYKLPLLKDEDAMTLFRSSAFQQDGRSYMPDEDLVEKIVKGCKGFP 341

Query: 360 LALTVVGGSLCGKHPAIWQKRVKEWTQDVSVFHSNKEILSCLERSLDALNNE--VKECYM 417
           LAL VVG SLCG+    W+ R+  W++  S+F S+ ++L CL+ SLDAL ++  +KEC+M
Sbjct: 342 LALRVVGRSLCGQPAEAWESRLLTWSEGQSIFSSDSDLLLCLQSSLDALADKGILKECFM 401

Query: 418 DLCSFPEDQRIPITALVDMWMELYEL-VDELFAIANLHELSNLNLANCVATRKYASD-DS 475
           DL SFPEDQ+IP TAL+DMW ELY+L    +FAI NL ELS  NL + V  RK  SD D 
Sbjct: 402 DLGSFPEDQKIPATALIDMWAELYKLHTGGVFAINNLQELSFRNLLSLVDARKDESDVDG 461

Query: 476 CYNDHFVMQHDLLRELAIYQSTLEPIKQRKRLIIDTSGNNFPEWWMDQKQHPLNASLLSI 535
           CYND +VM HDLLRELAIYQS+ EPI+QRKRLI+D SG+  P WW    Q P  A LLSI
Sbjct: 462 CYNDTYVMLHDLLRELAIYQSSQEPIEQRKRLIVDLSGDKVPNWWTQDNQQPFGARLLSI 521

Query: 536 STDETFSSNWYDMEAPEVKVVVLNVRTKK-YTLPKFLEKMDKLKVMIVTNYGFFPAELSN 594
           STDE FSS+W +++ PE++V++LN ++K+ YTLP+F+++M+KLKV+++TN G  PA+L N
Sbjct: 522 STDELFSSSWCNIQTPELEVLILNFQSKENYTLPEFIKQMEKLKVLVLTNNGPSPAQLIN 581

Query: 595 IQVFGALSNLKRIRLEHVSLPSL--TTVRMKHLQNVSLVMCNVDQVVQNSTFHFSDAFPN 652
             V G+L +LKRIR E V +P L  TT   K+L+ +SLVMC + + + N +   S+ FPN
Sbjct: 582 FSVLGSLPSLKRIRFEQVRIPPLCNTTAEFKNLEKISLVMCKISEALSNRSIQISNMFPN 641

Query: 653 LLEIDIDYCNDLIELPDGLCDIVSIKKLRITNCHKLSALPEGIGKLVNLQMLTLASCTDL 712
           L+E++IDYCNDL+EL +GLCD+V +KKL I+NC KLSALP+GIGKL NL++L L  C  L
Sbjct: 642 LVELNIDYCNDLVELLEGLCDLVELKKLSISNCPKLSALPKGIGKLGNLEVLRLRDCVKL 701

Query: 713 SALPDTIGNLSNLNFLDISECLNIQELPERIGELCSLKTLCLKGCSMF---ELPSSILNL 769
           S LPD+IG L  L+ LDIS CL I+E+P+++GELC+L+ + ++ C      ELP+S++NL
Sbjct: 702 SGLPDSIGRLHKLSVLDISGCLQIKEIPKQMGELCNLRKIHMRECWSLCRSELPASVMNL 761

Query: 770 ENLEVVKCDEETAYQWEYFQLGQAKFRIEVIQEDINLYWL 809
             L+ V CD ETA  WE F+      RI V +E+INL WL
Sbjct: 762 VGLKKVICDTETAKLWEPFEYHLKNLRISVPEENINLNWL 801

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224096806|ref|XP_002310744.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222853647|gb|EEE91194.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225463693|ref|XP_002276590.1| PREDICTED: probable disease resistance protein At5g66900 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359480459|ref|XP_002265449.2| PREDICTED: probable disease resistance protein At5g66900-like [Vitis vinifera] gi|302144172|emb|CBI23299.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496922|ref|XP_003635372.1| PREDICTED: probable disease resistance protein At5g66900-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359480455|ref|XP_003632465.1| PREDICTED: probable disease resistance protein At5g66900-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|345104748|gb|AEN71144.1| disease resistance protein [Vitis pseudoreticulata] Back     alignment and taxonomy information
>gi|359480457|ref|XP_002265331.2| PREDICTED: probable disease resistance protein At5g66900-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255562653|ref|XP_002522332.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223538410|gb|EEF40016.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359480445|ref|XP_003632464.1| PREDICTED: probable disease resistance protein At5g66900-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query814
TAIR|locus:2175019809 AT5G66900 [Arabidopsis thalian 0.945 0.951 0.430 5.1e-154
TAIR|locus:2174944815 AT5G66910 [Arabidopsis thalian 0.944 0.943 0.411 3.7e-142
TAIR|locus:2119196816 ADR1-L1 "ADR1-like 1" [Arabido 0.936 0.933 0.322 1.2e-106
TAIR|locus:2006932787 ADR1 "ACTIVATED DISEASE RESIST 0.710 0.734 0.319 2.2e-101
TAIR|locus:2175433811 ADR1-L2 "ADR1-like 2" [Arabido 0.945 0.949 0.300 5.6e-100
TAIR|locus:2171479623 ADR1-L3 "ADR1-like 3" [Arabido 0.749 0.979 0.326 4.5e-91
TAIR|locus:2175009415 AT5G66890 "AT5G66890" [Arabido 0.492 0.966 0.413 3.8e-78
TAIR|locus:2154890702 DAR5 "DA1-related protein 5" [ 0.399 0.462 0.392 2.2e-45
TAIR|locus:2147992 1189 AT5G11250 [Arabidopsis thalian 0.221 0.151 0.366 1.2e-26
TAIR|locus:2078012852 ZAR1 "HOPZ-ACTIVATED RESISTANC 0.665 0.636 0.237 3.3e-23
TAIR|locus:2175019 AT5G66900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1502 (533.8 bits), Expect = 5.1e-154, P = 5.1e-154
 Identities = 343/796 (43%), Positives = 479/796 (60%)

Query:    22 VSEAKDKAVMFKDLLEQLESTLQNSTPMIKEIEKLNQVLDLPKHETDTLIEMMRRGEHLV 81
             + EAK K   FK L + L ST++   P+ ++I+ + + LD    E   L + + R +  V
Sbjct:    25 IDEAK-KFKAFKPLSKDLVSTMEILFPLTQKIDSMQKELDFGVKELKELRDTIERADVAV 83

Query:    82 HKCSRVKWNCFKRYDYAKKIIKLDRSIDTFFRTYIPLQQTRDNRVIMVDLKEVHMMVKRL 141
              K  RVKW  +++  Y +KI ++++ +  F +  + L Q R N++ ++ L     +V  +
Sbjct:    84 RKFPRVKW--YEKSKYTRKIERINKDMLKFCQIDLQLLQHR-NQLTLLGL--TGNLVNSV 138

Query:   142 SG-NDRTSWMFNQVGV-AGACSAPDPPPVTPGLDVPLQELKLELFKDGRQVIVVSAPGGY 199
              G + R   +     V    CS P    V  GLD PL ELK  L  D    +VVSAP G 
Sbjct:   139 DGLSKRMDLLSVPAPVFRDLCSVPKLDKVIVGLDWPLGELKKRLLDDSVVTLVVSAPPGC 198

Query:   200 GKTTLVKKLCKDDQVLGKFKDNIFFVTVSQTPNVKGIVQKVYQHKGYAVPEFQTDEDAIN 259
             GKTTLV +LC D  + GKFK +IFF  VS TPN + IVQ + QH GY    F+ D  A  
Sbjct:   199 GKTTLVSRLCDDPDIKGKFK-HIFFNVVSNTPNFRVIVQNLLQHNGYNALTFENDSQAEV 257

Query:   260 DLERLLKPIRPEA-ILLVLDDVWSGSESLLQKFKFQLPYYKILVTSRSVFPQFGSGYDLK 318
              L +LL+ ++    ILLVLDDVW G++S LQKF+ +LP YKILVTSR  FP F S Y LK
Sbjct:   258 GLRKLLEELKENGPILLVLDDVWRGADSFLQKFQIKLPNYKILVTSRFDFPSFDSNYRLK 317

Query:   319 PLNDEAARTLFRYSANLQDGNSYIPDE--NLVNKILRACKGCPLALTVVGGSLCGKHPAI 376
             PL D+ AR L  + A+     S  PDE  +L+ KIL+ C G P+ + VVG SL G+    
Sbjct:   318 PLEDDDARALLIHWASRPCNTS--PDEYEDLLQKILKRCNGFPIVIEVVGVSLKGRSLNT 375

Query:   377 WQKRVKEWTQDVSVFHSN-KEILSCLERSLDALNNEVKECYMDLCSFPEDQRIPITALVD 435
             W+ +V+ W++   +       +L CL+ S DAL+  +KEC++D+ SF EDQ+I  + ++D
Sbjct:   376 WKGQVESWSEGEKILGKPYPTVLECLQPSFDALDPNLKECFLDMGSFLEDQKIRASVIID 435

Query:   436 MWMELYELVDELFAIANLHELSNLNLANCVATRKYASDDSCYNDHFVMQHDLLRELAIYQ 495
             MW+ELY     +  +  L +L++ NL   V       +D  YND  V QHD+LRELAI Q
Sbjct:   436 MWVELYGKGSSILYMY-LEDLASQNLLKLVPLGTNEHEDGFYNDFLVTQHDILRELAICQ 494

Query:   496 STLEPIKQRKRLIIDTSGNNFPEWWMDQKQHPLNASLLSISTDETFSSNWYDMEAPEVKV 555
             S  +   +RKRL ++   N FP+W ++     +NASLLSISTD+ FSS W +M+ P V+ 
Sbjct:   495 SEFKENLERKRLNLEILENTFPDWCLNT----INASLLSISTDDLFSSKWLEMDCPNVEA 550

Query:   556 VVLNVRTKKYTLPKFLEKMDKLKVMIVTNYGFFPAELSNIQVFGALSNLKRIRLEHVSLP 615
             +VLN+ +  Y LP F+  M KLKV+ +TN+GF+PA LSN     +L NLKRIRLE VS+ 
Sbjct:   551 LVLNLSSSDYALPSFISGMKKLKVLTITNHGFYPARLSNFSCLSSLPNLKRIRLEKVSIT 610

Query:   616 SLTT--VRMKHLQNVSLVMCNVDQVVQNST-FHFSDAFPNLLEIDIDYCNDLIELPDGLC 672
              L    +++  L+ +SLVMC+  +V  ++     S+A   L EIDIDYC DL ELP  + 
Sbjct:   611 LLDIPQLQLSSLKKLSLVMCSFGEVFYDTEDIVVSNALSKLQEIDIDYCYDLDELPYWIS 670

Query:   673 DIVSIKKLRITNCHKLSALPEGIGKLVNLQMLTLASCTDLSALPDTIGNLSNLNFLDISE 732
             +IVS+K L ITNC+KLS LPE IG L  L++L L S  +LS LP+    LSNL FLDIS 
Sbjct:   671 EIVSLKTLSITNCNKLSQLPEAIGNLSRLEVLRLCSSMNLSELPEATEGLSNLRFLDISH 730

Query:   733 CLNIQELPERIGELCSLKTLCLKGCSMFELPSSILNLENLEVVKCDEETAYQWEYFQLGQ 792
             CL +++LP+ IG+L +LK + ++ CS  ELP S+ NLENLEV KCDEET   WE  +   
Sbjct:   731 CLGLRKLPQEIGKLQNLKKISMRKCSGCELPESVTNLENLEV-KCDEETGLLWERLKPKM 789

Query:   793 AKFRI--EVIQEDINL 806
                R+  E I+ ++NL
Sbjct:   790 RNLRVQEEEIEHNLNL 805
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2174944 AT5G66910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119196 ADR1-L1 "ADR1-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2006932 ADR1 "ACTIVATED DISEASE RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175433 ADR1-L2 "ADR1-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171479 ADR1-L3 "ADR1-like 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175009 AT5G66890 "AT5G66890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154890 DAR5 "DA1-related protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FKZ1DRL42_ARATHNo assigned EC number0.42340.96430.9703yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00003901001
SubName- Full=Chromosome undetermined scaffold_560, whole genome shotgun sequence; (801 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query814
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 5e-31
pfam05659147 pfam05659, RPW8, Arabidopsis broad-spectrum mildew 8e-22
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-08
PLN03210 1153 PLN03210, PLN03210, Resistant to P 4e-08
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-06
PRK15386 426 PRK15386, PRK15386, type III secretion protein Gog 1e-05
pfam13401124 pfam13401, AAA_22, AAA domain 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
cd00071137 cd00071, GMPK, Guanosine monophosphate kinase (GMP 0.001
TIGR03263179 TIGR03263, guanyl_kin, guanylate kinase 0.003
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 0.003
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  123 bits (310), Expect = 5e-31
 Identities = 76/268 (28%), Positives = 126/268 (47%), Gaps = 12/268 (4%)

Query: 180 KLELFKDGRQVIVVSAPGGYGKTTLVKKLCKDDQVLGKFKDNIFFVTVSQTPNVKGIVQK 239
           KL    D   V+ +   GG GKTTL K++  DD V G F D++ +V VS+T     + + 
Sbjct: 11  KLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHF-DSVAWVVVSKTYTEFRLQKD 69

Query: 240 VYQHKGYAVPEFQTDEDAINDLERLLKP-IRPEAILLVLDDVWSGS--ESLLQKFKFQLP 296
           + Q  G  + +    E   ++L   +K  +  +  LLVLDDVW  +  + +   F     
Sbjct: 70  ILQELG--LDDSDWVEKNESELAVKIKEALLRKRFLLVLDDVWEKNDWDKIGVPFPDGEN 127

Query: 297 YYKILVTSRSV----FPQFGS-GYDLKPLNDEAARTLFRYSANLQDGNSYIPDENLVNKI 351
             +++VT+RS          S  ++++ L  E +  LF      ++       E +  +I
Sbjct: 128 GSRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEI 187

Query: 352 LRACKGCPLALTVVGGSL-CGKHPAIWQKRVKEWTQDVSVFHSNKEILSCLERSLDALNN 410
           +  CKG PLAL V+GG L        W+  +++   +++      E+LS L  S D L  
Sbjct: 188 VEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRDGLNEVLSILSLSYDNLPM 247

Query: 411 EVKECYMDLCSFPEDQRIPITALVDMWM 438
            +K C++ L  FPED  I    L+ +W+
Sbjct: 248 HLKRCFLYLALFPEDYNIRKEQLIKLWI 275

Length = 285
>gnl|CDD|203301 pfam05659, RPW8, Arabidopsis broad-spectrum mildew resistance protein RPW8 Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238026 cd00071, GMPK, Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>gnl|CDD|213788 TIGR03263, guanyl_kin, guanylate kinase Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 814
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.84
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.78
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.69
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.63
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.63
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.54
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.51
KOG0617264 consensus Ras suppressor protein (contains leucine 99.49
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.47
KOG0617264 consensus Ras suppressor protein (contains leucine 99.46
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.46
PRK04841 903 transcriptional regulator MalT; Provisional 99.44
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.28
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.28
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.26
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.26
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.21
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.18
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.17
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.15
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.14
PF05659147 RPW8: Arabidopsis broad-spectrum mildew resistance 99.13
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 99.12
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 99.07
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.06
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.06
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.05
COG3903414 Predicted ATPase [General function prediction only 99.04
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.01
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.99
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.94
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.91
PF05729166 NACHT: NACHT domain 98.9
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.86
PTZ001121164 origin recognition complex 1 protein; Provisional 98.86
PLN03150623 hypothetical protein; Provisional 98.81
COG3899 849 Predicted ATPase [General function prediction only 98.81
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.81
PTZ00202550 tuzin; Provisional 98.75
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.66
PLN03150623 hypothetical protein; Provisional 98.65
PRK13342413 recombination factor protein RarA; Reviewed 98.65
COG2256436 MGS1 ATPase related to the helicase subunit of the 98.64
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 98.6
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.6
PRK12402337 replication factor C small subunit 2; Reviewed 98.57
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.54
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.53
PRK06893229 DNA replication initiation factor; Validated 98.52
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.51
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.5
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.5
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.49
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 98.48
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.47
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.46
PLN03025319 replication factor C subunit; Provisional 98.46
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 98.45
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.44
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.44
PRK00440319 rfc replication factor C small subunit; Reviewed 98.44
PRK15386 426 type III secretion protein GogB; Provisional 98.43
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.43
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.42
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.42
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.42
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 98.4
PRK04195482 replication factor C large subunit; Provisional 98.39
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.38
PF14516331 AAA_35: AAA-like domain 98.37
PRK09112351 DNA polymerase III subunit delta'; Validated 98.33
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 98.33
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 98.32
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 98.31
PRK07471365 DNA polymerase III subunit delta'; Validated 98.31
PRK13341725 recombination factor protein RarA/unknown domain f 98.29
PRK07940394 DNA polymerase III subunit delta'; Validated 98.29
PRK05564313 DNA polymerase III subunit delta'; Validated 98.29
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 98.28
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 98.28
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 98.27
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 98.27
PRK08727233 hypothetical protein; Validated 98.25
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.24
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 98.23
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 98.22
PRK08084235 DNA replication initiation factor; Provisional 98.22
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 98.22
PRK15386 426 type III secretion protein GogB; Provisional 98.2
KOG2028554 consensus ATPase related to the helicase subunit o 98.2
cd01128249 rho_factor Transcription termination factor rho is 98.18
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 98.17
PF13173128 AAA_14: AAA domain 98.17
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.14
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.14
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 98.12
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 98.12
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.09
PRK05642234 DNA replication initiation factor; Validated 98.08
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 98.08
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.06
PRK09376416 rho transcription termination factor Rho; Provisio 98.05
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 98.03
PRK09087226 hypothetical protein; Validated 98.0
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 97.99
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 97.97
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 97.97
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 97.97
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 97.96
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.94
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.94
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 97.93
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 97.92
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.92
PRK07399314 DNA polymerase III subunit delta'; Validated 97.92
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.92
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 97.92
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 97.91
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 97.89
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 97.88
PRK14087450 dnaA chromosomal replication initiation protein; P 97.88
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.88
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.87
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 97.87
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 97.85
TIGR00362405 DnaA chromosomal replication initiator protein Dna 97.83
PHA02544316 44 clamp loader, small subunit; Provisional 97.82
KOG2543438 consensus Origin recognition complex, subunit 5 [R 97.82
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 97.81
PRK03992389 proteasome-activating nucleotidase; Provisional 97.78
PRK12422445 chromosomal replication initiation protein; Provis 97.77
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 97.77
TIGR00767415 rho transcription termination factor Rho. Members 97.77
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 97.74
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 97.73
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 97.72
PRK14088440 dnaA chromosomal replication initiation protein; P 97.72
PRK00149450 dnaA chromosomal replication initiation protein; R 97.7
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 97.68
PRK11331459 5-methylcytosine-specific restriction enzyme subun 97.68
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 97.68
PRK10865857 protein disaggregation chaperone; Provisional 97.65
KOG4341483 consensus F-box protein containing LRR [General fu 97.63
PRK14086617 dnaA chromosomal replication initiation protein; P 97.61
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.6
PRK06620214 hypothetical protein; Validated 97.59
PRK05707328 DNA polymerase III subunit delta'; Validated 97.59
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.58
COG0593408 DnaA ATPase involved in DNA replication initiation 97.56
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.56
CHL00095821 clpC Clp protease ATP binding subunit 97.56
PRK08769319 DNA polymerase III subunit delta'; Validated 97.55
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.52
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.52
CHL00181287 cbbX CbbX; Provisional 97.5
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 97.5
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.47
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 97.44
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 97.42
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 97.42
PRK08116268 hypothetical protein; Validated 97.4
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.39
PF00004132 AAA: ATPase family associated with various cellula 97.38
COG2255332 RuvB Holliday junction resolvasome, helicase subun 97.38
PRK08058329 DNA polymerase III subunit delta'; Validated 97.38
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 97.37
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 97.32
PRK06871325 DNA polymerase III subunit delta'; Validated 97.31
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 97.3
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.29
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 97.28
PRK06090319 DNA polymerase III subunit delta'; Validated 97.27
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.27
smart00382148 AAA ATPases associated with a variety of cellular 97.26
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.25
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 97.24
TIGR00763775 lon ATP-dependent protease La. This protein is ind 97.23
PRK07993334 DNA polymerase III subunit delta'; Validated 97.23
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.21
PRK10536262 hypothetical protein; Provisional 97.21
PRK12608380 transcription termination factor Rho; Provisional 97.19
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.17
KOG1514767 consensus Origin recognition complex, subunit 1, a 97.17
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 97.11
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.11
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 97.08
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 97.07
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 97.06
PRK08118167 topology modulation protein; Reviewed 97.03
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 97.02
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 97.01
CHL00176638 ftsH cell division protein; Validated 96.98
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.98
PRK10865857 protein disaggregation chaperone; Provisional 96.95
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 96.95
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.94
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.91
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.86
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 96.86
PRK08181269 transposase; Validated 96.85
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.84
PHA00729226 NTP-binding motif containing protein 96.84
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 96.83
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 96.82
KOG2228408 consensus Origin recognition complex, subunit 4 [R 96.79
PRK13531498 regulatory ATPase RavA; Provisional 96.79
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 96.76
PRK04132846 replication factor C small subunit; Provisional 96.75
PRK12377248 putative replication protein; Provisional 96.73
PRK07261171 topology modulation protein; Provisional 96.7
PTZ00494664 tuzin-like protein; Provisional 96.7
CHL00095821 clpC Clp protease ATP binding subunit 96.7
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 96.67
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.67
PRK06921266 hypothetical protein; Provisional 96.67
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.64
PRK06526254 transposase; Provisional 96.6
PRK09183259 transposase/IS protein; Provisional 96.58
CHL00195489 ycf46 Ycf46; Provisional 96.58
PRK06964342 DNA polymerase III subunit delta'; Validated 96.54
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.54
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.54
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 96.52
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.52
PRK04296190 thymidine kinase; Provisional 96.51
COG0470325 HolB ATPase involved in DNA replication [DNA repli 96.51
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 96.49
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.48
TIGR02237209 recomb_radB DNA repair and recombination protein R 96.47
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 96.47
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 96.46
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 96.44
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.43
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.39
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.38
PHA02244383 ATPase-like protein 96.37
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 96.37
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.36
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.33
TIGR02236310 recomb_radA DNA repair and recombination protein R 96.29
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.29
PRK09361225 radB DNA repair and recombination protein RadB; Pr 96.28
PRK08939306 primosomal protein DnaI; Reviewed 96.28
PRK08699325 DNA polymerase III subunit delta'; Validated 96.26
PRK06696223 uridine kinase; Validated 96.23
cd01393226 recA_like RecA is a bacterial enzyme which has rol 96.23
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 96.2
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 96.19
KOG1969877 consensus DNA replication checkpoint protein CHL12 96.17
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 96.16
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.15
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 96.12
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 96.1
PRK05541176 adenylylsulfate kinase; Provisional 96.07
PRK15455644 PrkA family serine protein kinase; Provisional 96.07
cd01394218 radB RadB. The archaeal protein radB shares simila 96.07
KOG0734752 consensus AAA+-type ATPase containing the peptidas 96.05
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 96.05
PRK00771437 signal recognition particle protein Srp54; Provisi 96.04
TIGR02012321 tigrfam_recA protein RecA. This model describes or 96.03
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 95.92
KOG4341483 consensus F-box protein containing LRR [General fu 95.9
PRK07952244 DNA replication protein DnaC; Validated 95.87
cd03115173 SRP The signal recognition particle (SRP) mediates 95.87
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.85
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 95.85
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 95.84
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 95.84
KOG0731774 consensus AAA+-type ATPase containing the peptidas 95.83
cd00983325 recA RecA is a bacterial enzyme which has roles in 95.83
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 95.82
PRK09354349 recA recombinase A; Provisional 95.81
PRK06547172 hypothetical protein; Provisional 95.77
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.75
PRK09270229 nucleoside triphosphate hydrolase domain-containin 95.75
PRK06835329 DNA replication protein DnaC; Validated 95.73
PRK10867433 signal recognition particle protein; Provisional 95.72
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.71
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 95.71
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.69
PRK07667193 uridine kinase; Provisional 95.63
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 95.62
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 95.59
TIGR00959428 ffh signal recognition particle protein. This mode 95.59
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 95.58
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 95.57
PLN03186342 DNA repair protein RAD51 homolog; Provisional 95.55
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 95.54
PRK04301317 radA DNA repair and recombination protein RadA; Va 95.53
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 95.52
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.5
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 95.46
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 95.45
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 95.44
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.43
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 95.4
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.39
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 95.37
PTZ00035337 Rad51 protein; Provisional 95.37
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.35
PRK14974336 cell division protein FtsY; Provisional 95.33
PRK08533230 flagellar accessory protein FlaH; Reviewed 95.32
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 95.3
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 95.3
PRK07132299 DNA polymerase III subunit delta'; Validated 95.29
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 95.24
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 95.23
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 95.23
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 95.22
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.2
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 95.18
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 95.15
PRK05022509 anaerobic nitric oxide reductase transcription reg 95.14
PTZ00301210 uridine kinase; Provisional 95.13
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 95.12
PRK08233182 hypothetical protein; Provisional 95.1
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 95.1
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 95.01
PRK05480209 uridine/cytidine kinase; Provisional 95.0
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 94.99
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 94.95
TIGR00235207 udk uridine kinase. Model contains a number of lon 94.94
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 94.94
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 94.93
TIGR02974329 phageshock_pspF psp operon transcriptional activat 94.92
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 94.91
TIGR00064272 ftsY signal recognition particle-docking protein F 94.9
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 94.9
PRK06762166 hypothetical protein; Provisional 94.89
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 94.87
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 94.87
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 94.87
KOG09241042 consensus mRNA splicing factor ATP-dependent RNA h 94.86
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.86
TIGR01817534 nifA Nif-specific regulatory protein. This model r 94.82
PRK11608326 pspF phage shock protein operon transcriptional ac 94.81
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 94.79
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 94.78
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 94.78
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 94.77
PRK03839180 putative kinase; Provisional 94.75
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 94.68
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 94.66
PRK14527191 adenylate kinase; Provisional 94.66
PTZ00088229 adenylate kinase 1; Provisional 94.64
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 94.64
cd03216163 ABC_Carb_Monos_I This family represents the domain 94.61
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 94.61
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 94.61
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 94.6
PRK00625173 shikimate kinase; Provisional 94.57
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.56
PRK04040188 adenylate kinase; Provisional 94.55
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 94.54
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 94.49
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 94.45
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 94.44
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.43
PRK15429686 formate hydrogenlyase transcriptional activator Fh 94.43
PRK06067234 flagellar accessory protein FlaH; Validated 94.4
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 94.39
PF07726131 AAA_3: ATPase family associated with various cellu 94.37
KOG0736953 consensus Peroxisome assembly factor 2 containing 94.37
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 94.36
COG4618580 ArpD ABC-type protease/lipase transport system, AT 94.36
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 94.32
PF00154322 RecA: recA bacterial DNA recombination protein; In 94.32
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.31
PRK06002450 fliI flagellum-specific ATP synthase; Validated 94.3
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 94.28
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 94.26
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.22
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 94.2
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 94.2
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 94.18
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 94.17
cd03246173 ABCC_Protease_Secretion This family represents the 94.16
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 94.14
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 94.12
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 94.11
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 94.1
PRK00131175 aroK shikimate kinase; Reviewed 94.09
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 94.09
PRK09280463 F0F1 ATP synthase subunit beta; Validated 94.07
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 94.07
PRK05439311 pantothenate kinase; Provisional 94.07
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 94.07
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 94.07
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 94.05
PRK14532188 adenylate kinase; Provisional 94.03
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 94.03
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 94.02
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 94.02
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 94.01
PF12061402 DUF3542: Protein of unknown function (DUF3542); In 93.99
PRK07276290 DNA polymerase III subunit delta'; Validated 93.96
PRK13947171 shikimate kinase; Provisional 93.94
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 93.91
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 93.9
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 93.88
COG0003322 ArsA Predicted ATPase involved in chromosome parti 93.87
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 93.86
PRK06217183 hypothetical protein; Validated 93.86
KOG2123 388 consensus Uncharacterized conserved protein [Funct 93.85
PRK00889175 adenylylsulfate kinase; Provisional 93.84
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 93.82
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 93.79
PF1324576 AAA_19: Part of AAA domain 93.79
PRK14528186 adenylate kinase; Provisional 93.78
COG0488530 Uup ATPase components of ABC transporters with dup 93.77
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 93.74
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 93.74
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.74
PRK12678672 transcription termination factor Rho; Provisional 93.72
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 93.62
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 93.62
COG1936180 Predicted nucleotide kinase (related to CMP and AM 93.62
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 93.62
TIGR01039461 atpD ATP synthase, F1 beta subunit. The sequences 93.59
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 93.59
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 93.57
PRK00279215 adk adenylate kinase; Reviewed 93.56
COG2884223 FtsE Predicted ATPase involved in cell division [C 93.55
PRK13949169 shikimate kinase; Provisional 93.55
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 93.53
COG0714329 MoxR-like ATPases [General function prediction onl 93.53
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 93.51
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 93.51
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 93.51
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 93.45
PRK09519 790 recA DNA recombination protein RecA; Reviewed 93.44
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 93.36
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 93.36
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 93.36
COG0055468 AtpD F0F1-type ATP synthase, beta subunit [Energy 93.35
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 93.35
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 93.32
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 93.3
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 93.3
PRK08927442 fliI flagellum-specific ATP synthase; Validated 93.29
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 93.28
PRK08972444 fliI flagellum-specific ATP synthase; Validated 93.28
PRK13948182 shikimate kinase; Provisional 93.25
PRK04328249 hypothetical protein; Provisional 93.24
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 93.24
PHA02774613 E1; Provisional 93.23
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 93.19
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 93.19
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 93.18
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 93.14
PF12780268 AAA_8: P-loop containing dynein motor region D4; I 93.11
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 93.11
PRK12339197 2-phosphoglycerate kinase; Provisional 93.1
PRK09099441 type III secretion system ATPase; Provisional 93.09
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 93.09
PRK09302509 circadian clock protein KaiC; Reviewed 93.08
PRK05917290 DNA polymerase III subunit delta'; Validated 93.08
PRK14530215 adenylate kinase; Provisional 93.07
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 93.06
PRK03846198 adenylylsulfate kinase; Provisional 93.05
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 93.05
PRK00409782 recombination and DNA strand exchange inhibitor pr 93.04
PRK14529223 adenylate kinase; Provisional 93.02
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 93.02
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 93.02
KOG1947482 consensus Leucine rich repeat proteins, some prote 93.01
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 93.01
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 93.01
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 93.01
PRK00300205 gmk guanylate kinase; Provisional 93.0
PRK10416318 signal recognition particle-docking protein FtsY; 92.97
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 92.97
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 92.95
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 92.95
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 92.91
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 92.89
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 92.88
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 92.88
PRK05922434 type III secretion system ATPase; Validated 92.87
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 92.87
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 92.86
PRK13946184 shikimate kinase; Provisional 92.84
PLN02348395 phosphoribulokinase 92.82
KOG1970634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 92.8
PRK13765637 ATP-dependent protease Lon; Provisional 92.8
PRK13407334 bchI magnesium chelatase subunit I; Provisional 92.78
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. 92.77
PRK13975196 thymidylate kinase; Provisional 92.76
PTZ00185574 ATPase alpha subunit; Provisional 92.76
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 92.74
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 92.7
PRK14737186 gmk guanylate kinase; Provisional 92.7
PRK05057172 aroK shikimate kinase I; Reviewed 92.67
COG0703172 AroK Shikimate kinase [Amino acid transport and me 92.66
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 92.66
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 92.61
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 92.58
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=3.2e-73  Score=656.32  Aligned_cols=628  Identities=20%  Similarity=0.254  Sum_probs=463.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHhhhhhhHHHHHHhhhccCCChhHHHHHHHHHHhhHHHhhhccCc
Q 003515            8 GALLGAVFGELLRAVSEAKDKAVMFKDLLEQLESTLQNSTPMIKEIEKLNQVLDLPKHETDTLIEMMRRGEHLVHKCSRV   87 (814)
Q Consensus         8 ~a~~~~v~~kl~~~l~~~~~~~~~~~~~~~~L~~~l~~i~~~l~~ae~~~~~~~~~~~wl~~l~~~~~d~ed~ld~~~~~   87 (814)
                      ++.++..++++.+.+.+++....+.++.+..|++.|..++++++||+.++........|...+++++|+++|.++.+.. 
T Consensus         2 ~~~~s~~~~~~~~~l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~~~~~~~~~~~~e~~~~~~~~~e~~~~~~~v-   80 (889)
T KOG4658|consen    2 GACVSFGVEKLDQLLNRESECLDGKDNYILELKENLKALQSALEDLDAKRDDLERRVNWEEDVGDLVYLAEDIIWLFLV-   80 (889)
T ss_pred             CeEEEEehhhHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHH-
Confidence            3445566788888898999999999999999999999999999999999888777889999999999999999999876 


Q ss_pred             cccccccchhHHHHHHHHhhhhhhhhccchhhhhhhhhHHHHHHHHHHHHHhhcccccccccccc--c-ccccccCCCCC
Q 003515           88 KWNCFKRYDYAKKIIKLDRSIDTFFRTYIPLQQTRDNRVIMVDLKEVHMMVKRLSGNDRTSWMFN--Q-VGVAGACSAPD  164 (814)
Q Consensus        88 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~l~~~~~~~~~~~~~~~~~~~~~--~-~~~~~~~~~~~  164 (814)
                        +..... ..+..........+..-....+....++..+..++-.+.+.++.+.....+.....  . ...+...+ ..
T Consensus        81 --~~~~~~-~~~~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~~~~~~e~~~-~~  156 (889)
T KOG4658|consen   81 --EEIERK-ANDLLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLDPREKVETRP-IQ  156 (889)
T ss_pred             --HHHHHH-HhHHhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceecccccccchhhcccCC-CC
Confidence              222111 11111111000111111134556667777778888888888888876553322221  1 11121111 12


Q ss_pred             CCCCCCCccchhHHHHHHHhhCCcEEEEEEcCCCCCHHHHHHHHhhchh-hhccCCCcEEEEEecCCCCHHHHHHHHHHH
Q 003515          165 PPPVTPGLDVPLQELKLELFKDGRQVIVVSAPGGYGKTTLVKKLCKDDQ-VLGKFKDNIFFVTVSQTPNVKGIVQKVYQH  243 (814)
Q Consensus       165 ~~~~~vGr~~~~~~l~~~L~~~~~~vi~I~G~gGiGKTtLa~~v~~~~~-~~~~F~~~~~wv~v~~~~~~~~~~~~i~~~  243 (814)
                      +... ||.+..++++.+.|..++..+++|+||||+||||||+.++|+.. ++.+|+. ++||.||+.++...++.+|++.
T Consensus       157 ~~~~-VG~e~~~~kl~~~L~~d~~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~-~iWV~VSk~f~~~~iq~~Il~~  234 (889)
T KOG4658|consen  157 SESD-VGLETMLEKLWNRLMEDDVGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDG-VIWVVVSKEFTTRKIQQTILER  234 (889)
T ss_pred             cccc-ccHHHHHHHHHHHhccCCCCEEEEECCCcccHHHHHHHHhcccchhcccCce-EEEEEEcccccHHhHHHHHHHH
Confidence            2223 99999999999999988889999999999999999999999988 9999998 8899999999999999999999


Q ss_pred             hCCCCCCCCChHHHHHHHHHHh-cccCCCcEEEEEeCCCCCchH--HHhhhcccCCCeEEEEEccccccC-----CCCcc
Q 003515          244 KGYAVPEFQTDEDAINDLERLL-KPIRPEAILLVLDDVWSGSES--LLQKFKFQLPYYKILVTSRSVFPQ-----FGSGY  315 (814)
Q Consensus       244 l~~~~~~~~~~~~~~~~l~~~l-~~l~~kr~LlVlDdv~~~~~~--~~~~~~~~~~gs~iivTtR~~~~~-----~~~~~  315 (814)
                      ++...+......  .+.++..+ +.+++|||||||||||+..+|  +..+++....||||++|||+..+.     ....+
T Consensus       235 l~~~~~~~~~~~--~~~~~~~i~~~L~~krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~  312 (889)
T KOG4658|consen  235 LGLLDEEWEDKE--EDELASKLLNLLEGKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPI  312 (889)
T ss_pred             hccCCcccchhh--HHHHHHHHHHHhccCceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccc
Confidence            887544332221  14444444 566899999999999998764  444555566789999999998433     23479


Q ss_pred             ccCCCCHHHHHHHHHHHcccCCCCCCCCChHHHHHHHHHcCCchhHHHHHHHHhCCCC-hHHHHHHHHHHhcc-cc-ccC
Q 003515          316 DLKPLNDEAARTLFRYSANLQDGNSYIPDENLVNKILRACKGCPLALTVVGGSLCGKH-PAIWQKRVKEWTQD-VS-VFH  392 (814)
Q Consensus       316 ~l~~L~~~~~~~Lf~~~a~~~~~~~~~~~~~~~~~i~~~~~g~Plai~~~~~~L~~~~-~~~w~~~l~~~~~~-~~-~~~  392 (814)
                      +++.|+++|||+||++.+|.......+..+++|++|+++|+|+|||+.++|+.|+.+. ..+|+++...+... .. ..+
T Consensus       313 ~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~  392 (889)
T KOG4658|consen  313 EVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSG  392 (889)
T ss_pred             cccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCc
Confidence            9999999999999999998886555455799999999999999999999999999985 77999888876543 11 122


Q ss_pred             ChHHHHHHHHHHHhhchHHHHHHHhHhCCCCCCcccCHHHHHHHHHHhhccchH-------HHHHHHHHhhhhhhhhhhh
Q 003515          393 SNKEILSCLERSLDALNNEVKECYMDLCSFPEDQRIPITALVDMWMELYELVDE-------LFAIANLHELSNLNLANCV  465 (814)
Q Consensus       393 ~~~~i~~~l~~sy~~L~~~~k~cf~~ls~fp~~~~i~~~~Li~~W~a~~~~~~~-------~~~~~~l~~L~~rsll~~~  465 (814)
                      ..+.++.++.+||+.||+++|.||+|||+||+||.|+++.|+.+|+|+|++++.       ++|++|+.+|++++|++..
T Consensus       393 ~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~  472 (889)
T KOG4658|consen  393 MEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEE  472 (889)
T ss_pred             hhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhc
Confidence            357899999999999998899999999999999999999999999999988652       6899999999999999964


Q ss_pred             hhcccCCCCCCccchhhhhhHHHHHHHHHhhccCCccccceeeeeCCCCCCchhhHhhcCCCcccceeeeccCCCccCCc
Q 003515          466 ATRKYASDDSCYNDHFVMQHDLLRELAIYQSTLEPIKQRKRLIIDTSGNNFPEWWMDQKQHPLNASLLSISTDETFSSNW  545 (814)
Q Consensus       466 ~~~~~~~~~~~~~~~~~~mHdlv~d~a~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~Lsi~~~~~~~~~~  545 (814)
                      ..        .++..+|.|||+|||+|.+++++.....++.+ +..+.... +  ..........|++++          
T Consensus       473 ~~--------~~~~~~~kmHDvvRe~al~ias~~~~~~e~~i-v~~~~~~~-~--~~~~~~~~~~rr~s~----------  530 (889)
T KOG4658|consen  473 RD--------EGRKETVKMHDVVREMALWIASDFGKQEENQI-VSDGVGLS-E--IPQVKSWNSVRRMSL----------  530 (889)
T ss_pred             cc--------ccceeEEEeeHHHHHHHHHHhccccccccceE-EECCcCcc-c--cccccchhheeEEEE----------
Confidence            32        13557899999999999999996555433311 22110000 0  000000112222222          


Q ss_pred             ccCCCCceEEEEEeccCCCCCCChhcCCCCCCcEEEeecccccCcccccccccCCCCCCCEEEecCCCCCCc-ccccccc
Q 003515          546 YDMEAPEVKVVVLNVRTKKYTLPKFLEKMDKLKVMIVTNYGFFPAELSNIQVFGALSNLKRIRLEHVSLPSL-TTVRMKH  624 (814)
Q Consensus       546 ~~~~~~~~~~l~l~~~~~~~~~p~~l~~l~~Lr~L~l~~~~~~~~~~~~l~~l~~l~~L~~L~l~~n~l~~~-~~~~l~~  624 (814)
                                                           .+                           |.+... .....+.
T Consensus       531 -------------------------------------~~---------------------------~~~~~~~~~~~~~~  546 (889)
T KOG4658|consen  531 -------------------------------------MN---------------------------NKIEHIAGSSENPK  546 (889)
T ss_pred             -------------------------------------ec---------------------------cchhhccCCCCCCc
Confidence                                                 21                           111111 1111234


Q ss_pred             ccccceecccccccccCcccccccCCCCccEEecccCcCcCcCCccccCCCCccEEEeecCCCCCCCchhccCCCCcCEe
Q 003515          625 LQNVSLVMCNVDQVVQNSTFHFSDAFPNLLEIDIDYCNDLIELPDGLCDIVSIKKLRITNCHKLSALPEGIGKLVNLQML  704 (814)
Q Consensus       625 L~~L~l~~~~~~~~~~~~~~~~~~~l~~L~~L~L~~~~~~~~lp~~i~~l~~L~~L~l~~~~~~~~lp~~~~~l~~L~~L  704 (814)
                      |++|-+.++..  ........++..+|.|++|||++|...+++|..|++|.+|+||+++++ .+..+|.++++|..|.+|
T Consensus       547 L~tLll~~n~~--~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t-~I~~LP~~l~~Lk~L~~L  623 (889)
T KOG4658|consen  547 LRTLLLQRNSD--WLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDT-GISHLPSGLGNLKKLIYL  623 (889)
T ss_pred             cceEEEeecch--hhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCC-CccccchHHHHHHhhhee
Confidence            44544444432  011122234457899999999999888999999999999999999984 477999999999999999


Q ss_pred             ecccCCCCCCCccccCCCCCCCEEeccCC
Q 003515          705 TLASCTDLSALPDTIGNLSNLNFLDISEC  733 (814)
Q Consensus       705 ~L~~~~~~~~lp~~l~~L~~L~~L~l~~~  733 (814)
                      ++..+..+..+|..+..|++|++|.+..-
T Consensus       624 nl~~~~~l~~~~~i~~~L~~Lr~L~l~~s  652 (889)
T KOG4658|consen  624 NLEVTGRLESIPGILLELQSLRVLRLPRS  652 (889)
T ss_pred             ccccccccccccchhhhcccccEEEeecc
Confidence            99987777777777777899999987653

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PTZ00494 tuzin-like protein; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query814
1z6t_A591 Structure Of The Apoptotic Protease-activating Fact 1e-07
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 2e-07
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-07
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 4e-06
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 7e-06
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 2e-05
>pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591 Back     alignment and structure 
Iteration: 1

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 130/293 (44%), Gaps = 31/293 (10%)
Query: 180 KLELFKDGRQVIVVSAPGGYGKTTLVKKLCKDDQVL-GKFKDNIFFVTVSQTPN------ 232
           KL   K     + +    G GK+ L  +  +D  +L G F   + +V+V +         
Sbjct: 139 KLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPGGVHWVSVGKQDKSGLLMK 198
Query: 233 VKGIVQKVYQHKGYAVPEFQTDEDAINDLERLLKPIRPEAILLVLDDVWSGSESLLQKFK 292
           ++ +  ++ Q + ++       E+A + L  L+    P + LL+LDDVW     +L+ F 
Sbjct: 199 LQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRS-LLILDDVWDSW--VLKAFD 255
Query: 293 FQLPYYKILVTSR--SVFPQ-FGSGYDL---KPLNDEAARTLFRYSANLQDGNSYIPDEN 346
            Q    +IL+T+R  SV     G  Y +     L  E    +     N++  +  +P++ 
Sbjct: 256 SQC---QILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVNMKKAD--LPEQ- 309
Query: 347 LVNKILRACKGCPLALTVVGGSLCGKHPAIWQKRVKEWTQDV------SVFHSNKEILSC 400
             + I++ CKG PL ++++G +L    P  W+  +K+           S  +  + +   
Sbjct: 310 -AHSIIKECKGSPLVVSLIG-ALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEA 367
Query: 401 LERSLDALNNEVKECYMDLCSFPEDQRIPITALVDMW-MELYELVDELFAIAN 452
           +  S++ L  ++K+ Y DL    +D ++P   L  +W ME  E+ D L    N
Sbjct: 368 MSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN 420
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query814
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 1e-56
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-55
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 5e-45
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-32
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-22
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-10
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 1e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-15
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-12
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-10
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-11
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-10
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 2e-05
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 9e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-08
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 4e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 5e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-08
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 5e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 1e-04
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-04
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 7e-04
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 8e-04
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
 Score =  202 bits (515), Expect = 1e-56
 Identities = 62/481 (12%), Positives = 137/481 (28%), Gaps = 48/481 (9%)

Query: 99  KKIIKLDRSIDTFFRTYIPLQQTRDNRVIMVDLKEVHMMVKRLSGNDRTSWMFNQVGVAG 158
           +   +    +      +    Q+     +   +         L           Q+    
Sbjct: 59  RIYRRQASELGPLIDFFNYNNQSHLADFLEDYIDFAINEPDLLRPVVIAPQFSRQMLDRK 118

Query: 159 AC--SAPDPPPVT--PGLDVPLQELKLELFKDGRQVIVVSAPGGYGKTTLVKKLC-KDDQ 213
               + P              + +   E+       + +    G GK+ +  +   K DQ
Sbjct: 119 LLLGNVPKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQ 178

Query: 214 VLGKFKDNIFFVTVSQTP---------NVKGIVQKVYQHKGYAVPEFQTDEDAINDLERL 264
           ++G   D+I ++  S T          ++  +++       +   E  T       +   
Sbjct: 179 LIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNA 238

Query: 265 LKPIRPEAILLVLDDVWSGSESLLQKFKFQLPYYKILVTSR--SVFPQFGSG---YDLKP 319
           L        L V DDV    E++    + +    + LVT+R   +           ++  
Sbjct: 239 LIDRPN--TLFVFDDVVQ-EETIRWAQELR---LRCLVTTRDVEISNAASQTCEFIEVTS 292

Query: 320 LNDEAARTLFRYSANLQDGNSYIPDENLVNKILRACKGCPLALTVVGGSLCGKHPAIW-- 377
           L  +                    +E+++NK +    G P  L +   S   K       
Sbjct: 293 LEIDECYDFLEAYGMPMPVGE--KEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQ 350

Query: 378 ---QKRVKEWTQDVSVFHSNKE-ILSCLERSLDALNNEVKECYMDLCSFPEDQRIPITAL 433
              +   +       +   + + +   L+R ++ L++E +         P    IP+   
Sbjct: 351 LNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIPVKLW 410

Query: 434 VDMWM------ELYELVDELFAIANLHELSNLNLANCVATRKYASDDSCYNDHFVMQHDL 487
             +        E  +L DE      L  LS       + + K     +      ++ H  
Sbjct: 411 SCVIPVDICSNEEEQLDDE--VADRLKRLSKRGA---LLSGKRMPVLTFKI-DHII-HMF 463

Query: 488 LRELAIYQSTLEPIKQRKRLIIDTSGNNFPEWWMDQKQHPLNASLLSISTDETFSSNWYD 547
           L+ +   Q+    I   ++ +++   NN          H         S  E +     +
Sbjct: 464 LKHVVDAQTIANGISILEQRLLEIGNNNVSVPERHIPSH--FQKFRRSSASEMYPKTTEE 521

Query: 548 M 548
            
Sbjct: 522 T 522
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Length = 198 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Length = 218 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 814
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 5e-23
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-06
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-06
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1lvga_190 c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculu 0.001
d1kgda_178 c.37.1.1 (A:) Guanylate kinase-like domain of Cask 0.002
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1gkya_186 c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Sac 0.003
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 97.6 bits (242), Expect = 5e-23
 Identities = 37/257 (14%), Positives = 72/257 (28%), Gaps = 24/257 (9%)

Query: 176 LQELKLELFKDGRQVIVVSAPGGYGKTTLVKKLC-KDDQVLGKFKDNIFFVTVSQTPNVK 234
           + +   E+       + +    G GK+ +  +   K DQ++G   D+I ++  S T    
Sbjct: 32  VIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKS 91

Query: 235 GI-------VQKVYQHKGYAVPEFQTDEDAINDLERLLKPIRPEAILLVLDDVWSGSESL 287
                    +    +      P  +     +         I     L V DDV       
Sbjct: 92  TFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQ----E 147

Query: 288 LQKFKFQLPYYKILVTSR--SVFPQFGSG---YDLKPLNDEAARTLFRYSANLQDGNSYI 342
                 Q    + LVT+R   +           ++  L  +                   
Sbjct: 148 ETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYG--MPMPVGE 205

Query: 343 PDENLVNKILRACKGCPLALTVVGGSLCGKHPAIWQKRVKEWTQDVSVFHSNKEILSCLE 402
            +E+++NK +    G P  L +   S   K      +   +             +     
Sbjct: 206 KEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESR-----GLVGVECITP 260

Query: 403 RSLDALNNEVKECYMDL 419
            S  +L   ++ C   L
Sbjct: 261 YSYKSLAMALQRCVEVL 277
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 190 Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 186 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query814
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.81
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.8
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.8
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.79
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.76
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.74
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.52
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.46
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.46
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.42
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.41
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.37
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.32
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.3
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.3
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.27
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.25
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.25
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.15
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.15
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.14
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.14
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.12
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.09
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.05
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.04
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.97
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.92
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.9
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.87
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.87
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.85
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.81
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.79
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.78
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.78
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.76
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.72
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.71
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.68
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.61
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.53
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.5
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.47
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.46
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.31
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 98.14
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 97.84
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.28
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.21
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.16
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.14
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.09
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.07
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.05
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 97.01
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.93
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.92
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 96.91
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 96.9
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.88
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.86
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.84
d2qy9a2211 GTPase domain of the signal recognition particle r 96.82
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 96.82
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 96.78
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.76
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.66
d1okkd2207 GTPase domain of the signal recognition particle r 96.64
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.59
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.58
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.54
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.51
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.47
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.43
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.41
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 96.38
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 96.37
d1vmaa2213 GTPase domain of the signal recognition particle r 96.3
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.28
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.28
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.28
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 96.27
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.26
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.25
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.22
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.21
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.16
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.14
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 96.13
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.13
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.03
d1xpua3289 Transcription termination factor Rho, ATPase domai 96.02
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.0
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 96.0
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.93
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.92
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.92
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.92
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.9
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.87
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.83
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.8
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.77
d1svma_362 Papillomavirus large T antigen helicase domain {Si 95.7
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.68
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.64
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.59
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.57
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.49
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.47
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.46
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 95.42
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.32
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.3
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.29
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.21
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.09
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.04
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.02
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.97
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.96
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.96
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.9
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 94.84
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 94.83
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 94.77
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 94.76
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.75
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.74
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.68
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.64
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 94.63
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.62
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.61
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.61
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.5
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.27
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.1
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 94.05
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 93.81
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 93.63
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 93.51
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 93.47
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 93.35
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 93.35
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 93.28
d1g2912240 Maltose transport protein MalK, N-terminal domain 93.28
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 93.18
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 93.16
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 93.08
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 93.07
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 93.01
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 92.95
d2awna2232 Maltose transport protein MalK, N-terminal domain 92.95
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 92.91
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 92.84
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 92.83
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 92.82
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 92.77
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 92.71
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.63
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 92.62
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 92.58
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 92.52
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 92.47
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 92.39
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 92.36
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 92.33
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 92.29
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.15
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 92.13
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 92.05
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 91.98
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 91.95
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 91.95
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.89
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 91.83
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 91.81
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.8
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 91.77
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.72
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 91.71
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 91.7
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 91.69
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.66
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 91.65
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 91.64
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 91.62
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 91.61
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 91.61
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 91.58
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 91.58
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 91.54
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 91.54
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 91.53
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 91.51
d2fh5b1207 Signal recognition particle receptor beta-subunit 91.49
d1nrjb_209 Signal recognition particle receptor beta-subunit 91.47
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 91.41
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 91.38
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 91.33
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 91.33
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 91.27
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.26
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 91.25
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 91.22
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 91.21
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 91.19
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 91.09
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 91.08
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 91.05
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 91.05
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 90.91
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 90.8
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 90.78
d2hyda1255 Putative multidrug export ATP-binding/permease pro 90.76
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 90.75
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.73
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 90.71
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 90.7
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 90.69
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 90.63
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 90.62
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 90.58
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 90.47
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 90.39
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 90.14
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 90.13
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 90.07
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 90.07
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 89.93
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.83
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 89.74
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 89.69
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 89.67
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 89.64
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 89.63
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 89.62
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 89.61
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 89.5
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 89.22
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 89.02
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 88.82
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 88.56
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 88.4
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 88.36
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 87.97
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 87.9
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 87.77
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 87.76
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 87.58
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 87.42
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 87.23
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 87.12
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 87.01
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 86.37
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 86.04
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 85.86
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 85.81
d1tuea_205 Replication protein E1 helicase domain {Human papi 84.24
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 84.21
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 83.35
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 83.34
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 82.83
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 81.93
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 81.39
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 81.3
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 80.3
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=100.00  E-value=5.5e-44  Score=280.58  Aligned_cols=246  Identities=14%  Similarity=0.082  Sum_probs=181.2

Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHH---HCCCEEEEEECCCCCCHHHHHHHHHHCHH--HHCCCCCCEEEEEECCCCCHHH
Q ss_conf             899999877876620599999986---09927999985898877799999721132--2135798279999669999999
Q 003515          161 SAPDPPPVTPGLDVPLQELKLELF---KDGRQVIVVSAPGGYGKTTLVKKLCKDDQ--VLGKFKDNIFFVTVSQTPNVKG  235 (814)
Q Consensus       161 ~~~~~~~~~vGr~~~~~~l~~~l~---~~~~~vi~I~G~gGiGKTtLa~~v~~~~~--~~~~F~~~~~wv~v~~~~~~~~  235 (814)
                      ..|..+ .++||+.++++|+++|.   +.+.++|+|+||||+||||||+++|++..  ...+|++ ++|+++++.++...
T Consensus        15 ~~p~~~-~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~-~~Wv~vs~~~~~~~   92 (277)
T d2a5yb3          15 NVPKQM-TCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDS-IVWLKDSGTAPKST   92 (277)
T ss_dssp             TCBCCC-CSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSE-EEEEECCCCSTTHH
T ss_pred             CCCCCC-CEECCHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCE-EEEEEECCCCCHHH
T ss_conf             899988-6237399999999998734687840899977997888999999998556554012764-89999368777778


Q ss_pred             HHHHHHHH---HCCCCC-CCCC-HH-HHHHHHHHHH-CCCCCCCEEEEEECCCCCCHHHHHHHCCCCCCEEEEEECCCCC
Q ss_conf             99999998---099999-8999-38-9999999973-4649982899981889994677843102599809999725535
Q 003515          236 IVQKVYQH---KGYAVP-EFQT-DE-DAINDLERLL-KPIRPEAILLVLDDVWSGSESLLQKFKFQLPYYKILVTSRSVF  308 (814)
Q Consensus       236 ~~~~i~~~---l~~~~~-~~~~-~~-~~~~~l~~~l-~~l~~k~~LlVlDdv~~~~~~~~~~~~~~~~gs~iiiTtR~~~  308 (814)
                      +...+...   ++.... ..+. .. .........+ ..+.++++|+||||+|+...  +..+  ...||+||+|||+..
T Consensus        93 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~--~~~~--~~~~srilvTTR~~~  168 (277)
T d2a5yb3          93 FDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEET--IRWA--QELRLRCLVTTRDVE  168 (277)
T ss_dssp             HHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHH--HHHH--HHTTCEEEEEESBGG
T ss_pred             HHHHHHHHHHHHCCHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHH--HHHH--CCCCCEEEEEEEHHH
T ss_conf             999999999872202202786321233699999999998446881675250667766--5552--045755999964489


Q ss_pred             CC--CC---CCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             57--99---83134799989999999987025899999978589999999859955589999887089995899999998
Q 003515          309 PQ--FG---SGYDLKPLNDEAARTLFRYSANLQDGNSYIPDENLVNKILRACKGCPLALTVVGGSLCGKHPAIWQKRVKE  383 (814)
Q Consensus       309 ~~--~~---~~~~l~~L~~~~~~~Lf~~~~~~~~~~~~~~~~~~~~~i~~~~~G~Plai~~i~~~L~~~~~~~w~~~l~~  383 (814)
                      ..  ..   ..|++++|+.++||+||..+++....  ....++++++|+++|+|+|||++++|+.|+.++.+.|......
T Consensus       169 v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~--~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~  246 (277)
T d2a5yb3         169 ISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPV--GEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNK  246 (277)
T ss_dssp             GGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHH
T ss_pred             HHHHCCCCCCEEECCCCCHHHHHHHHHHHHCCCCC--CHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             99863788716877889979999999998477667--4256799999999958998999999998655989999999999


Q ss_pred             HHCCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHH
Q ss_conf             820455667747899999999963109899999683
Q 003515          384 WTQDVSVFHSNKEILSCLERSLDALNNEVKECYMDL  419 (814)
Q Consensus       384 ~~~~~~~~~~~~~i~~~l~~s~~~L~~~~k~~f~~~  419 (814)
                      +...     ...++..++.+||+.||+++|+||.++
T Consensus       247 L~~~-----~~~~v~~il~~sY~~L~~~lk~c~~~l  277 (277)
T d2a5yb3         247 LESR-----GLVGVECITPYSYKSLAMALQRCVEVL  277 (277)
T ss_dssp             HHHH-----CSSTTCCCSSSSSSSHHHHHHHHHHTS
T ss_pred             HHCC-----CHHHHHHHHHHHHHCCCHHHHHHHHHC
T ss_conf             7348-----678899999998851269999999739
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure