Citrus Sinensis ID: 003528

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810---
MAKGEECCSTQLIDGDGTFNVSGIEHFIKEVKLSDCGLSYAVVSIMGPQSSGKSTLLNHLFGTNFREMDAFKGRSQTTKGIWMARCAGIEPCTLIMDLEGTDGRERGEDDTAFEKQSALFALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRKTTLMFVIRDKTRTPLENLEPVLREDIQKIWDSVPKPQAHMETPLSEFFNVEVVALSSFEEKEELFKEQVASLRQRFYHSVAPGGLAGDRRGVVPASGFSFSAHEIWKVIKENKDLDLPAHKVMVATVRCEEIANEKYSSFAANEEWCELEAAVQSGPISSFGKKLSSILETCLSGYDGEVLYFDEGVRSAKRKQLEDKLLQLVQPAFQSMLGHIRSGTLDKFKDAFDKALSGGEGFSSAAHHCSKFYMNLFDEACADAVIEQANWDMSKARDKFQRDIDAHIASVRAAKLGELTAIFEAKLNESLSGPVEALLDGANNETWPAIRKLLRCETESAISGFSDALYGFDMDEETKEKMLASLENYAKGVVEAKAREESGRVLMRMKDRFTSLFSHDSDSMPRVWTGKEDIRGITKLARSASLKLLSVMAAIRLDDETDNIESTLTLALVDSPSNAATNRSITNHDPLASSTWEQVPSSKTLITPVQCKSLWRQFKSETEYSVTQAISAQEANKRNNNWLPPPWAIAAMMVLGFNEFMTLLRNPLYLGFIFIGYLLIKALWVQLDISGEFRNGALPGLISLSTKFLPTVMNLLKKLAEEGQIPATNNNPQRNPVRASMNHQNGVSTSEISSTASSGVTSSGNGTEYSSPRKEE
ccccccccccEEEEccccccHHHHHHHHHHHccccccccEEEEEEEccccccHHHHHHHHHccccccccccccccccccEEEEEEccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHccEEEEcccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccEEEEEccccccccHHHHHHHHHcccccccccEEEEEEEccccccHHHHHHHHHcccccEccHcccccccccEEEEEEcccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHccHHHHHHHHHHHHHHHccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccHHHccccHHHHEEEEEEEcccHHccHHHHHHHHHHHHHHHHcccccccccHHHccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHcccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccc
makgeeccstqlidgdgtfnvSGIEHFIkevklsdcglSYAVVSimgpqssgkstllnhlfgtnfremdafkgrsqttKGIWMArcagiepctlimdlegtdgrergeddtAFEKQSALFALAVSDIVLINMWChdigreqaankpLLKTVFQVMMRlfsprkttLMFVIrdktrtplenlepvLREDIQKIWdsvpkpqahmetplseFFNVEVVALSSFEEKEELFKEQVASLRQRFyhsvapgglagdrrgvvpasgfsfsAHEIWKVIKenkdldlpaHKVMVATVRCEEIANekyssfaaNEEWCELEAavqsgpissfGKKLSSILETClsgydgevlyfdeGVRSAKRKQLEDKLLQLVQPAFQSMlghirsgtlDKFKDAFDKalsggegfssaaHHCSKFYMNLFDEACADAVIEQANWDMSKARDKFQRDIDAHIASVRAAKLGELTAIFEAKLneslsgpvealldgannetWPAIRKLLRCETEsaisgfsdalygfdmdEETKEKMLASLENYAKGVVEAKAREESGRVLMRMKDRFTslfshdsdsmprvwtgkediRGITKLARSASLKLLSVMAAIRLDDETDNIESTLTLAlvdspsnaatnrsitnhdplasstweqvpssktlitpvqCKSLWRQFKSETEYSVTQAISAQEAnkrnnnwlpppWAIAAMMVLGFNEFMTllrnplylGFIFIGYLLIKALWVQLDisgefrngalpglislSTKFLPTVMNLLKKLAeegqipatnnnpqrnpvrasmnhqngvstseisstassgvtssgngteyssprkee
makgeeccstqlidgdgTFNVSGIEHFIKEVKLSDCGLSYAVVSIMGPQSSGKSTLLNHLFGTNFREMDAFKGRSQTTKGIWMARCAGIEPCTLIMDLEGTDGRERGEDDTAFEKQSALFALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMMRlfsprkttlmfvirdktrtplenlepvlrEDIQKIWDSVPKPQAHMETPLSEFFNVEVVALSSFEEKEELFKEQVASLRQRFYHSVAPGGLAGDRRGVVPASGFSFSAHEIWKVIKENKDLDLPAHKVMVATVRCEEIANEKYSSFAANEEWCELEAAVQSGPISSFGKKLSSILETCLSGYDGEVLYFDEGVRSAKRKQLEDKLLQLVQPAFQSMLGHIRSGTLDKFKDAFDKALSGGEGFSSAAHHCSKFYMNLFDEACADAVIEQANWDMSKARDKFQRDIDAHIASVRAAKLGELTAIFEAKLNESLSGPVEALLDGANNETWPAIRKLLRCETESAISGFSDALYGFDMDEETKEKMLASLENYAKgvveakareesgrvLMRMKDRFTslfshdsdsmprvwtgkedirGITKLARSASLKLLSVMAAIRLDDETDNIESTLTLALVDSPSNAATNRSITNHDPLASSTWEQVPSSKTLITPVQCKSLWRQFKSETEYSVTQAISAQEankrnnnwlPPPWAIAAMMVLGFNEFMTLLRNPLYLGFIFIGYLLIKALWVQLDISGEFRNGALPGLISLSTKFLPTVMNLLKKLAEegqipatnnnpqrnpvRASMNHQNGVSTSEisstassgvtssgngteyssprkee
MAKGEECCSTQLIDGDGTFNVSGIEHFIKEVKLSDCGLSYAVVSIMGPQSSGKSTLLNHLFGTNFREMDAFKGRSQTTKGIWMARCAGIEPCTLIMDLEGTDGRERGEDDTAFEKQSALFALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRKTTLMFVIRDKTRTPLENLEPVLREDIQKIWDSVPKPQAHMETPLSEFFNVEVVAlssfeekeelfkeQVASLRQRFYHSVAPGGLAGDRRGVVPASGFSFSAHEIWKVIKENKDLDLPAHKVMVATVRCEEIANEKYSSFAANEEWCELEAAVQSGPISSFGKKLSSILETCLSGYDGEVLYFDEGVRSAKRKQLEDKLLQLVQPAFQSMLGHIRSGTLDKFKDAFDKALSGGEGFSSAAHHCSKFYMNLFDEACADAVIEQANWDMSKARDKFQRDIDAHIASVRAAKLGELTAIFEAKLNESLSGPVEALLDGANNETWPAIRKLLRCETESAISGFSDALYGFDMDEETKEKMLASLENYAKGVVEAKAREESGRVLMRMKDRFTSLFSHDSDSMPRVWTGKEDIRGITklarsaslkllsVMAAIRLDDETDNIESTLTLALVDSPSNAATNRSITNHDPLASSTWEQVPSSKTLITPVQCKSLWRQFKSETEYSVTQAISAQEANKRNNNWLPPPWAIAAMMVLGFNEFMTLLRNPLYLGFIFIGYLLIKALWVQLDISGEFRNGALPGLISLSTKFLPTVMNLLKKLAEEGQIPATNNNPQRNPVRASMNHQNgvstseisstassgvtssgngtEYSSPRKEE
******CCSTQLIDGDGTFNVSGIEHFIKEVKLSDCGLSYAVVSIMGPQSSGKSTLLNHLFGTNFREMDAFKGRSQTTKGIWMARCAGIEPCTLIMDLEG*************EKQSALFALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRKTTLMFVIRDKTRTPLENLEPVLREDIQKIWDSVP******ETPLSEFFNVEVVALSSFEEKEELFKEQVASLRQRFYHSVAPGGLAGDRRGVVPASGFSFSAHEIWKVIKENKDLDLPAHKVMVATVRCEEIANEKYSSFAANEEWCELEAAVQSGPISSFGKKLSSILETCLSGYDGEVLYFDEGVRSAKRKQLEDKLLQLVQPAFQSMLGHIRSGTLDKFKDAFDKALSGGEGFSSAAHHCSKFYMNLFDEACADAVIEQANWDMSKARDKFQRDIDAHIASVRAAKLGELTAIFEAKLNESLSGPVEALLDGANNETWPAIRKLLRCETESAISGFSDALYGFDM**************Y************************************RVWTGKEDIRGITKLARSASLKLLSVMAAIRLDDETDNIESTLTLALV******************************TLITPVQCKSLWRQFKSETEYSVTQAIS******RNNNWLPPPWAIAAMMVLGFNEFMTLLRNPLYLGFIFIGYLLIKALWVQLDISGEFRNGALPGLISLSTKFLPTVMNLLKKL*********************************************************
******C***QLIDGDGTFNVSGIEHFIKEVKLSDCGLSYAVVSIMGPQSSGKSTLLNHLFGTNFRE*********TTKGIWMARCAGIEPCTLIMDLEG***************QSALFALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRKTTLMFVIRDKTRTPLENLEPVLREDIQ**************TPLSEFFNVEVVALSSFEEKEELFKEQVASLRQRFYHSVAPGGLAGDRRGVVPASGFSFSAHEIWKVIKENKDLDLPAHKVMVATVRCEEIANEKYSSFAANEEWCELEAAVQSGPISSFGKKLSSILETCLSGYDGEVLYFDEGVRSAKRKQLEDKLLQLVQPAFQSMLGHIRSGTLDKFKDAFDK************HHCSKFYMNLFDEACADAVIEQANWDMSKARDKFQRDIDAHIASVRAAKLGELTAIFEAKLNESLSGP***LLDGANNETWPAIRKLLRCETESAISGFSDALYGFDMDEETKEKMLASLENYAKGVVEAKAREESGRVLMRMKDRFTSLFSHDSDSMPRVWTGKEDIRGITKLARSASLKLLSVMAAIRLDDETDNIESTLTLA***********************TWEQVPSSKTLITPVQCKSLWRQFKSETEYSVTQAI***********WLPPPWAIAAMMVLGFNEFMTLLRNPLYLGFIFIGYLLIKALWVQLDISGEFRNGALPGLISLSTKFLPTVMNLL************************************************************
********STQLIDGDGTFNVSGIEHFIKEVKLSDCGLSYAVVSIMGPQSSGKSTLLNHLFGTNFREMDAFKGRSQTTKGIWMARCAGIEPCTLIMDLEGTDGRERGEDDTAFEKQSALFALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRKTTLMFVIRDKTRTPLENLEPVLREDIQKIWDSVPKPQAHMETPLSEFFNVEVVALSSFEEKEELFKEQVASLRQRFYHSVAPGGLAGDRRGVVPASGFSFSAHEIWKVIKENKDLDLPAHKVMVATVRCEEIANEKYSSFAANEEWCELEAAVQSGPISSFGKKLSSILETCLSGYDGEVLYFDEGVRSAKRKQLEDKLLQLVQPAFQSMLGHIRSGTLDKFKDAFDKALSGGEGFSSAAHHCSKFYMNLFDEACADAVIEQANWDMSKARDKFQRDIDAHIASVRAAKLGELTAIFEAKLNESLSGPVEALLDGANNETWPAIRKLLRCETESAISGFSDALYGFDMDEETKEKMLASLENYAKGVVEAKAREESGRVLMRMKDRFTSLFSHDSDSMPRVWTGKEDIRGITKLARSASLKLLSVMAAIRLDDETDNIESTLTLALVDSPSNAATNRSITNHDP***********SKTLITPVQCKSLWRQFKSETEYSVTQAISAQEANKRNNNWLPPPWAIAAMMVLGFNEFMTLLRNPLYLGFIFIGYLLIKALWVQLDISGEFRNGALPGLISLSTKFLPTVMNLLKKLAEEGQIPATNNNPQRNPVRASMN**********************************
*****ECCSTQLIDGDGTFNVSGIEHFIKEVKLSDCGLSYAVVSIMGPQSSGKSTLLNHLFGTNFREMDAFKGRSQTTKGIWMARCAGIEPCTLIMDLEGTDGRERGEDDTAFEKQSALFALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRKTTLMFVIRDKTRTPLENLEPVLREDIQKIWDSVPKPQAHMETPLSEFFNVEVVALSSFEEKEELFKEQVASLRQRFYHSVAPGGLAGDRRGVVPASGFSFSAHEIWKVIKENKDLDLPAHKVMVATVRCEEIANEKYSSFAANEEWCELEAAVQSGPISSFGKKLSSILETCLSGYDGEVLYFDEGVRSAKRKQLEDKLLQLVQPAFQSMLGHIRSGTLDKFKDAFDKALSGGEGFSSAAHHCSKFYMNLFDEACADAVIEQANWDMSKARDKFQRDIDAHIASVRAAKLGELTAIFEAKLNESLSGPVEALLDGANNETWPAIRKLLRCETESAISGFSDALYGFDMDEETKEKMLASLENYAKGVVEAKAREESGRVLMRMKDRFTSLFSHDSDSMPRVWTGKEDIRGITKLARSASLKLLSVMAAIRLDDETDNIESTLTLALV********************STWEQVPSSKTLITPVQCKSLWRQFKSETEYSVTQAISAQEANKRNNNWLPPPWAIAAMMVLGFNEFMTLLRNPLYLGFIFIGYLLIKALWVQLDISGEFRNGALPGLISLSTKFLPTVMNLLKKLAEEG*****************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKGEECCSTQLIDGDGTFNVSGIEHFIKEVKLSDCGLSYAVVSIMGPQSSGKSTLLNHLFGTNFREMDAFKGRSQTTKGIWMARCAGIEPCTLIMDLEGTDGRERGEDDTAFEKQSALFALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRKTTLMFVIRDKTRTPLENLEPVLREDIQKIWDSVPKPQAHMETPLSEFFNVEVVAxxxxxxxxxxxxxxxxxxxxxFYHSVAPGGLAGDRRGVVPASGFSFSAHEIWKVIKENKDLDLPAHKVMVATVRCEEIANEKYSSFAANEEWCELEAAVQSGPISSFGKKLSSILETCLSGYDGEVLYFDEGVRSAKRKQLEDKLLQLVQPAFQSMLGHIRSGTLDKFKDAFDKALSGGEGFSSAAHHCSKFYMNLFDEACADAVIEQANWDMSKARDKFQRDIDAHIASVRAAKLGELTAIFEAKLNESLSGPVEALLDGANNETWPAIRKLLRCETESAISGFSDALYGFDMDEETKEKMLASLENYAKGVVEAKAREESGRVLMRMKDRFTSLFSHDSDSMPRVWTGKEDIRGITKLARSASLKLLSVMAAIRLDDETDNIESTLTLALVDSPSNAATNRSITNHDPLASSTWEQVPSSKTLITPVQCKSLWRQFKSETEYSVTQAISAQEANKRNNNWLPPPWAIAAMMVLGFNEFMTLLRNPLYLGFIFIGYLLIKALWVQLDISGEFRNGALPGLISLSTKFLPTVMNLLKKLAEEGQIPATNNNPQRNPVRASMNHQNGVSTSEISSTASSGVTSSGNGTEYSSPRKEE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query813 2.2.26 [Sep-21-2011]
P93042802 Protein ROOT HAIR DEFECTI yes no 0.955 0.968 0.788 0.0
Q9SSN0795 Protein ROOT HAIR DEFECTI no no 0.940 0.962 0.775 0.0
Q0JLS6806 Protein ROOT HAIR DEFECTI yes no 0.984 0.992 0.721 0.0
Q9FKE9834 Protein ROOT HAIR DEFECTI no no 0.991 0.966 0.654 0.0
Q2QMH2854 Protein ROOT HAIR DEFECTI no no 0.923 0.879 0.644 0.0
Q2R224823 Protein ROOT HAIR DEFECTI no no 0.917 0.906 0.593 0.0
A8N5E5784 Protein SEY1 OS=Coprinops N/A no 0.907 0.941 0.305 8e-92
Q54W90894 Protein SEY1 homolog OS=D yes no 0.785 0.714 0.313 4e-89
B0D0N9785 Protein SEY1 OS=Laccaria N/A no 0.826 0.856 0.313 2e-86
Q4PEQ0845 Protein SEY1 OS=Ustilago N/A no 0.894 0.860 0.291 2e-84
>sp|P93042|RHD3_ARATH Protein ROOT HAIR DEFECTIVE 3 OS=Arabidopsis thaliana GN=RHD3 PE=1 SV=1 Back     alignment and function desciption
 Score = 1257 bits (3253), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/777 (78%), Positives = 692/777 (89%)

Query: 7   CCSTQLIDGDGTFNVSGIEHFIKEVKLSDCGLSYAVVSIMGPQSSGKSTLLNHLFGTNFR 66
            CSTQLIDGDG FNVSG++HFIKEVKL +CGLSYAVVSIMGPQSSGKSTLLNHLFGTNFR
Sbjct: 4   ACSTQLIDGDGVFNVSGVDHFIKEVKLDECGLSYAVVSIMGPQSSGKSTLLNHLFGTNFR 63

Query: 67  EMDAFKGRSQTTKGIWMARCAGIEPCTLIMDLEGTDGRERGEDDTAFEKQSALFALAVSD 126
           EMDAF+GRSQTTKGIW+ARCAGIEPCT++MDLEGTDGRERGEDDTAFEKQSALFALAVSD
Sbjct: 64  EMDAFRGRSQTTKGIWIARCAGIEPCTVVMDLEGTDGRERGEDDTAFEKQSALFALAVSD 123

Query: 127 IVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRKTTLMFVIRDKTRTPLENLEPVLR 186
           IVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRKTTLMFVIRDKTRTPLENLEPVLR
Sbjct: 124 IVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRKTTLMFVIRDKTRTPLENLEPVLR 183

Query: 187 EDIQKIWDSVPKPQAHMETPLSEFFNVEVVALSSFEEKEELFKEQVASLRQRFYHSVAPG 246
           EDIQKIWDSVPKPQAH ETPLS+FFNVEVVALSS+EEKEE FKEQV +LRQRF+ SVAPG
Sbjct: 184 EDIQKIWDSVPKPQAHKETPLSDFFNVEVVALSSYEEKEEQFKEQVYNLRQRFFQSVAPG 243

Query: 247 GLAGDRRGVVPASGFSFSAHEIWKVIKENKDLDLPAHKVMVATVRCEEIANEKYSSFAAN 306
           GLAGDRRGVVPA+ F+FSA ++W+VIK+NKDLDLPAHKVMVATVRCEEIANEK+SSF AN
Sbjct: 244 GLAGDRRGVVPANAFAFSAKQMWQVIKDNKDLDLPAHKVMVATVRCEEIANEKFSSFIAN 303

Query: 307 EEWCELEAAVQSGPISSFGKKLSSILETCLSGYDGEVLYFDEGVRSAKRKQLEDKLLQLV 366
           E W ELE AVQSGP+S FG+KLSSIL+  LS YD E  YF+E VRS+KR+QL++KLLQLV
Sbjct: 304 ENWRELEEAVQSGPVSGFGRKLSSILQASLSEYDTEATYFEESVRSSKRQQLQEKLLQLV 363

Query: 367 QPAFQSMLGHIRSGTLDKFKDAFDKALSGGEGFSSAAHHCSKFYMNLFDEACADAVIEQA 426
           QP FQ +LGH+R+G L+ FK+AF+KAL  GEGFSS+A  C++  ++ FD+ C +AVIEQA
Sbjct: 364 QPTFQDVLGHLRAGALENFKNAFEKALDAGEGFSSSAKSCAQSCISKFDKGCEEAVIEQA 423

Query: 427 NWDMSKARDKFQRDIDAHIASVRAAKLGELTAIFEAKLNESLSGPVEALLDGANNETWPA 486
            WD SK R+K +RDI+AHI+SVR AKL ELT ++E+KLN +LSGPVEALLDGAN+ETWPA
Sbjct: 424 KWDTSKTREKLERDIEAHISSVRTAKLAELTTLYESKLNVALSGPVEALLDGANDETWPA 483

Query: 487 IRKLLRCETESAISGFSDALYGFDMDEETKEKMLASLENYAKGVVEAKAREESGRVLMRM 546
           IRKLLR E E A+ G S+AL GF+MDEET+ KMLA LENYA+G+VE KA+EE+GR +MRM
Sbjct: 484 IRKLLRREGELAVYGLSNALSGFEMDEETRSKMLADLENYARGIVETKAKEEAGRAMMRM 543

Query: 547 KDRFTSLFSHDSDSMPRVWTGKEDIRGITKLARSASLKLLSVMAAIRLDDETDNIESTLT 606
           KDRF ++FSHDSDSMPRVWTGKEDIR ITK+ARSASLKLLSVMA IRLDDE DNIE TLT
Sbjct: 544 KDRFATIFSHDSDSMPRVWTGKEDIRAITKMARSASLKLLSVMAVIRLDDELDNIEKTLT 603

Query: 607 LALVDSPSNAATNRSITNHDPLASSTWEQVPSSKTLITPVQCKSLWRQFKSETEYSVTQA 666
           LAL +S  N AT++SI+  D LASSTWE+V   KTLITPVQCKSLWRQFK+ETEY+VTQA
Sbjct: 604 LALFNSTGNNATSKSISTIDSLASSTWEKVAPEKTLITPVQCKSLWRQFKNETEYTVTQA 663

Query: 667 ISAQEANKRNNNWLPPPWAIAAMMVLGFNEFMTLLRNPLYLGFIFIGYLLIKALWVQLDI 726
           ISAQEAN+RNNNWLPPPWAI A++VLGFNEFMTLLRNPL+L  +F+GYL+ KALWVQL+I
Sbjct: 664 ISAQEANRRNNNWLPPPWAILALVVLGFNEFMTLLRNPLWLLVLFVGYLVSKALWVQLNI 723

Query: 727 SGEFRNGALPGLISLSTKFLPTVMNLLKKLAEEGQIPATNNNPQRNPVRASMNHQNG 783
           SGEF+NG LPGL+SLSTKF+PTVMNLLKKLAEEGQ P TN+N   N    S    NG
Sbjct: 724 SGEFQNGVLPGLLSLSTKFIPTVMNLLKKLAEEGQAPPTNSNQSMNSTAQSEVTTNG 780
Probable GTP-binding protein involved in cell wall expansion. Required for appropriate root and root hair cells enlargement. May inhibit vacuole enlargement during root hair cell expansion. Plays a role in cell wall biosynthesis and actin organization. Seems to act independently from auxin and ethylene pathways. May regulate membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER).
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 5EC: .EC: -
>sp|Q9SSN0|RHD31_ARATH Protein ROOT HAIR DEFECTIVE 3 homolog 1 OS=Arabidopsis thaliana GN=At1g72960 PE=2 SV=2 Back     alignment and function description
>sp|Q0JLS6|RHD3_ORYSJ Protein ROOT HAIR DEFECTIVE 3 OS=Oryza sativa subsp. japonica GN=RHD3 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKE9|RHD32_ARATH Protein ROOT HAIR DEFECTIVE 3 homolog 2 OS=Arabidopsis thaliana GN=At5g45160 PE=2 SV=1 Back     alignment and function description
>sp|Q2QMH2|RHD31_ORYSJ Protein ROOT HAIR DEFECTIVE 3 homolog 1 OS=Oryza sativa subsp. japonica GN=Os12g0604600 PE=2 SV=1 Back     alignment and function description
>sp|Q2R224|RHD32_ORYSJ Protein ROOT HAIR DEFECTIVE 3 homolog 2 OS=Oryza sativa subsp. japonica GN=Os11g0582300 PE=2 SV=1 Back     alignment and function description
>sp|A8N5E5|SEY1_COPC7 Protein SEY1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=SEY1 PE=3 SV=1 Back     alignment and function description
>sp|Q54W90|SEY1_DICDI Protein SEY1 homolog OS=Dictyostelium discoideum GN=DDB_0206311 PE=3 SV=1 Back     alignment and function description
>sp|B0D0N9|SEY1_LACBS Protein SEY1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=SEY1 PE=3 SV=1 Back     alignment and function description
>sp|Q4PEQ0|SEY1_USTMA Protein SEY1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SEY1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query813
255572949813 Protein SEY1, putative [Ricinus communis 0.998 0.998 0.828 0.0
359482513871 PREDICTED: protein ROOT HAIR DEFECTIVE 3 0.998 0.932 0.808 0.0
297743083 1029 unnamed protein product [Vitis vinifera] 0.998 0.789 0.809 0.0
356522460808 PREDICTED: protein ROOT HAIR DEFECTIVE 3 0.992 0.998 0.808 0.0
356526017808 PREDICTED: protein ROOT HAIR DEFECTIVE 3 0.992 0.998 0.809 0.0
356557329812 PREDICTED: protein ROOT HAIR DEFECTIVE 3 0.995 0.996 0.772 0.0
449447853818 PREDICTED: protein ROOT HAIR DEFECTIVE 3 0.998 0.992 0.766 0.0
449480571818 PREDICTED: LOW QUALITY PROTEIN: protein 0.998 0.992 0.765 0.0
356547353800 PREDICTED: protein ROOT HAIR DEFECTIVE 3 0.936 0.951 0.796 0.0
15231390802 Root hair defective 3 GTP-binding protei 0.955 0.968 0.788 0.0
>gi|255572949|ref|XP_002527405.1| Protein SEY1, putative [Ricinus communis] gi|223533215|gb|EEF34971.1| Protein SEY1, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1392 bits (3602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 674/814 (82%), Positives = 748/814 (91%), Gaps = 2/814 (0%)

Query: 1   MAKGEECCSTQLIDGDGTFNVSGIEHFIKEVKLSDCGLSYAVVSIMGPQSSGKSTLLNHL 60
           MA  EE CSTQLIDGDGTFN +G+EHF KEV+L +CGLSYAVVSIMGPQSSGKSTLLN+L
Sbjct: 1   MANSEESCSTQLIDGDGTFNAAGLEHFTKEVRLGECGLSYAVVSIMGPQSSGKSTLLNNL 60

Query: 61  FGTNFREMDAFKGRSQTTKGIWMARCAGIEPCTLIMDLEGTDGRERGEDDTAFEKQSALF 120
           FGTNFREMDAF+GRSQTTKGIW+ARCAGIEPCTL+MDLEGTDGRERGEDDTAFEKQSALF
Sbjct: 61  FGTNFREMDAFRGRSQTTKGIWLARCAGIEPCTLVMDLEGTDGRERGEDDTAFEKQSALF 120

Query: 121 ALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRKTTLMFVIRDKTRTPLEN 180
           ALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRKTTLMFVIRDKTRTPLEN
Sbjct: 121 ALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRKTTLMFVIRDKTRTPLEN 180

Query: 181 LEPVLREDIQKIWDSVPKPQAHMETPLSEFFNVEVVALSSFEEKEELFKEQVASLRQRFY 240
           LEPVLREDIQKIWD+VPKPQ H ETPLSEFFNVEVVALSS+EEKEE FKEQVASLRQRF+
Sbjct: 181 LEPVLREDIQKIWDAVPKPQEHKETPLSEFFNVEVVALSSYEEKEEQFKEQVASLRQRFF 240

Query: 241 HSVAPGGLAGDRRGVVPASGFSFSAHEIWKVIKENKDLDLPAHKVMVATVRCEEIANEKY 300
           HS+APGGLAGDRRGVVPASGFSFSA ++WKVIKENKDLDLPAHKVMVATVRCEEIANEKY
Sbjct: 241 HSIAPGGLAGDRRGVVPASGFSFSAQQMWKVIKENKDLDLPAHKVMVATVRCEEIANEKY 300

Query: 301 SSFAANEEWCELEAAVQSGPISSFGKKLSSILETCLSGYDGEVLYFDEGVRSAKRKQLED 360
           ++F  NEEW ++E AVQSGP+S FGKKLSS L T  S YD E +YFDEGVRSAKRKQLE+
Sbjct: 301 ANFTTNEEWHQIEEAVQSGPVSGFGKKLSSTLSTSFSEYDAEAIYFDEGVRSAKRKQLEE 360

Query: 361 KLLQLVQPAFQSMLGHIRSGTLDKFKDAFDKALSGGEGFSSAAHHCSKFYMNLFDEACAD 420
           KLLQLVQPA QSMLGHIRSGTLDKFK+AFDKAL+ GEGFSSAA+ C+++YM +FDE C D
Sbjct: 361 KLLQLVQPAHQSMLGHIRSGTLDKFKEAFDKALAAGEGFSSAAYSCTQYYMTVFDEGCTD 420

Query: 421 AVIEQANWDMSKARDKFQRDIDAHIASVRAAKLGELTAIFEAKLNESLSGPVEALLDGAN 480
           A+IEQA+WD SK RDK +RDIDAH+ASVRAAKL ELT+ FEAKLNE+LSGPVEALLDGA 
Sbjct: 421 AIIEQASWDTSKVRDKLRRDIDAHVASVRAAKLSELTSSFEAKLNEALSGPVEALLDGAT 480

Query: 481 NETWPAIRKLLRCETESAISGFSDALYGFDMDEETKEKMLASLENYAKGVVEAKAREESG 540
           +ETWPAIRKLL+ E+ESA+SG S AL GFDMD+++K+KML+SLE YA+GVVEAKA+EE+G
Sbjct: 481 SETWPAIRKLLQRESESAVSGLSSALAGFDMDKQSKDKMLSSLETYARGVVEAKAKEEAG 540

Query: 541 RVLMRMKDRFTSLFSHDSDSMPRVWTGKEDIRGITKLARSASLKLLSVMAAIRLDDETDN 600
           RVL+RMKDRF+ LFSHDSDSMPRVWTGKEDIR ITK ARSASLKLLSVM AIRLDDE DN
Sbjct: 541 RVLIRMKDRFSMLFSHDSDSMPRVWTGKEDIRAITKTARSASLKLLSVMVAIRLDDEVDN 600

Query: 601 IESTLTLALVDSPSNAA-TNRSITNHDPLASSTWEQVPSSKTLITPVQCKSLWRQFKSET 659
           +ESTL+   +D+ +NAA T RSIT  DPLASSTW++VPSSKTLITPVQCKSLWRQFK+ET
Sbjct: 601 VESTLSSVFLDTKNNAAVTERSITKTDPLASSTWDEVPSSKTLITPVQCKSLWRQFKAET 660

Query: 660 EYSVTQAISAQEANKRNNNWLPPPWAIAAMMVLGFNEFMTLLRNPLYLGFIFIGYLLIKA 719
           EYSVTQAISAQEANKRNNNWLPPPWAI A++VLGFNEFMTLLRNPLYLGFIF+ +LL+KA
Sbjct: 661 EYSVTQAISAQEANKRNNNWLPPPWAIVALVVLGFNEFMTLLRNPLYLGFIFVVFLLVKA 720

Query: 720 LWVQLDISGEFRNGALPGLISLSTKFLPTVMNLLKKLAEEGQIPATNNNPQRNPVRASMN 779
           LWVQLD+SGEFRNGALPGLISLSTKFLPT+MNL+KKLAEEGQ PAT N+PQRNP  A+ +
Sbjct: 721 LWVQLDVSGEFRNGALPGLISLSTKFLPTIMNLIKKLAEEGQKPAT-NDPQRNPALAAKS 779

Query: 780 HQNGVSTSEISSTASSGVTSSGNGTEYSSPRKEE 813
            +NGV +S+  STASSGVTS+ NGTE+SS  K++
Sbjct: 780 FRNGVGSSDDMSTASSGVTSTENGTEFSSASKDD 813

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359482513|ref|XP_002279673.2| PREDICTED: protein ROOT HAIR DEFECTIVE 3 homolog 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743083|emb|CBI35950.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356522460|ref|XP_003529864.1| PREDICTED: protein ROOT HAIR DEFECTIVE 3 homolog 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356526017|ref|XP_003531616.1| PREDICTED: protein ROOT HAIR DEFECTIVE 3 homolog 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356557329|ref|XP_003546969.1| PREDICTED: protein ROOT HAIR DEFECTIVE 3 homolog 1-like [Glycine max] Back     alignment and taxonomy information
>gi|449447853|ref|XP_004141681.1| PREDICTED: protein ROOT HAIR DEFECTIVE 3 homolog 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449480571|ref|XP_004155933.1| PREDICTED: LOW QUALITY PROTEIN: protein ROOT HAIR DEFECTIVE 3 homolog 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356547353|ref|XP_003542078.1| PREDICTED: protein ROOT HAIR DEFECTIVE 3 homolog 1-like [Glycine max] Back     alignment and taxonomy information
>gi|15231390|ref|NP_188003.1| Root hair defective 3 GTP-binding protein RHD3 [Arabidopsis thaliana] gi|75279781|sp|P93042.1|RHD3_ARATH RecName: Full=Protein ROOT HAIR DEFECTIVE 3; AltName: Full=Protein FRAGILE FIBER 4; AltName: Full=Protein SEY1 homolog 1 gi|1839188|gb|AAB58375.1| root hair defective 3 [Arabidopsis thaliana] gi|20260178|gb|AAM12987.1| unknown protein [Arabidopsis thaliana] gi|22136246|gb|AAM91201.1| unknown protein [Arabidopsis thaliana] gi|332641908|gb|AEE75429.1| Root hair defective 3 GTP-binding protein RHD3 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query813
TAIR|locus:2087964802 RHD3 "ROOT HAIR DEFECTIVE 3" [ 0.950 0.963 0.761 0.0
TAIR|locus:2153343834 RL2 "AT5G45160" [Arabidopsis t 0.993 0.968 0.627 4.9e-275
DICTYBASE|DDB_G0279823894 DDB_G0279823 "Protein SEY1" [D 0.447 0.407 0.404 4.8e-92
POMBASE|SPAC222.14c762 SPAC222.14c "GTP binding prote 0.720 0.769 0.304 2.5e-75
SGD|S000005691776 SEY1 "Dynamin-like GTPase that 0.837 0.877 0.283 4.4e-68
CGD|CAL0005364790 NAG6 [Candida albicans (taxid: 0.830 0.854 0.271 6.2e-62
UNIPROTKB|Q9C0L9790 SEY1 "Protein SEY1" [Candida a 0.830 0.854 0.271 6.2e-62
UNIPROTKB|Q525S7848 SEY1 "Protein SEY1" [Magnaport 0.355 0.340 0.411 5.1e-59
GENEDB_PFALCIPARUM|PF14_0159 937 PF14_0159 "hypothetical protei 0.461 0.400 0.337 4e-52
UNIPROTKB|Q8ILT5 937 PF14_0159 "Protein SEY1 homolo 0.461 0.400 0.337 4e-52
TAIR|locus:2087964 RHD3 "ROOT HAIR DEFECTIVE 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3096 (1094.9 bits), Expect = 0., P = 0.
 Identities = 589/773 (76%), Positives = 667/773 (86%)

Query:     5 EECCSTQLIDGDGTFNVSGIEHFIKEVKLSDCGLSYAVVSIMGPQSSGKSTLLNHLFGTN 64
             +  CSTQLIDGDG FNVSG++HFIKEVKL +CGLSYAVVSIMGPQSSGKSTLLNHLFGTN
Sbjct:     2 DAACSTQLIDGDGVFNVSGVDHFIKEVKLDECGLSYAVVSIMGPQSSGKSTLLNHLFGTN 61

Query:    65 FREMDAFKGRSQTTKGIWMARCAGIEPCTLIMDLEGTDGRERGEDDTAFEKQSALFALAV 124
             FREMDAF+GRSQTTKGIW+ARCAGIEPCT++MDLEGTDGRERGEDDTAFEKQSALFALAV
Sbjct:    62 FREMDAFRGRSQTTKGIWIARCAGIEPCTVVMDLEGTDGRERGEDDTAFEKQSALFALAV 121

Query:   125 SDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRKTTLMFVIRDKTRTPLENLEPV 184
             SDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRKTTLMFVIRDKTRTPLENLEPV
Sbjct:   122 SDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRKTTLMFVIRDKTRTPLENLEPV 181

Query:   185 LREDIQKIWDSVPKPQAHMETPLSEFFNVEVVAXXXXXXXXXXXXXQVASLRQRFYHSVA 244
             LREDIQKIWDSVPKPQAH ETPLS+FFNVEVVA             QV +LRQRF+ SVA
Sbjct:   182 LREDIQKIWDSVPKPQAHKETPLSDFFNVEVVALSSYEEKEEQFKEQVYNLRQRFFQSVA 241

Query:   245 PGGLAGDRRGVVPASGFSFSAHEIWKVIKENKDLDLPAHKVMVATVRCEEIANEKYSSFA 304
             PGGLAGDRRGVVPA+ F+FSA ++W+VIK+NKDLDLPAHKVMVATVRCEEIANEK+SSF 
Sbjct:   242 PGGLAGDRRGVVPANAFAFSAKQMWQVIKDNKDLDLPAHKVMVATVRCEEIANEKFSSFI 301

Query:   305 ANEEWCELEAAVQSGPISSFGKKLSSILETCLSGYDGEVLYFDEGVRSAKRKQLEDKLLQ 364
             ANE W ELE AVQSGP+S FG+KLSSIL+  LS YD E  YF+E VRS+KR+QL++KLLQ
Sbjct:   302 ANENWRELEEAVQSGPVSGFGRKLSSILQASLSEYDTEATYFEESVRSSKRQQLQEKLLQ 361

Query:   365 LVQPAFQSMLGHIRSGTLDKFKDAFDKALSGGEGFSSAAHHCSKFYMNLFDEACADAVIE 424
             LVQP FQ +LGH+R+G L+ FK+AF+KAL  GEGFSS+A  C++  ++ FD+ C +AVIE
Sbjct:   362 LVQPTFQDVLGHLRAGALENFKNAFEKALDAGEGFSSSAKSCAQSCISKFDKGCEEAVIE 421

Query:   425 QANWDMSKARDKFQRDIDAHIASVRAAKLGELTAIFEAKLNESLSGPVEALLDGANNETW 484
             QA WD SK R+K +RDI+AHI+SVR AKL ELT ++E+KLN +LSGPVEALLDGAN+ETW
Sbjct:   422 QAKWDTSKTREKLERDIEAHISSVRTAKLAELTTLYESKLNVALSGPVEALLDGANDETW 481

Query:   485 PAIRKLLRCETESAISGFSDALYGFDMDEETKEKMLASLENYAKGVVEAKAREESGRVLM 544
             PAIRKLLR E E A+ G S+AL GF+MDEET+ KMLA LENYA+G+VE KA+EE+GR +M
Sbjct:   482 PAIRKLLRREGELAVYGLSNALSGFEMDEETRSKMLADLENYARGIVETKAKEEAGRAMM 541

Query:   545 RMKDRFTSLFSHDSDSMPRVWTGKEDIRGITXXXXXXXXXXXXVMAAIRLDDETDNIEST 604
             RMKDRF ++FSHDSDSMPRVWTGKEDIR IT            VMA IRLDDE DNIE T
Sbjct:   542 RMKDRFATIFSHDSDSMPRVWTGKEDIRAITKMARSASLKLLSVMAVIRLDDELDNIEKT 601

Query:   605 LTLALVDSPSNAATNRSITNHDPLASSTWEQVPSSKTLITPVQCKSLWRQFKSETEYSVT 664
             LTLAL +S  N AT++SI+  D LASSTWE+V   KTLITPVQCKSLWRQFK+ETEY+VT
Sbjct:   602 LTLALFNSTGNNATSKSISTIDSLASSTWEKVAPEKTLITPVQCKSLWRQFKNETEYTVT 661

Query:   665 QAISAQEANKRNNNWLPPPWAIAAMMVLGFNEFMTLLRNPLYLGFIFIGYLLIKALWVQL 724
             QAISAQEAN+RNNNWLPPPWAI A++VLGFNEFMTLLRNPL+L  +F+GYL+ KALWVQL
Sbjct:   662 QAISAQEANRRNNNWLPPPWAILALVVLGFNEFMTLLRNPLWLLVLFVGYLVSKALWVQL 721

Query:   725 DISGEFRNGALPGLISLSTKFLPTVMNLLKKLAEEGQIPATNNNPQRNPVRAS 777
             +ISGEF+NG LPGL+SLSTKF+PTVMNLLKKLAEEGQ P TN+N   N    S
Sbjct:   722 NISGEFQNGVLPGLLSLSTKFIPTVMNLLKKLAEEGQAPPTNSNQSMNSTAQS 774
GO:0005634 "nucleus" evidence=ISM
GO:0016817 "hydrolase activity, acting on acid anhydrides" evidence=IEA
GO:0005525 "GTP binding" evidence=ISS
GO:0009932 "cell tip growth" evidence=RCA;IMP
GO:0009832 "plant-type cell wall biogenesis" evidence=IMP
GO:0030036 "actin cytoskeleton organization" evidence=IMP
GO:0006888 "ER to Golgi vesicle-mediated transport" evidence=RCA;IMP
GO:0005737 "cytoplasm" evidence=IDA
GO:0010053 "root epidermal cell differentiation" evidence=IMP
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0000902 "cell morphogenesis" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0006820 "anion transport" evidence=RCA
GO:0006862 "nucleotide transport" evidence=RCA
GO:0006865 "amino acid transport" evidence=RCA
GO:0006886 "intracellular protein transport" evidence=RCA
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0015696 "ammonium transport" evidence=RCA
GO:0015802 "basic amino acid transport" evidence=RCA
GO:0016049 "cell growth" evidence=RCA
GO:0016051 "carbohydrate biosynthetic process" evidence=RCA
GO:0030243 "cellulose metabolic process" evidence=RCA
GO:0043069 "negative regulation of programmed cell death" evidence=RCA
GO:0043090 "amino acid import" evidence=RCA
GO:0043269 "regulation of ion transport" evidence=RCA
GO:0048193 "Golgi vesicle transport" evidence=RCA
GO:0048527 "lateral root development" evidence=RCA
GO:0048765 "root hair cell differentiation" evidence=RCA
TAIR|locus:2153343 RL2 "AT5G45160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0279823 DDB_G0279823 "Protein SEY1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC222.14c SPAC222.14c "GTP binding protein Sey1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000005691 SEY1 "Dynamin-like GTPase that mediates homotypic ER fusion" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
CGD|CAL0005364 NAG6 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q9C0L9 SEY1 "Protein SEY1" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|Q525S7 SEY1 "Protein SEY1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF14_0159 PF14_0159 "hypothetical protein, conserved" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8ILT5 PF14_0159 "Protein SEY1 homolog" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SSN0RHD31_ARATH3, ., 6, ., 5, ., -0.77510.94090.9622nono
P0CQ46SEY1_CRYNJ3, ., 6, ., 5, ., -0.30610.84990.8335yesno
Q0JLS6RHD3_ORYSJ3, ., 6, ., 5, ., -0.72100.98400.9925yesno
P93042RHD3_ARATH3, ., 6, ., 5, ., -0.78890.95570.9688yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.50.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
RHD3
RHD3 (ROOT HAIR DEFECTIVE 3); GTP binding; required for regulated cell expansion and normal root hair development. Encodes an evolutionarily conserved protein with putative GTP-binding motifs that is implicated in the control of vesicle trafficking between the endoplasmic reticulum and the Golgi compartments. (802 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
COW1
COW1 (CAN OF WORMS1); phosphatidylinositol transporter/ transporter; Encodes COW1 (can of worms [...] (554 aa)
      • 0.921
RHD2
RHD2 (ROOT HAIR DEFECTIVE 2); NAD(P)H oxidase; RHD2 (along with RHD3 and RHD4) is required for [...] (905 aa)
      • 0.919
RHD4
RHD4 (ROOT HAIR DEFECTIVE4); phosphatidylinositol-4,5-bisphosphate 5-phosphatase/ phosphatidyli [...] (597 aa)
      • 0.895
RHD1
RHD1 (ROOT HAIR DEFECTIVE 1); UDP-glucose 4-epimerase/ protein dimerization; Encodes a protein [...] (348 aa)
      • 0.788
CSLD3
CSLD3 (CELLULOSE SYNTHASE-LIKE D3); cellulose synthase/ transferase, transferring glycosyl grou [...] (1145 aa)
      • 0.780
SHV3
SHV3 (SHAVEN 3); glycerophosphodiester phosphodiesterase/ kinase; Glycerophosphoryl diester pho [...] (759 aa)
      • 0.679
LRX1
LRX1 (LEUCINE-RICH REPEAT/EXTENSIN 1); histidine phosphotransfer kinase/ protein binding / stru [...] (744 aa)
      • 0.677
AT3G53930
protein kinase family protein; protein kinase family protein; FUNCTIONS IN- protein serine/thre [...] (712 aa)
      • 0.659
RHL1
RHL1 (ROOT HAIRLESS 1); DNA binding / protein binding; Encodes a novel nuclear protein required [...] (386 aa)
      • 0.651
SHV2
SHV2 (SHAVEN 2); Involved in successfully establishing tip growth in root hairs. (663 aa)
      • 0.577

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query813
pfam05879743 pfam05879, RHD3, Root hair defective 3 GTP-binding 0.0
cd01851224 cd01851, GBP, Guanylate-binding protein (GBP) fami 4e-61
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 1e-04
cd00880161 cd00880, Era_like, E 3e-04
cd11383140 cd11383, YfjP, YfjP GTPase 8e-04
pfam02263264 pfam02263, GBP, Guanylate-binding protein, N-termi 0.001
>gnl|CDD|218791 pfam05879, RHD3, Root hair defective 3 GTP-binding protein (RHD3) Back     alignment and domain information 
 Score = 1009 bits (2610), Expect = 0.0
 Identities = 371/765 (48%), Positives = 484/765 (63%), Gaps = 41/765 (5%)

Query: 46  MGPQSSGKSTLLNHLFGTNFREMDAFKGRSQTTKGIWMARCAGI---EPCTLIMDLEGTD 102
            G QS+GKSTLLNHLFGTNF  MDA  GR QTTKGIW+A+C GI   EP  L+MD+EGTD
Sbjct: 1   FGSQSTGKSTLLNHLFGTNFSVMDA-SGRQQTTKGIWLAKCKGIGNMEPNILVMDVEGTD 59

Query: 103 GRERGEDDTAFEKQSALFALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLF--- 159
           GRERGED   FE++SALFALA S+++++NMW H +G  Q AN  LLKTVF+V ++LF   
Sbjct: 60  GRERGEDQD-FERKSALFALATSEVLIVNMWEHQVGLYQGANMGLLKTVFEVNLQLFGKD 118

Query: 160 --SPRKTTLMFVIRDKTR-TPLENLEPVLREDIQKIWDSVPKPQAHMETPLSEFFNVEVV 216
             +P KT L+FVIRD    TPLENLE  LRED+QKIWDS+ KP     +PL++FF+VE V
Sbjct: 119 KDNPHKTLLLFVIRDHVGVTPLENLEDTLREDLQKIWDSLSKPAGLENSPLNDFFDVEFV 178

Query: 217 ALSSFEEKEELFKEQVASLRQRFYHS--VAPGGLAGDRRGVVPASGFSFSAHEIWKVIKE 274
           AL   E +E+ FKE+V  LRQRF HS  + PGG A +  G +PA GFSF A +IW  I+ 
Sbjct: 179 ALPHKELQEDQFKEEVKKLRQRFVHSKGIEPGGFAPEYHGRIPADGFSFYAEQIWDQIEN 238

Query: 275 NKDLDLPAHKVMVATVRCEEIANEKYSSFAAN-----EEWCELEAAVQSGPISSFGKKLS 329
           NKDLDLP  +V+VA  RC+EIANE +  F        E+W EL+ A + G +   G KL+
Sbjct: 239 NKDLDLPTQQVLVAQFRCDEIANEVFEEFITAYDPLEEKWRELKEAGEGGLLGGLGAKLA 298

Query: 330 SILETCLSGYDGEVLYFDEGVRSAKRKQLEDKLLQLVQPAFQSMLGHIRSGTLDKFKDAF 389
           SI E CLS YD E   +++GV   KR++LE+KL   ++P FQ+ LG +  G L+ FK+A 
Sbjct: 299 SIREKCLSEYDTEASRYNKGVYQEKRQELEEKLDSHLKPTFQAQLGALHKGLLESFKEAV 358

Query: 390 DKALSGGEGFSSAAHHCSKFYMNLFDEACADAVIEQANWDMS-KARDKFQRDIDAHIASV 448
             AL  GEGF+ +        +  FDE C    IEQA W  S K R K ++DIDAH A +
Sbjct: 359 SSALKAGEGFAESVKDGKTKCVEKFDEECESLAIEQATWSNSDKIRLKLEKDIDAHSARL 418

Query: 449 RAAKLGELTAIFEAKLNESLSGPVEALLDGANNETWPAIRKLLRCETESAISGFSDALYG 508
           R  +L ELT  +E KL  +LS PVE LL+  N ETW  + KL + E E A+S F+D   G
Sbjct: 419 RKEELKELTNRYEKKLVSALSEPVELLLNKLNKETWDTVLKLFKREVEDAVSRFTDRKSG 478

Query: 509 FDMDEETKEKMLASLENYAKGVVEAKAREE--SGRVLMRMKDRFTSLFSHDSDSMPRVWT 566
           FD+ EE  +KML +L+  + GV+  K  EE    ++LMR++DRF   F +DSD MPR+WT
Sbjct: 479 FDLSEEENDKMLKNLKRKSWGVLRTKIHEEASEVKLLMRLRDRFEDKFRYDSDGMPRLWT 538

Query: 567 GKEDIRGITKLARSASLKLLSVMAAIRLDDETDNIESTLTLALVDSPSNAATNRSITNHD 626
           GKEDI GI K+AR  +LKLL V++ IRL D +D I  TL + L     N A   S+T+ D
Sbjct: 539 GKEDIEGIYKVAREHALKLLPVLSRIRLSDGSDPIPDTLIVGLEPGTVNPADEESVTSID 598

Query: 627 PLASSTWEQVPSSKTLITPVQCKSLWRQFKSETEYSVTQAISAQEANKRNNNWLPPPWAI 686
            L SS WE+VPS  T++T VQ KSLW QFK E +Y+VT+A    + +  NNN   PP+  
Sbjct: 599 GLDSSEWEEVPSFATILTEVQKKSLWVQFKKEADYTVTEA----KRSIINNNTQIPPYFY 654

Query: 687 AAMMVLGFNEFMTLLRNPLYLGFIFIGYLLIKALWVQLDISGEFRNGALPGLISLSTKFL 746
             ++VLG+NEFM +LRNPLY   +F+  L +  L+ QL + G             + K L
Sbjct: 655 VLLLVLGWNEFMAVLRNPLYFLLLFVLGLTVYVLY-QLGLWG------------PAVKVL 701

Query: 747 PTVMNLLKKLAEEGQIPATNNNPQRNPVRASMNHQNGVSTSEISS 791
           PT MNLL+ LA++        + +   VRAS   ++  S   ISS
Sbjct: 702 PTAMNLLRVLAKDKLREFLQEDHE---VRASQEMKDSSSPESISS 743

This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins. It has been speculated that the RHD3 protein is a member of a novel class of GTP-binding proteins that is widespread in eukaryotes and required for regulated cell enlargement. The family also contains the homologous yeast synthetic enhancement of YOP1 (SEY1) protein which is involved in membrane trafficking. Length = 743
>gnl|CDD|206650 cd01851, GBP, Guanylate-binding protein (GBP) family (N-terminal domain) Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|206743 cd11383, YfjP, YfjP GTPase Back     alignment and domain information
>gnl|CDD|111185 pfam02263, GBP, Guanylate-binding protein, N-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 813
KOG2203772 consensus GTP-binding protein [General function pr 100.0
PF05879742 RHD3: Root hair defective 3 GTP-binding protein (R 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.98
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.97
COG1127263 Ttg2A ABC-type transport system involved in resist 99.97
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 99.97
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.96
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.96
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.96
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.96
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.96
COG3842352 PotA ABC-type spermidine/putrescine transport syst 99.96
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 99.95
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.95
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.95
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.95
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.95
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.95
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 99.95
PRK13537306 nodulation ABC transporter NodI; Provisional 99.95
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 99.95
COG4559259 ABC-type hemin transport system, ATPase component 99.95
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.95
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 99.95
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.95
PRK13536340 nodulation factor exporter subunit NodI; Provision 99.94
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.94
COG0411250 LivG ABC-type branched-chain amino acid transport 99.94
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 99.94
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 99.94
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.94
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 99.94
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 99.94
PRK11607377 potG putrescine transporter ATP-binding subunit; P 99.94
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 99.94
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.94
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.94
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.94
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.94
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.94
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 99.94
PRK11153343 metN DL-methionine transporter ATP-binding subunit 99.94
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.94
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.93
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.93
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 99.93
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.93
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.93
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.93
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.93
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
COG0410237 LivF ABC-type branched-chain amino acid transport 99.93
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.93
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
COG4175386 ProV ABC-type proline/glycine betaine transport sy 99.93
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.93
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.93
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.93
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 99.93
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 99.93
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.93
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.93
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.93
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.93
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.93
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.93
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.93
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.93
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.93
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.93
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 99.93
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.93
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.93
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.93
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.93
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.93
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.93
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.93
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.93
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.93
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.93
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.93
PRK10070400 glycine betaine transporter ATP-binding subunit; P 99.93
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.93
PRK09984262 phosphonate/organophosphate ester transporter subu 99.93
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
COG4152300 ABC-type uncharacterized transport system, ATPase 99.93
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.93
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.93
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.92
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 99.92
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.92
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.92
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 99.92
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.92
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 99.92
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.92
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 99.92
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.92
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.92
COG1123539 ATPase components of various ABC-type transport sy 99.92
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 99.92
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.92
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.92
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 99.92
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.92
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.92
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.92
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.92
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.92
PRK10908222 cell division protein FtsE; Provisional 99.92
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.92
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.92
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 99.92
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 99.92
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.92
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.92
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.92
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.92
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.92
COG1123539 ATPase components of various ABC-type transport sy 99.92
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.92
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.92
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.92
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.92
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.92
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 99.92
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.92
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 99.92
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 99.92
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.92
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.92
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.92
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.92
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.92
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.92
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.92
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.92
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.92
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.92
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.92
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 99.91
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 99.91
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.91
cd03246173 ABCC_Protease_Secretion This family represents the 99.91
PRK10938490 putative molybdenum transport ATP-binding protein 99.91
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.91
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.91
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.91
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.91
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.91
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.91
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.91
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.91
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.91
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.91
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.91
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.91
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.91
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.91
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.91
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.91
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.91
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.91
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.91
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.91
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.91
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.91
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.91
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.91
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.91
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.91
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.91
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.91
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.91
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.91
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.91
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.91
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.91
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.91
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.91
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.91
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.91
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.91
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.91
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.91
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.91
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.91
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.9
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.9
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.9
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.9
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.9
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.9
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.9
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.9
PRK13545549 tagH teichoic acids export protein ATP-binding sub 99.9
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.9
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.9
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.9
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.9
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.9
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.9
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.9
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.9
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.9
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.9
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.9
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.9
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.9
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.9
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.9
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.9
COG4181228 Predicted ABC-type transport system involved in ly 99.9
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.9
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.9
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.9
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.9
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.9
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.9
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.9
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.9
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.9
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.9
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.9
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.89
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.89
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.89
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.89
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.89
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.89
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.89
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.89
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.89
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.89
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.89
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.89
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.89
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.89
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.89
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.89
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.89
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.89
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.89
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.89
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.89
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.89
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.89
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.89
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.89
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.89
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.88
cd03234226 ABCG_White The White subfamily represents ABC tran 99.88
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.88
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.88
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.88
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.88
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.88
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.88
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.88
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.88
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.88
COG4988559 CydD ABC-type transport system involved in cytochr 99.88
COG4987573 CydC ABC-type transport system involved in cytochr 99.88
PRK10938490 putative molybdenum transport ATP-binding protein 99.88
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.88
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.88
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.88
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.88
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.88
PRK11147635 ABC transporter ATPase component; Reviewed 99.88
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.87
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.87
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.87
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 99.87
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.87
COG4172534 ABC-type uncharacterized transport system, duplica 99.87
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.87
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.87
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.87
COG4586325 ABC-type uncharacterized transport system, ATPase 99.87
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.87
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.87
PRK11147635 ABC transporter ATPase component; Reviewed 99.87
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.87
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.87
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.86
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.86
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.86
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.86
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.86
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.86
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.86
PRK13409590 putative ATPase RIL; Provisional 99.86
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.86
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.86
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.86
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.86
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.86
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 99.86
PRK10535648 macrolide transporter ATP-binding /permease protei 99.86
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.86
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.86
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 99.86
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.86
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.86
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.86
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.86
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.86
PLN03211659 ABC transporter G-25; Provisional 99.86
PLN03073718 ABC transporter F family; Provisional 99.85
COG4172534 ABC-type uncharacterized transport system, duplica 99.85
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.85
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.85
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.85
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.84
PLN032321495 ABC transporter C family member; Provisional 99.84
PLN031301622 ABC transporter C family member; Provisional 99.84
COG0488530 Uup ATPase components of ABC transporters with dup 99.84
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.84
COG4619223 ABC-type uncharacterized transport system, ATPase 99.83
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.83
COG4148352 ModC ABC-type molybdate transport system, ATPase c 99.83
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 99.83
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.83
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.83
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.83
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.83
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.83
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.83
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.83
PTZ002431560 ABC transporter; Provisional 99.83
PLN03073718 ABC transporter F family; Provisional 99.82
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.82
TIGR009561394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.81
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 99.81
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.81
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.81
PLN032321495 ABC transporter C family member; Provisional 99.8
PLN031401470 ABC transporter G family member; Provisional 99.8
PLN03130 1622 ABC transporter C family member; Provisional 99.8
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.8
PRK13409590 putative ATPase RIL; Provisional 99.79
TIGR00955617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.79
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 99.79
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.78
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 99.78
KOG0061613 consensus Transporter, ABC superfamily (Breast can 99.78
COG0488530 Uup ATPase components of ABC transporters with dup 99.78
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.76
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.76
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.75
COG4133209 CcmA ABC-type transport system involved in cytochr 99.75
PLN03140 1470 ABC transporter G family member; Provisional 99.75
PTZ002431560 ABC transporter; Provisional 99.74
KOG00541381 consensus Multidrug resistance-associated protein/ 99.73
KOG0059885 consensus Lipid exporter ABCA1 and related protein 99.73
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.72
COG4136213 ABC-type uncharacterized transport system, ATPase 99.71
COG4615546 PvdE ABC-type siderophore export system, fused ATP 99.71
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 99.7
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.7
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.69
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.69
KOG00541381 consensus Multidrug resistance-associated protein/ 99.69
KOG2355291 consensus Predicted ABC-type transport, ATPase com 99.65
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.63
COG4170330 SapD ABC-type antimicrobial peptide transport syst 99.61
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.61
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.6
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.59
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.59
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.55
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.54
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.53
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.53
KOG0062582 consensus ATPase component of ABC transporters wit 99.51
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.51
KOG00651391 consensus Pleiotropic drug resistance proteins (PD 99.5
COG4178604 ABC-type uncharacterized transport system, permeas 99.5
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.47
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.45
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.44
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.44
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.42
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 99.4
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.39
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 99.39
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 99.37
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.36
cd03239178 ABC_SMC_head The structural maintenance of chromos 99.36
KOG0062582 consensus ATPase component of ABC transporters wit 99.34
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 99.28
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 99.26
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 99.25
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 99.24
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 99.19
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 99.17
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.15
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 99.13
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 99.13
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 99.03
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 99.02
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 99.01
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 99.01
COG3845501 ABC-type uncharacterized transport systems, ATPase 98.98
PRK006351809 excinuclease ABC subunit A; Provisional 98.96
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 98.96
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 98.9
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 98.89
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 98.85
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 98.82
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 98.81
COG3910233 Predicted ATPase [General function prediction only 98.76
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 98.76
PRK07721438 fliI flagellum-specific ATP synthase; Validated 98.73
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 98.7
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 98.68
PRK00409782 recombination and DNA strand exchange inhibitor pr 98.67
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 98.66
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 98.42
PRK08533230 flagellar accessory protein FlaH; Reviewed 98.4
PRK00064361 recF recombination protein F; Reviewed 98.34
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 98.32
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 98.32
PRK13695174 putative NTPase; Provisional 98.28
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.17
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 98.17
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 98.12
cd01124187 KaiC KaiC is a circadian clock protein primarily f 98.09
TIGR03238504 dnd_assoc_3 dnd system-associated protein 3. cereu 98.07
TIGR01026440 fliI_yscN ATPase FliI/YscN family. This family of 97.98
PRK05399854 DNA mismatch repair protein MutS; Provisional 97.95
smart00382148 AAA ATPases associated with a variety of cellular 97.92
cd01128249 rho_factor Transcription termination factor rho is 97.89
PRK06067234 flagellar accessory protein FlaH; Validated 97.88
PRK06793432 fliI flagellum-specific ATP synthase; Validated 97.86
PF00488235 MutS_V: MutS domain V C-terminus.; InterPro: IPR00 97.82
TIGR00634563 recN DNA repair protein RecN. All proteins in this 97.8
TIGR006181042 sbcc exonuclease SbcC. This family is based on the 97.73
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 97.69
PHA02562562 46 endonuclease subunit; Provisional 97.62
PRK10869553 recombination and repair protein; Provisional 97.62
PRK102461047 exonuclease subunit SbcC; Provisional 97.6
PF1355562 AAA_29: P-loop containing region of AAA domain 97.58
PRK06002450 fliI flagellum-specific ATP synthase; Validated 97.58
PRK13830818 conjugal transfer protein TrbE; Provisional 97.51
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 97.51
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 97.49
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 97.39
TIGR01070840 mutS1 DNA mismatch repair protein MutS. 97.38
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.37
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 97.36
TIGR00235207 udk uridine kinase. Model contains a number of lon 97.35
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.33
PRK09825176 idnK D-gluconate kinase; Provisional 97.32
PRK10416318 signal recognition particle-docking protein FtsY; 97.3
PRK03918880 chromosome segregation protein; Provisional 97.28
TIGR00767415 rho transcription termination factor Rho. Members 97.28
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 97.28
TIGR006061311 rad50 rad50. This family is based on the phylogeno 97.24
PRK01156895 chromosome segregation protein; Provisional 97.23
PRK09862506 putative ATP-dependent protease; Provisional 97.2
PRK09270229 nucleoside triphosphate hydrolase domain-containin 97.15
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 97.11
PRK15494339 era GTPase Era; Provisional 97.08
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 97.07
PRK07594433 type III secretion system ATPase SsaN; Validated 97.06
PRK00300205 gmk guanylate kinase; Provisional 97.06
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 97.02
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 97.01
PRK07196434 fliI flagellum-specific ATP synthase; Validated 96.99
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 96.94
PRK13898800 type IV secretion system ATPase VirB4; Provisional 96.9
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 96.87
COG1159298 Era GTPase [General function prediction only] 96.85
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 96.82
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 96.81
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 96.76
PRK08149428 ATP synthase SpaL; Validated 96.74
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 96.72
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 96.71
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 96.71
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 96.71
PF09818448 ABC_ATPase: Predicted ATPase of the ABC class; Int 96.71
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 96.69
cd01878204 HflX HflX subfamily. A distinct conserved domain w 96.68
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 96.67
PRK05480209 uridine/cytidine kinase; Provisional 96.66
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 96.66
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 96.65
>KOG2203 consensus GTP-binding protein [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=3.8e-165  Score=1345.13  Aligned_cols=740  Identities=64%  Similarity=1.008  Sum_probs=710.4

Q ss_pred             CccEEEEeeeEEeccccccceeeecceeeeccCCcEEEEEcCCCCcHHHHHHHHHcCCCCCCCCCCCeeeeccceecccc
Q 003528            7 CCSTQLIDGDGTFNVSGIEHFIKEVKLSDCGLSYAVVSIMGPQSSGKSTLLNHLFGTNFREMDAFKGRSQTTKGIWMARC   86 (813)
Q Consensus         7 ~~~Iel~dls~~y~~~~~~~vL~~vsl~i~~~~GeivaIiGpNGSGKSTLLn~L~Gl~~~~m~p~sG~~q~~~g~~~~~~   86 (813)
                      .+.+|++|..+.|+..+...+.+.+.+..+|.+|++|+|+||++||||||||+|||+.|.+||...||.|+++|+|+++.
T Consensus         4 r~stQlIDe~keFn~s~l~~F~q~vgl~d~Gl~YhVVavmG~QSSGKSTLLN~LFgTnF~~MDA~~gRqQTTKGIWlar~   83 (772)
T KOG2203|consen    4 RCSTQLIDEEKEFNVSGLDYFQQCVGLRDCGLSYHVVAVMGSQSSGKSTLLNHLFGTNFREMDAFKGRQQTTKGIWLARC   83 (772)
T ss_pred             cccceeeccccccchhhHHHHHHHhcccccCcceeEEEEecCcccchHHHHHHHhccChHHHHhhhccccccchhhHHhh
Confidence            45799999999998755667889999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCchhHHHHhhCCCccccccchHHHHHHHHHHHHHHHhHhhhccCCCCCCchhhcChhhHHHHHHHHHHhhcCCC--c
Q 003528           87 AGIEPCTLIMDLEGTDGRERGEDDTAFEKQSALFALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRK--T  164 (813)
Q Consensus        87 ~~~e~~~~vld~~g~~~~e~~~~~~~~erQrv~iA~ALadvLLLDEPtsgLD~~~~a~~~l~~~v~ell~~L~~~~g--~  164 (813)
                      .+.++.++|||++|++++||+++ ++||||.++||.|+++|+|+|+|++++|.++++|++++++|++++++|+..++  +
T Consensus        84 ~~i~p~i~vmDvEGTDGrERGED-qdFErksALFaiavSevvivNMW~~qIG~~Q~aN~~LLKTVfeV~lrLF~~rk~k~  162 (772)
T KOG2203|consen   84 AGIEPCILVMDVEGTDGRERGED-QDFERKSALFAIAVSEVVIVNMWEHQIGLYQGANMALLKTVFEVNLRLFSPRKNKT  162 (772)
T ss_pred             cCCCCceEEEecccCCccccccc-ccHHHHhHHHHHhhhheehhhHHHHHhhHhhccCcHHHHHHHHHHHHHhCCCCCce
Confidence            99999999999999999999999 99999999999999999999999999999999999999999999999998765  8


Q ss_pred             eEEEEeecC-CCcccccCcceeeecCCeEEEecCcccccCCccchhhhcccccccccchhhHHHHHHHHHHHHhhhhcc-
Q 003528          165 TLMFVIRDK-TRTPLENLEPVLREDIQKIWDSVPKPQAHMETPLSEFFNVEVVALSSFEEKEELFKEQVASLRQRFYHS-  242 (813)
Q Consensus       165 TIL~VtHD~-~~~~~~~~~~vll~~~GkI~~~g~~~e~~~~~~l~d~f~~~~~~lp~~~~~~e~f~~~v~~Lr~~f~~~-  242 (813)
                      +++||++|. ..++...+..+++.+..+||.+.++|+.+++..+.|||++.+.+++||+.++++|.++|..||+||.++ 
T Consensus       163 ~LlFVIRD~~~~TplenLe~~l~~dlqkIW~sl~KPe~~e~s~l~DfFdv~~v~Ls~~~~kedqF~e~V~~LrqrFv~s~  242 (772)
T KOG2203|consen  163 LLLFVIRDKTGVTPLENLEDVLREDLQKIWDSLSKPEGHENSPLNDFFDVEFVGLSHKELKEDQFKEQVASLRQRFVHSG  242 (772)
T ss_pred             EEEEEEecccCCCchHHhhHHHHHHHHHHHHhcCCcccccCCchhhhhceeeeecchHHHHHHHHHHHHHHHHHHHHhcC
Confidence            999999999 558888889999999999999999999999999999999999999999999999999999999999998 


Q ss_pred             CCCCCCCCCCCCcccccchhhhHHHHHHHHHhccCCCCchhhhhhhhhchHHHHHHHHhhhhhhhhHHHHHHHHhcCCcc
Q 003528          243 VAPGGLAGDRRGVVPASGFSFSAHEIWKVIKENKDLDLPAHKVMVATVRCEEIANEKYSSFAANEEWCELEAAVQSGPIS  322 (813)
Q Consensus       243 ~~~~~l~~~~~~~ip~~gl~~~~~~iW~~I~~n~dLdlp~q~~~lA~~rC~Ei~~~~~~~f~~~~~~~~l~~~~~~g~~~  322 (813)
                      ++|.+++++||++||++||++|+++||++|++|||||||+||.|||++||+||++++++.|.+++.|..+.+.++.|+++
T Consensus       243 ~s~~~f~~d~~~~iPadGfs~~a~qiWd~Ie~NKDLDLPtqqvlvAt~rceEIanE~~e~fitne~~~e~~e~l~g~l~s  322 (772)
T KOG2203|consen  243 ISPYGFAGDYHGVIPADGFSFYAEQIWDVIEENKDLDLPTQQVLVATVRCEEIANEKLEEFITNEKWLELIEALQGNLVS  322 (772)
T ss_pred             CCCCccccccCCcccccchhhhHHHHHHHHHhCcCCCCchhhhHHhhhhHHHHHHHHHHHhhhhhhHHHHHhhhcCCCcc
Confidence            77878899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHhhchhhhhhhhcHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCCChHHH
Q 003528          323 SFGKKLSSILETCLSGYDGEVLYFDEGVRSAKRKQLEDKLLQLVQPAFQSMLGHIRSGTLDKFKDAFDKALSGGEGFSSA  402 (813)
Q Consensus       323 ~~g~~~~~~~~~~l~~yd~~a~~y~~~V~~~kr~~L~~~i~~~l~~~~~~~l~~l~~~~~~~f~~~l~~~~~~~~~F~~~  402 (813)
                      +||+++..++++|+++||.+|+||+++||++||++|..++++.++|.|+.+|+|||+.++++||.++++.++.+.+|+++
T Consensus       323 ~l~~kL~~i~e~~lseYD~qAs~y~~~V~~~KrqqL~~kl~s~v~~~fq~~L~~L~~~lle~fk~~~~~~~~~~~gF~es  402 (772)
T KOG2203|consen  323 GLGKKLSSILEECLSEYDEQASRYDEGVYSEKRQQLNEKLLSHVYPTFQDVLGHLREGLLESFKLAFEKALKATEGFSES  402 (772)
T ss_pred             chhHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHhccccccchHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhHhHHHHHHHHHHHhhhhhhccCCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcchHHHhhcCCCCC
Q 003528          403 AHHCSKFYMNLFDEACADAVIEQANWDMSKARDKFQRDIDAHIASVRAAKLGELTAIFEAKLNESLSGPVEALLDGANNE  482 (813)
Q Consensus       403 ~~~~~~~~~~~f~~~~~~~~i~~~~w~~~~~~~~l~~~l~~~~~~~r~~~l~~l~~~~ek~~~~~l~~~v~~ll~~~~~~  482 (813)
                      +..|.++|+.+|+++|+++.++|+.||+++++++|.++|++|+.++|..+|++++..||+++..+|++||+.+|++++++
T Consensus       403 ~~~~~~~~~~~fde~~E~~~~~~~~wd~ski~~Kls~diea~i~~lr~akLke~~~~~e~~l~~else~Ve~ll~~~s~e  482 (772)
T KOG2203|consen  403 VADGKQSCEKKFDEECETAKIEQALWDTSKIREKLSRDIEAHISSLRTAKLKEKTGLYEKKLVPELSEPVEALLDGASKE  482 (772)
T ss_pred             HHHHHHHHHHHHHhhhHhhcccccccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccHhhhHHHHHHHhccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHHHHHhhhhhhhcCCC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHhhhccccCCCC
Q 003528          483 TWPAIRKLLRCETESAISGFSDALYGFD--MDEETKEKMLASLENYAKGVVEAKAREESGRVLMRMKDRFTSLFSHDSDS  560 (813)
Q Consensus       483 ~W~~i~~~f~~~~~~~~~~~~~~~~~~~--~~~~e~~~~~~~lr~~~~~~l~~~~~e~~~~~l~~l~~rFe~~FryD~~g  560 (813)
                      +||.|++.|++..+.++..+++...||+  +++++++++++.||.+||..++.|++|++++|+++||+||+++||||.||
T Consensus       483 vW~ti~n~f~~e~n~av~~~~~~~~~f~~~~de~t~~~m~~nlk~~a~~~~etk~~ee~~~il~rmrdRFe~vFr~Dsd~  562 (772)
T KOG2203|consen  483 VWDTIRNLFRRETNTAVYGLSNAVYGFEIGLDEETRDKMVKNLKNYAWGTVETKAKEEADRILMRMRDRFETVFRYDSDG  562 (772)
T ss_pred             cHHHHHHHHHhccchhHHHHhhcccccccccchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCC
Confidence            9999999999999999999999999998  99999999999999999999999999999999999999999999999999


Q ss_pred             CCccccCccchhhHHHHHHHHHHHHHhhHhheecCCCCccchhhhhhhccCCCCCccccCCCCCCCCCCCCccCCCCCCC
Q 003528          561 MPRVWTGKEDIRGITKLARSASLKLLSVMAAIRLDDETDNIESTLTLALVDSPSNAATNRSITNHDPLASSTWEQVPSSK  640 (813)
Q Consensus       561 ~PR~W~~~~di~~~~~~Ar~~al~ll~~l~~~rl~~~~~~i~~~l~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~  640 (813)
                      |||+|++++|||+||+.||++||+||+||+.||++|+   ++.+|+.++.+..++.+++  +.+.||++++     .++.
T Consensus       563 mPrlWk~kedI~~~~r~ar~~aL~llsVla~irlsDn---ie~~l~v~l~~~e~~~~s~--i~t~d~lass-----~~~~  632 (772)
T KOG2203|consen  563 MPRLWKGKEDIDAITRVARSAALKLLSVLAVIRLSDN---IEKTLTVALADEESNETSS--IYTNDPLASS-----ASFA  632 (772)
T ss_pred             CcccccCcchhHHHHHHHHHHHHHHHHHHHhheecCC---ccccCccccccCCCCCCCc--ccccCccccC-----Cccc
Confidence            9999999999999999999999999999999999955   4555777888876654443  6678999866     7789


Q ss_pred             cccCHHHHHHHHHHHHhhhhHHHHHhhHHHHHhhhcCCCCCcHHHHHHHHHhchHHHHHHHHhhHHHHHHHHHHHHHHHH
Q 003528          641 TLITPVQCKSLWRQFKSETEYSVTQAISAQEANKRNNNWLPPPWAIAAMMVLGFNEFMTLLRNPLYLGFIFIGYLLIKAL  720 (813)
Q Consensus       641 ~ll~~~~~~~~~~~F~~~~~~~~~~A~~~~ea~r~~~~~~iP~w~~~~l~vLGwNE~m~vlrnPl~~~~~~~~~~~~~~~  720 (813)
                      |||||.||++||+||| +++|++.||+++||++   ++++||||+|++|+||||||||++|||||||+++||+++++|+|
T Consensus       633 tilt~vq~ksi~~qFk-rt~~~v~~d~k~s~~n---t~t~iPPw~~vlLiVLG~NEFmallRNPl~l~~~~v~~~~~~~l  708 (772)
T KOG2203|consen  633 TILTPVQCKSIWRQFK-RTEYTVTQDIKRSEIN---TNTWIPPWAIVLLIVLGWNEFMALLRNPLYLLVLFVGGLVSKAL  708 (772)
T ss_pred             eeccHHHHHHHHHHHH-HhhhHHHHHHHHHHhc---CCCCCCcHHHHHHHHHhHHHHHHHHhchHHHHHHHHHHHHHHHH
Confidence            9999999999999999 8889999998888887   55667779999999999999999999999999999999999999


Q ss_pred             HHHhcccccccccccchhhhhhhhhhHHHHHHHHHHHhcCCC
Q 003528          721 WVQLDISGEFRNGALPGLISLSTKFLPTVMNLLKKLAEEGQI  762 (813)
Q Consensus       721 ~~ql~~~~~~~~g~~~~~~~~s~~~~~~~~~~~~~~~~~~~~  762 (813)
                      |+|++|+ +||||+|||++|++++|.|++||++++++.+||.
T Consensus       709 ~~q~~i~-ef~~~vl~~~~s~~~k~~~tv~n~lrq~ave~~a  749 (772)
T KOG2203|consen  709 WVQGLIP-EFQNGVLPGVLSISGKFRTTVMNLLRQLAVEGQA  749 (772)
T ss_pred             HHhccch-hhhcchhHHHHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            9999999 9999999999999999999999999999999993

>PF05879 RHD3: Root hair defective 3 GTP-binding protein (RHD3); InterPro: IPR008803 This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>PRK05399 DNA mismatch repair protein MutS; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PF00488 MutS_V: MutS domain V C-terminus Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK13830 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR01070 mutS1 DNA mismatch repair protein MutS Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PRK13898 type IV secretion system ATPase VirB4; Provisional Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>PF09818 ABC_ATPase: Predicted ATPase of the ABC class; InterPro: IPR019195 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query813
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 6e-25
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 1e-06
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Length = 447 Back     alignment and structure
 Score =  107 bits (268), Expect = 6e-25
 Identities = 57/401 (14%), Positives = 123/401 (30%), Gaps = 62/401 (15%)

Query: 11  QLIDGDGTFNVSGIEHFIKEVKLSDCGLSY--AVVSIMGPQSSGKSTLLNHLFGTNFREM 68
            ++  D +F +   E  +  + LS+         VS+ G    GKS L++ +    + + 
Sbjct: 38  LIVKDDHSFELD--ETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQE 95

Query: 69  DAFK---------------GRSQTTKGIWMARCA-------GIEPCTLIMDLEGTDGRER 106
                              G  + T GI +           G +   L+MD +GT   + 
Sbjct: 96  SVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQS 155

Query: 107 GEDDTAFEKQSALFALAVSDIVLINMWCHDIGREQAANKPLLKTVF--QVMMRLFSPRKT 164
              D      + +FAL+     +         +E       L T +    M   F     
Sbjct: 156 TLRD-----SATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEETFLKPFQ 210

Query: 165 TLMFVIRDKT---------RTPLENLEPVLR------EDIQKIWDSVPKPQAHMETPLSE 209
           +L+F++RD +             + LE  L+      E++Q +   +     ++   L  
Sbjct: 211 SLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQNVRKHIHSCFTNISCFLLP 270

Query: 210 FFNVEVVALSSFEEKEELFKEQVASLRQRF------YHSVAPGGLAGDRRGVVPASGFSF 263
              ++V    +F+ K +   ++     +          S+    + G++   +   G   
Sbjct: 271 HPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPESLDIKEINGNK---ITCRGLVE 327

Query: 264 SAHEIWKVIKENKDLDLPAHKVMVATVRCEEIANEKYSSFAANEEWCELEAAVQSGPIS- 322
                 K+ +  +     +     A             ++    +  E         ++ 
Sbjct: 328 YFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTY---NKKMEEICGGDKPFLAP 384

Query: 323 -SFGKKLSSILETCLSGYDGEVLYFDEGVRSAKRKQLEDKL 362
                K   + E  +  + G      E       +QLE ++
Sbjct: 385 NDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESEI 425
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 813
d1f5na2277 c.37.1.8 (A:7-283) Interferon-induced guanylate-bi 1e-36
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 3e-04
d1tq4a_400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 3e-04
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 7e-04
d1puia_188 c.37.1.8 (A:) Probable GTPase EngB {Escherichia co 0.001
d2gj8a1161 c.37.1.8 (A:216-376) Probable tRNA modification GT 0.002
d1mkya1171 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal 0.002
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 0.002
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 0.003
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  136 bits (344), Expect = 1e-36
 Identities = 40/248 (16%), Positives = 76/248 (30%), Gaps = 50/248 (20%)

Query: 41  AVVSIMGPQSSGKSTLLNHLFGTNFREMDAFKGRSQTTKGIWMARC-AGIEPCTLIMDLE 99
            VV+I+G   +GKS L+N L G               TKGIWM       +P  +++ L+
Sbjct: 33  VVVAIVGLYRTGKSYLMNKLAGKKKG-FSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLD 91

Query: 100 GTDGRERGEDDTAFEKQSALFALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMMRL- 158
                +  + D   +      A+ +S   + N       +       + +   ++  +  
Sbjct: 92  TEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSS 151

Query: 159 -------------FSPRKTTLMFVIRD---------KTRTPLENLEPVL----------- 185
                        F       ++ +RD         +  TP E L   L           
Sbjct: 152 PDENENEVEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDE 211

Query: 186 -----REDIQKIWDSVPK---PQAHMETPLSEFFNVEVVALSSFEEKEELFKEQVASLRQ 237
                R  I+K +         +      L++   ++   L      +  F +QVA    
Sbjct: 212 TFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEEL------DPEFVQQVADFCS 265

Query: 238 RFYHSVAP 245
             + +   
Sbjct: 266 YIFSNSKT 273
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query813
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.96
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.96
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.96
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.96
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.96
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.96
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.96
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.96
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.95
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.95
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.95
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.94
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.94
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.94
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.94
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.93
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.93
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.91
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.88
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.84
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 99.4
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.06
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.84
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.58
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 97.87
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.46
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 97.24
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 96.97
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 96.94
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.68
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 96.46
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 96.05
d1okkd2207 GTPase domain of the signal recognition particle r 95.78
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 95.74
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 95.73
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.71
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 95.71
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.7
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 95.66
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 95.65
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 95.59
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 95.57
d2qy9a2211 GTPase domain of the signal recognition particle r 95.57
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 95.39
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.35
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 95.34
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.23
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.14
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 95.1
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.05
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.86
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 94.79
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.76
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.57
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 94.56
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.55
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 94.54
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.51
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.49
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.36
d1nrjb_209 Signal recognition particle receptor beta-subunit 94.32
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 94.32
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 94.26
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 94.24
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.04
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.01
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 93.95
d2fh5b1207 Signal recognition particle receptor beta-subunit 93.91
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 93.81
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 93.8
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.68
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.68
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 93.65
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.63
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.6
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 93.59
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.59
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 93.53
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 93.32
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.24
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.23
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.17
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.15
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 93.04
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 92.87
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 92.86
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.53
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 92.52
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 92.39
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 92.34
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 92.33
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 92.21
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 92.2
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 92.2
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 92.05
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 92.01
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 91.91
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.66
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 91.64
d1vmaa2213 GTPase domain of the signal recognition particle r 91.6
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 91.55
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 91.4
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 91.36
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 91.3
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 91.27
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 91.11
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 91.1
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.06
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 91.05
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 91.03
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 91.01
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 91.01
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 91.0
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 90.97
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 90.84
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 90.75
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 90.63
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 90.38
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.37
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 90.35
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 90.35
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 90.35
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 90.3
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 90.27
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 90.16
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 90.13
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 90.11
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 90.11
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 89.95
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 89.87
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 89.8
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 89.72
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 89.72
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 89.65
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 89.45
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 89.34
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 89.31
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 89.26
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 89.13
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 89.11
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 89.05
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 88.98
d1ls1a2207 GTPase domain of the signal sequence recognition p 88.92
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 88.9
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 88.84
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 88.84
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 88.83
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 88.82
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 88.81
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 88.81
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 88.78
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.64
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 88.63
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.58
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 88.49
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 88.4
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 88.34
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 88.33
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 88.3
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 87.97
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 87.95
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 87.94
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 87.79
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 87.7
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 87.59
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 87.57
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 87.46
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 87.36
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 87.34
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 87.07
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 87.0
d1j8yf2211 GTPase domain of the signal sequence recognition p 86.91
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 86.89
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 86.83
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 86.79
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 86.73
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 86.69
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 86.5
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 86.28
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 86.27
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 86.07
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 85.88
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 85.77
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 85.55
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 85.47
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 85.44
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 85.23
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 85.21
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 85.09
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 84.49
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 84.29
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 84.14
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 84.07
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 84.01
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 83.91
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 83.72
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 83.51
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 83.51
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 83.5
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 83.49
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 83.4
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 83.39
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 83.36
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 83.35
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 83.01
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 82.58
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 82.49
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 82.21
d1xpua3289 Transcription termination factor Rho, ATPase domai 82.15
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 82.14
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 81.93
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 81.81
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 81.74
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 81.54
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 81.45
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 81.08
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 80.94
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 80.11
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 80.02
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Maltose transport protein MalK, N-terminal domain
species: Archaeon Thermococcus litoralis [TaxId: 2265]

Probab=99.96  E-value=2.5e-30  Score=235.61  Aligned_cols=182  Identities=13%  Similarity=0.136  Sum_probs=148.3

Q ss_pred             CCCEEEEEEEEEECCCCCCCEEEECCEEEECCCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCEE-----------
Q ss_conf             761899955699266544310553014651669718999849998599999999829899988999714-----------
Q 003528            7 CCSTQLIDGDGTFNVSGIEHFIKEVKLSDCGLSYAVVSIMGPQSSGKSTLLNHLFGTNFREMDAFKGRS-----------   75 (813)
Q Consensus         7 ~~~Iqi~dl~~~y~~~~~~~~L~~isl~i~g~~geivaIlGpnGSGKSTLLn~L~Gl~~~~m~~~~Gr~-----------   75 (813)
                      |..|++.|+++.|+.   ..+++++||.+  .+|++++|+||||||||||+++|+|+..    |++|+.           
T Consensus         1 M~~i~v~nl~k~yg~---~~al~~vsl~i--~~Ge~~~liG~sGaGKSTll~~i~gl~~----p~sG~I~~~g~~i~~~~   71 (240)
T d1g2912           1 MAGVRLVDVWKVFGE---VTAVREMSLEV--KDGEFMILLGPSGCGKTTTLRMIAGLEE----PSRGQIYIGDKLVADPE   71 (240)
T ss_dssp             CEEEEEEEEEEEETT---EEEEEEEEEEE--ETTCEEEEECSTTSSHHHHHHHHHTSSC----CSEEEEEETTEEEEEGG
T ss_pred             CCCEEEEEEEEEECC---EEEECCEEEEE--CCCCEEEEECCCCCHHHHHHHHHHCCCC----CCCCEEEECCEEECCCC
T ss_conf             981899869999899---99985606688--6998999999999809999999964878----89898999999803566


Q ss_pred             --------EECCCEECCCCCC------CCCHHHHHHHHCCCCCCCCCCHHHH--------------------HHHHHHHH
Q ss_conf             --------2014335343347------7702578875189942325210799--------------------99999999
Q 003528           76 --------QTTKGIWMARCAG------IEPCTLIMDLEGTDGRERGEDDTAF--------------------EKQSALFA  121 (813)
Q Consensus        76 --------qtt~G~~~~~~~~------~e~~~~vld~~g~~~~er~e~~~~~--------------------EkQrv~iA  121 (813)
                              ....|.++|....      .++..+.+...+.+..++.+++.+.                    |+||++||
T Consensus        72 ~~~~~~~~~r~ig~v~Q~~~L~~~ltV~eni~~~~~~~~~~~~e~~~~v~~~l~~~~l~~~~~~~p~~LSGGqkQRv~IA  151 (240)
T d1g2912          72 KGIFVPPKDRDIAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRVREVAELLGLTELLNRKPRELSGGQRQRVALG  151 (240)
T ss_dssp             GTEECCGGGSSEEEECSCCCCCTTSCHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHTCGGGTTCCGGGSCHHHHHHHHHH
T ss_pred             HHHHCCCCCCCCEECCCCHHHCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHH
T ss_conf             44424532255120022122231011667633068772999899999999999875996676299334999999999999


Q ss_pred             HHHH---HHHHHCCCCCCCCCHHHCCHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCEEEECCCEEEEECCC
Q ss_conf             9987---5761026788989000018113999999999810699965999950699731235741335229938881385
Q 003528          122 LAVS---DIVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRKTTLMFVIRDKTRTPLENLEPVLREDIQKIWDSVPK  198 (813)
Q Consensus       122 ~ALa---dvLIlDEPt~~LD~~~~a~~~llk~V~e~l~~L~~~~~~tiLfVtHD~~~~~~~~~~~vll~~~GkI~~~gs~  198 (813)
                      +|++   ++||+||||++||+..      ...+.+.+.++.++.|.|+|+||||++++...+++.+++.+ |+|+..|++
T Consensus       152 raL~~~P~iLllDEPt~~LD~~~------~~~i~~~l~~l~~~~g~tvi~vTHd~~~~~~~~drv~vm~~-G~iv~~G~~  224 (240)
T d1g2912         152 RAIVRKPQVFLMDEPLSNLDAKL------RVRMRAELKKLQRQLGVTTIYVTHDQVEAMTMGDRIAVMNR-GVLQQVGSP  224 (240)
T ss_dssp             HHHHTCCSEEEEECTTTTSCHHH------HHHHHHHHHHHHHHHTCEEEEEESCHHHHHHHCSEEEEEET-TEEEEEECH
T ss_pred             HHHHCCCCEEEECCCCCCCCHHH------HHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHCCEEEEEEC-CEEEEECCH
T ss_conf             99826998898258876569899------98999999999863698899995999999996999999989-999998599


Q ss_pred             CCCCCC
Q ss_conf             342377
Q 003528          199 PQAHME  204 (813)
Q Consensus       199 ~e~~~~  204 (813)
                      .+++.+
T Consensus       225 ~el~~~  230 (240)
T d1g2912         225 DEVYDK  230 (240)
T ss_dssp             HHHHHS
T ss_pred             HHHHHC
T ss_conf             999828
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure