Citrus Sinensis ID: 003556


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-
MTTKRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDPLLKETKTLGRLSVSQNSEPAKESKVLSSTGSVPGTPQRVNLNMGSKTSVVNSTAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGRTMPFSLQSKATDSRKFQNSGDEVDQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQGVSVTERNSKEDIFTVSGKSGTMSMSESPASYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINWEKRGSSPNYDGPTSSISSGTVSTFKQRGYSSSAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQDVS
cccccccEEEEEEcccccEEEEEEEcccccEEEEEcccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEccccEEEEEcccccEEEccccccccEEEEEEccccccccEEEEEcccccEEEccccccccccccccccccEEEEEEccccccEEEccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccEEHHHHHHHHHccccEEEEHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccc
cccccccEEEEEEcccccEEEEEEccccccEEEEEEccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEcccccEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccccccccEEEcccccccEEEEcccccEEEEccccccccccccccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEcccccccEEEccccccccccccccccccEEcccccccccccccccccEcccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccc
MTTKRAYKLQEFVAHSSTvnclkigrkssrvlvtggedhkvnlwaigkpnailslsghtsgidsvsfdSSEVLVAAGAASGTIKLWDLEEAKIVRTLtghrsncisvdfhpfgeffasgsldtnlkiWDIRKKgcihtykghtrgvnairftpdgrwvvsggedntvklWDLTAgkllhdfkchegqiqcidfhphefllatgsadrtvkfwDLETFEligsagpetsgvrcltfnpdgrtLLCGLHEslkvfswepirchdavdvgwsrlsdlnvhegkllgcsynqscvgVWVVdisriepytigsvtrvnglseskssasgnlsvlnensakaslgklsvsqnsdplvketkslgrlsvsqnsdpllketktlgrlsvsqnsepakeskvlsstgsvpgtpqrvnlnmgsktSVVNSTAVVSKRtstrantasnvpilnksdivpvivprtntRFEQAVESRKDidvigrtmpfslqskatdsrkfqnsgdevdqpaVSVLCEntgskatevssvadrntfAAIKGSIQgvsvternskediftvsgksgtmsmsespasyederydslghksnrdgyamesqkrgRMHSLVINwekrgsspnydgptssissgtvstfkqrgysssaeketasvsdedatADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISastsvgvdieAEQRIERCNRCFIElekvkcclptlmrrggsvaKSAQELNLALQDVS
mttkrayklqefvahsstvnclkigrkSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAasgtiklwdLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIhtykghtrgvnairftpdgrwvvsggeDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELigsagpetsgvRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASlgklsvsqnsdpLVKEtkslgrlsvsqnsdpllketktlgrlsvsqnsepakeskvlsstgsvpgtpqrvnlnmgsktsvVNSTavvskrtstrantasnvpilnksdivpvivprtntrfeqavesrkdidvigrtmpfslqskatdsrkfqnsgdevdqpaVSVLCENTGskatevssvadrntfaaikgsiqgvsvternskediftvsgksgtmsmsespasYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINWEKrgsspnydgptssissgtvstFKQRGYSSSAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAisastsvgvdiEAEQRIERCNRCFIELEKVKCCLPTLMRrggsvaksaQELNLALQDVS
MTTKRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDPLLKETKTLGRLSVSQNSEPAKESKVLSSTGSVPGTPQRVNLNMGSKTSVVNSTAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGRTMPFSLQSKATDSRKFQNSGDEVDQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQGVSVTERNSKEDIFTVSGKSGTMSMSESPASYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINWEKRGSSPNYDGPTSSISSGTVSTFKQRGYSSSAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCllplltgllESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQDVS
******YKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRV*****************************************************************************************************************************VPILNKSDIVPVIVPRTNTRFEQAV*****IDVIG***************************************************FAAI**************************************************************************************************************************************LAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRR*******************
MTTKRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDP*LKETKTLGRLSVSQNSEPAK**KVLSSTG*****************************************************************************************************************************************************************************************************************************************************TADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVK******************ELNLALQD**
MTTKRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNG**********NLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDPLLKETKTLGRLS********************PGTPQRVNLNMGSKTSVVNSTAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGRTMPFSLQ***************VDQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQGVSVTERNSKEDIFTVS*****************ERYDSLGHKSNRDG*********RMHSLVINWEKRGSSPNYDGPTSSISSG*************************ATADVMEQ**********RLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQDVS
*****AYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDPLLKETKTLGRLSVSQNSEPAKESKVLSSTGSVPGTPQRVNLNMGSKTSVVNSTAVVSKRTSTRANTASNVP****SDIVP*********************************************************************************************************************************************************************************************VSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLAL*D**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTKRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDPLLKETKTLGRLSVSQNSEPAKESKVLSSTGSVPGTPQRVNLNMGSKTSVVNSTAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGRTMPFSLQSKATDSRKFQNSGDEVDQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQGVSVTERNSKEDIFTVSGKSGTMSMSESPASYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINWEKRGSSPNYDGPTSSISSGTVSTFKQRGYSSSAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQDVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query811 2.2.26 [Sep-21-2011]
Q8H0T9837 Katanin p80 WD40 repeat-c yes no 0.992 0.961 0.665 0.0
O61585690 Katanin p80 WD40 repeat-c yes no 0.430 0.505 0.551 1e-116
Q4V7Y7655 Katanin p80 WD40 repeat-c N/A no 0.572 0.708 0.398 1e-104
Q6NVM2655 Katanin p80 WD40 repeat-c yes no 0.546 0.676 0.403 1e-103
Q9BVA0655 Katanin p80 WD40 repeat-c yes no 0.542 0.671 0.404 1e-102
Q5ZIU8657 Katanin p80 WD40 repeat-c yes no 0.371 0.458 0.524 1e-102
Q7ZUV2694 Katanin p80 WD40 repeat-c yes no 0.387 0.452 0.518 1e-101
Q8BG40658 Katanin p80 WD40 repeat-c yes no 0.367 0.452 0.526 1e-101
Q8YRI11526 Uncharacterized WD repeat yes no 0.293 0.155 0.363 1e-40
Q8YTC21258 Uncharacterized WD repeat no no 0.265 0.170 0.351 1e-35
>sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 Back     alignment and function desciption
 Score = 1073 bits (2776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/842 (66%), Positives = 651/842 (77%), Gaps = 37/842 (4%)

Query: 1   MTTKRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTS 60
           MTTKRAYKLQEFVAHS+ VNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSL GH+S
Sbjct: 1   MTTKRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSS 60

Query: 61  GIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGS 120
           GIDSV+FD+SEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGS
Sbjct: 61  GIDSVTFDASEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGS 120

Query: 121 LDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHD 180
           LDTNLKIWDIRKKGCIHTYKGHTRGVN +RFTPDGRWVVSGGEDN VK+WDLTAGKLL +
Sbjct: 121 LDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAGKLLTE 180

Query: 181 FKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGR 240
           FK HEGQIQ +DFHPHEFLLATGSADRTVKFWDLETFELIGS GPET+GVRCL+FNPDG+
Sbjct: 181 FKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSFNPDGK 240

Query: 241 TLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISR 300
           T+LCGL ESLK+FSWEPIRCHD VDVGWSRLSD+NVHEGKLLGCSYNQSCVGVWVVD+SR
Sbjct: 241 TVLCGLQESLKIFSWEPIRCHDGVDVGWSRLSDMNVHEGKLLGCSYNQSCVGVWVVDLSR 300

Query: 301 IEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRL 360
            EP   G   + NG  E +S +  +  VLN+N++K  LGKLSVSQN DPL+KETKSLGRL
Sbjct: 301 TEPCMAGDTAQSNGHPEKRSCSGRDPVVLNDNNSKTVLGKLSVSQNVDPLLKETKSLGRL 360

Query: 361 SVSQNSDP-------------------LLKETKTLGRLSVSQNSEPAKESKVLSSTGSVP 401
           SVSQNSDP                    +KE+K LGRLSVSQNS+ +KES+  SSTGS+P
Sbjct: 361 SVSQNSDPSTKETKSIGRSSTSQNSESSMKESKPLGRLSVSQNSDVSKESRTFSSTGSLP 420

Query: 402 GTPQRV-NLNMGSKTSVVN---STAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNTR 457
           GTP RV + N+   TS V+   S A  S+R  T+AN  +N P+   +D  PVIVPR + R
Sbjct: 421 GTPHRVSSTNVSKATSGVSTAVSNAATSRRNFTKANPKAN-PVNKAADFAPVIVPRADPR 479

Query: 458 FEQAVESRKDIDVIGRTMPFSLQSKATDSRKFQNSGDEVDQPAVSVLCENTGSKATEVSS 517
            EQA ESR ++D+I RTMP+SLQ  A DSR+  +S +  D P  SVL E + S+  E ++
Sbjct: 480 IEQATESRAELDIIARTMPYSLQ--AADSRRSPSSRNNPDLPDASVL-EMSESQPVEPNN 536

Query: 518 VADRNTFAAIKGSIQGVSVTERNSKEDIFTVSGKSGTMSMSESPASYEDERYDSLGHKSN 577
           + D  T    K  ++G   TER+  +  +   G+S + S   SP    DE YD + H+SN
Sbjct: 537 IPDGGTLPGGKVGMRG--ATERSINDFRYKRYGRSNSRSRMGSPPRNHDENYDLVSHRSN 594

Query: 578 RDGYAMESQKRGRMHSLVINWEKRGSSPNYDGPTSSISSGTV--------STFKQRGYSS 629
           RD    ESQK GR  SLVIN E+RG   N++GP S+ SSG +        + FKQRG   
Sbjct: 595 RDPSPTESQKGGRFQSLVINRERRGRFSNFEGPVSNFSSGNMPAPNIRPSNMFKQRGNHM 654

Query: 630 SAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMAD 689
             E+   S S+E+   D+M +H+QFVSSMQSRLAKLQ V RYWERNDVK +I +++KMAD
Sbjct: 655 PVEQGIDSPSEENIVEDIMGKHNQFVSSMQSRLAKLQVVRRYWERNDVKNSIGSIEKMAD 714

Query: 690 HTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMI 749
           + V ADV+ I+ E+ EI+TLD C+ LLPLLT LL S MD+HLS+SLD+LLKLVR +GS I
Sbjct: 715 NAVTADVLGIITERNEILTLDNCTSLLPLLTALLGSGMDQHLSVSLDLLLKLVRLYGSPI 774

Query: 750 YSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQD 809
           YS++SA  SVGVDIEAEQRIER +RCF+ELEKVK CLP+L RRGG VAKS  ELNLA Q+
Sbjct: 775 YSSLSAPASVGVDIEAEQRIERYSRCFVELEKVKACLPSLARRGGLVAKSVLELNLAFQE 834

Query: 810 VS 811
           VS
Sbjct: 835 VS 836




May participate in a complex which severs microtubules in an ATP-dependent manner. This activity may promote rapid reorganization of cellular microtubule arrays.
Arabidopsis thaliana (taxid: 3702)
>sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 Back     alignment and function description
>sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 Back     alignment and function description
>sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 Back     alignment and function description
>sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 Back     alignment and function description
>sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 Back     alignment and function description
>sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 Back     alignment and function description
>sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 Back     alignment and function description
>sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=4 SV=1 Back     alignment and function description
>sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query811
255545317803 katanin P80 subunit, putative [Ricinus c 0.967 0.977 0.756 0.0
224100461802 predicted protein [Populus trichocarpa] 0.974 0.985 0.744 0.0
359484098800 PREDICTED: katanin p80 WD40 repeat-conta 0.975 0.988 0.745 0.0
449458795795 PREDICTED: katanin p80 WD40 repeat-conta 0.963 0.982 0.710 0.0
356573375758 PREDICTED: katanin p80 WD40 repeat-conta 0.921 0.985 0.692 0.0
30688988837 Katanin p80 WD40 repeat-containing subun 0.992 0.961 0.665 0.0
297812493837 transducin family protein [Arabidopsis l 0.992 0.961 0.667 0.0
224113211728 predicted protein [Populus trichocarpa] 0.864 0.962 0.673 0.0
30688991836 Katanin p80 WD40 repeat-containing subun 0.991 0.961 0.663 0.0
145357786839 katanin p80 subunit-like protein [Arabid 0.995 0.961 0.638 0.0
>gi|255545317|ref|XP_002513719.1| katanin P80 subunit, putative [Ricinus communis] gi|223547170|gb|EEF48666.1| katanin P80 subunit, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1247 bits (3226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/812 (75%), Positives = 684/812 (84%), Gaps = 27/812 (3%)

Query: 10  QEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDS 69
           +EFVAHSS+VNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDS
Sbjct: 5   KEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDS 64

Query: 70  SEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWD 129
           SEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWD
Sbjct: 65  SEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWD 124

Query: 130 IRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQ 189
           IRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFK HEGQ+Q
Sbjct: 125 IRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKSHEGQVQ 184

Query: 190 CIDFHPHEFLLATG-SADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHE 248
           CIDFHPHEFLLATG SADRTVKFWDLETFELIGSAGPET+GVRCLTFNPDGRTLLCGLHE
Sbjct: 185 CIDFHPHEFLLATGDSADRTVKFWDLETFELIGSAGPETTGVRCLTFNPDGRTLLCGLHE 244

Query: 249 SLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGS 308
           +LKVFSWEP+RCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPY+  +
Sbjct: 245 NLKVFSWEPLRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYSPSN 304

Query: 309 VTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDP 368
           V R+NG SESKS  S N SVL +++AK SLG+LS +QNS+ LVKETKS GRLSVSQN+DP
Sbjct: 305 VNRLNGYSESKSGISANQSVLLDSTAKTSLGRLSAAQNSEILVKETKSFGRLSVSQNTDP 364

Query: 369 LLKETKTLGRLSVSQNSEPAKESKVLSSTGSVPGTPQRVNLNMGSKTSV---VNSTAVVS 425
           +                E  KESK+L+STG+VPGTPQRVN N   KT++   +       
Sbjct: 365 V---------------KESTKESKILASTGNVPGTPQRVNFNTALKTTLSGPITVNVAAP 409

Query: 426 KRTSTRANTASNVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGRTMPFSLQSKATD 485
           KRTST+  +A NVP+LNK+D++PVIVPRTNTR +   E RK+I + GRTMPFSLQSKA D
Sbjct: 410 KRTSTKVQSAVNVPVLNKADVIPVIVPRTNTRPDPVAEPRKEIGIAGRTMPFSLQSKACD 469

Query: 486 SRKFQNSGDEVDQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQGVSVTERNSKEDI 545
            RKF NS D++DQP +S+  + T SK+  +S+V DRN F+ +KGSI+ +S  +RN KED 
Sbjct: 470 YRKFTNSRDDMDQPTISIPSDTTSSKSMALSNVGDRNIFSTVKGSIREISTADRNIKEDR 529

Query: 546 FTVSGKSGTMSMSESPASYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINWEKRGSSP 605
              SGK  +  ++E P SY++E Y++ GHK NRD  ++E QK GRM SLVINWEKRG SP
Sbjct: 530 PVGSGKQDSSLIAEPPVSYQEENYETRGHKLNRDATSLEGQKAGRMRSLVINWEKRGRSP 589

Query: 606 NYDGPTSSISSGTVST--------FKQRGYSSSAEKETASVSDEDATADVMEQHSQFVSS 657
           NY+GP S  S  T S+         KQRG S + EKE  S SDEDA ADVMEQH QFVSS
Sbjct: 590 NYEGPISGSSPETASSVNMLSFNMLKQRGCSPTTEKEMVSASDEDAIADVMEQHDQFVSS 649

Query: 658 MQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLP 717
           MQSR  KLQAV+R+WERNDVKGAISAM+KMADH VLADV+S++ EKI+IVTLD+C+CLLP
Sbjct: 650 MQSRFGKLQAVHRFWERNDVKGAISAMEKMADHGVLADVISVINEKIDIVTLDVCTCLLP 709

Query: 718 LLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFI 777
           LL GLLESDMDRHLSISLD+LLKLVRTFGSMIYS +SAST VGVDIEAEQR+ERCN CF+
Sbjct: 710 LLAGLLESDMDRHLSISLDVLLKLVRTFGSMIYSTVSASTPVGVDIEAEQRLERCNLCFV 769

Query: 778 ELEKVKCCLPTLMRRGGSVAKSAQELNLALQD 809
           ELEKVK CLPTLMRRGGSVAK  QELNLALQD
Sbjct: 770 ELEKVKRCLPTLMRRGGSVAKITQELNLALQD 801




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224100461|ref|XP_002311885.1| predicted protein [Populus trichocarpa] gi|222851705|gb|EEE89252.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359484098|ref|XP_002268907.2| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449458795|ref|XP_004147132.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Cucumis sativus] gi|449524677|ref|XP_004169348.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|356573375|ref|XP_003554837.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 1-like [Glycine max] Back     alignment and taxonomy information
>gi|30688988|ref|NP_851064.1| Katanin p80 WD40 repeat-containing subunit B1-1 [Arabidopsis thaliana] gi|73620972|sp|Q8H0T9.3|KTNB1_ARATH RecName: Full=Katanin p80 WD40 repeat-containing subunit B1 homolog gi|25083345|gb|AAN72064.1| putative protein [Arabidopsis thaliana] gi|332005783|gb|AED93166.1| Katanin p80 WD40 repeat-containing subunit B1-1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297812493|ref|XP_002874130.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] gi|297319967|gb|EFH50389.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224113211|ref|XP_002316424.1| predicted protein [Populus trichocarpa] gi|222865464|gb|EEF02595.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|30688991|ref|NP_197734.2| Katanin p80 WD40 repeat-containing subunit B1-1 [Arabidopsis thaliana] gi|332005784|gb|AED93167.1| Katanin p80 WD40 repeat-containing subunit B1-1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|145357786|ref|NP_568194.2| katanin p80 subunit-like protein [Arabidopsis thaliana] gi|332003911|gb|AED91294.1| katanin p80 subunit-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query811
TAIR|locus:2154438837 AT5G23430 "AT5G23430" [Arabido 0.784 0.759 0.589 4.5e-185
TAIR|locus:2150788839 AT5G08390 "AT5G08390" [Arabido 0.776 0.750 0.558 2.2e-176
TAIR|locus:2202129 1021 AT1G11160 "AT1G11160" [Arabido 0.765 0.608 0.428 1.3e-169
UNIPROTKB|Q5ZIU8657 KATNB1 "Katanin p80 WD40 repea 0.487 0.601 0.450 5.5e-113
MGI|MGI:1921437658 Katnb1 "katanin p80 (WD40-cont 0.594 0.732 0.403 1.4e-112
RGD|1311256655 Katnb1 "katanin p80 (WD repeat 0.483 0.598 0.448 1.8e-112
ZFIN|ZDB-GENE-040426-1954694 katnb1 "katanin p80 (WD repeat 0.673 0.786 0.376 7.9e-112
UNIPROTKB|E2QTQ5655 KATNB1 "Uncharacterized protei 0.482 0.596 0.452 2.1e-111
UNIPROTKB|F1P0F4661 KATNB1 "Katanin p80 WD40 repea 0.487 0.597 0.444 3.4e-109
UNIPROTKB|E3W9A3661 KATNB1 "Katanin p80 WD40 repea 0.487 0.597 0.440 5.6e-109
TAIR|locus:2154438 AT5G23430 "AT5G23430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1795 (636.9 bits), Expect = 4.5e-185, P = 4.5e-185
 Identities = 392/665 (58%), Positives = 455/665 (68%)

Query:     1 MTTKRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTS 60
             MTTKRAYKLQEFVAHS+ VNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSL GH+S
Sbjct:     1 MTTKRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSS 60

Query:    61 GIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGS 120
             GIDSV+FD+SEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGS
Sbjct:    61 GIDSVTFDASEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGS 120

Query:   121 LDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHD 180
             LDTNLKIWDIRKKGCIHTYKGHTRGVN +RFTPDGRWVVSGGEDN VK+WDLTAGKLL +
Sbjct:   121 LDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAGKLLTE 180

Query:   181 FKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGR 240
             FK HEGQIQ +DFHPHEFLLATGSADRTVKFWDLETFELIGS GPET+GVRCL+FNPDG+
Sbjct:   181 FKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSFNPDGK 240

Query:   241 TLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISR 300
             T+LCGL ESLK+FSWEPIRCHD VDVGWSRLSD+NVHEGKLLGCSYNQSCVGVWVVD+SR
Sbjct:   241 TVLCGLQESLKIFSWEPIRCHDGVDVGWSRLSDMNVHEGKLLGCSYNQSCVGVWVVDLSR 300

Query:   301 IEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRL 360
              EP   G   + NG  E +S +  +  VLN+N++K  LGKLSVSQN DPL+KETKSLGRL
Sbjct:   301 TEPCMAGDTAQSNGHPEKRSCSGRDPVVLNDNNSKTVLGKLSVSQNVDPLLKETKSLGRL 360

Query:   361 SVSQNSDPLLKETKTLGRLSVSQNSEPA-KESKVLS----STGSVPGTPQRVNLNMGSKT 415
             SVSQNSDP  KETK++GR S SQNSE + KESK L     S  S      R   + GS  
Sbjct:   361 SVSQNSDPSTKETKSIGRSSTSQNSESSMKESKPLGRLSVSQNSDVSKESRTFSSTGSLP 420

Query:   416 SVVN--STAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGR 473
                +  S+  VSK TS  +   SN     ++       P+ N    +A +    I  + R
Sbjct:   421 GTPHRVSSTNVSKATSGVSTAVSNAATSRRN--FTKANPKANP-VNKAADFAPVI--VPR 475

Query:   474 TMPFSLQSKATDSRKFQNSGDEVDQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQG 533
               P   Q  AT+SR       E+D   ++     +   A    S + RN       S+  
Sbjct:   476 ADPRIEQ--ATESRA------ELD--IIARTMPYSLQAADSRRSPSSRNNPDLPDASVLE 525

Query:   534 VSVT---ERNSKEDIFTV-SGKSGTMSMSESPASYEDERYDSLGHKSNRDGYAMESQKRG 589
             +S +   E N+  D  T+  GK G    +E   S  D RY   G  ++R       +   
Sbjct:   526 MSESQPVEPNNIPDGGTLPGGKVGMRGATER--SINDFRYKRYGRSNSRSRMGSPPRNHD 583

Query:   590 RMHSLVINWEKRGSSPNYDGPTSSISSGTVSTFKQRGYSSSAEKETASVSDEDATADVME 649
               + LV +   R  SP          S  ++  ++RG  S+ E   ++ S  +  A  + 
Sbjct:   584 ENYDLVSHRSNRDPSPTESQKGGRFQSLVINR-ERRGRFSNFEGPVSNFSSGNMPAPNIR 642

Query:   650 QHSQF 654
               + F
Sbjct:   643 PSNMF 647


GO:0000166 "nucleotide binding" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2150788 AT5G08390 "AT5G08390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202129 AT1G11160 "AT1G11160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZIU8 KATNB1 "Katanin p80 WD40 repeat-containing subunit B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1921437 Katnb1 "katanin p80 (WD40-containing) subunit B 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311256 Katnb1 "katanin p80 (WD repeat containing) subunit B 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1954 katnb1 "katanin p80 (WD repeat containing) subunit B 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2QTQ5 KATNB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0F4 KATNB1 "Katanin p80 WD40 repeat-containing subunit B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E3W9A3 KATNB1 "Katanin p80 WD40 repeat-containing subunit B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8H0T9KTNB1_ARATHNo assigned EC number0.66500.99260.9617yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pm.C_LG_VIII000002
hypothetical protein (802 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query811
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 6e-64
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-60
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-58
pfam13925164 pfam13925, Katanin_con80, con80 domain of Katanin 8e-57
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-32
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 7e-32
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-28
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-26
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-12
smart0032040 smart00320, WD40, WD40 repeats 1e-10
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 2e-10
PLN00181793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 3e-09
smart0032040 smart00320, WD40, WD40 repeats 6e-09
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 7e-09
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-08
PTZ00421493 PTZ00421, PTZ00421, coronin; Provisional 9e-08
smart0032040 smart00320, WD40, WD40 repeats 2e-07
PTZ00420568 PTZ00420, PTZ00420, coronin; Provisional 9e-07
PLN00181793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 1e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 9e-05
PTZ00421493 PTZ00421, PTZ00421, coronin; Provisional 1e-04
pfam08662194 pfam08662, eIF2A, Eukaryotic translation initiatio 1e-04
smart0032040 smart00320, WD40, WD40 repeats 3e-04
PTZ00420568 PTZ00420, PTZ00420, coronin; Provisional 3e-04
PLN00181793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 0.002
pfam06070777 pfam06070, Herpes_UL32, Herpesvirus large structur 0.004
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score =  215 bits (550), Expect = 6e-64
 Identities = 87/254 (34%), Positives = 136/254 (53%), Gaps = 2/254 (0%)

Query: 9   LQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFD 68
            +    H+  V C+       ++L TG  D  + +W +     + +L GHT  +  V+  
Sbjct: 2   RRTLKGHTGGVTCVAFSP-DGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAAS 60

Query: 69  SSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIW 128
           +    +A+G++  TI+LWDLE  + VRTLTGH S   SV F P G   +S S D  +K+W
Sbjct: 61  ADGTYLASGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVW 120

Query: 129 DIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQI 188
           D+    C+ T +GHT  VN++ F+PDG +V S  +D T+KLWDL  GK +     H G++
Sbjct: 121 DVETGKCLTTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLRTGKCVATLTGHTGEV 180

Query: 189 QCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHE 248
             + F P    L + S+D T+K WDL T + +G+     +GV  + F+PDG  L  G  +
Sbjct: 181 NSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLRGHENGVNSVAFSPDGYLLASGSED 240

Query: 249 -SLKVFSWEPIRCH 261
            +++V+      C 
Sbjct: 241 GTIRVWDLRTGECV 254


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|222456 pfam13925, Katanin_con80, con80 domain of Katanin Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|149648 pfam08662, eIF2A, Eukaryotic translation initiation factor eIF2A Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information
>gnl|CDD|218881 pfam06070, Herpes_UL32, Herpesvirus large structural phosphoprotein UL32 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 811
KOG0267825 consensus Microtubule severing protein katanin p80 100.0
PF13925164 Katanin_con80: con80 domain of Katanin 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0282503 consensus mRNA splicing factor [Function unknown] 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.98
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.98
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.98
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0315311 consensus G-protein beta subunit-like protein (con 99.97
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0296399 consensus Angio-associated migratory cell protein 99.97
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.97
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.97
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.97
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.97
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.97
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.97
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.97
KOG0266456 consensus WD40 repeat-containing protein [General 99.97
KOG0295406 consensus WD40 repeat-containing protein [Function 99.97
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.96
KOG0643327 consensus Translation initiation factor 3, subunit 99.96
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.96
KOG0293519 consensus WD40 repeat-containing protein [Function 99.96
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.96
KOG0283712 consensus WD40 repeat-containing protein [Function 99.96
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.96
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.95
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.95
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.95
KOG0296399 consensus Angio-associated migratory cell protein 99.95
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.95
PLN00181793 protein SPA1-RELATED; Provisional 99.95
KOG0289506 consensus mRNA splicing factor [General function p 99.95
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.95
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.95
KOG0645312 consensus WD40 repeat protein [General function pr 99.95
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.95
PTZ00421493 coronin; Provisional 99.95
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.95
KOG0283712 consensus WD40 repeat-containing protein [Function 99.95
PTZ00421493 coronin; Provisional 99.95
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.94
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.94
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.94
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.94
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.94
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.94
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.94
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.94
KOG0267825 consensus Microtubule severing protein katanin p80 99.94
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.94
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.94
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.94
PTZ00420568 coronin; Provisional 99.94
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.93
PTZ00420568 coronin; Provisional 99.93
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.93
KOG0772641 consensus Uncharacterized conserved protein, conta 99.93
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.93
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.93
KOG0300481 consensus WD40 repeat-containing protein [Function 99.93
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.93
KOG0301745 consensus Phospholipase A2-activating protein (con 99.93
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.93
KOG0643327 consensus Translation initiation factor 3, subunit 99.92
KOG0289506 consensus mRNA splicing factor [General function p 99.92
KOG0294362 consensus WD40 repeat-containing protein [Function 99.92
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.92
KOG0294362 consensus WD40 repeat-containing protein [Function 99.92
KOG0293519 consensus WD40 repeat-containing protein [Function 99.92
KOG0641350 consensus WD40 repeat protein [General function pr 99.92
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.92
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.92
KOG0639705 consensus Transducin-like enhancer of split protei 99.92
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.92
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.91
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.91
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.91
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.91
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.9
KOG0641350 consensus WD40 repeat protein [General function pr 99.9
KOG0301745 consensus Phospholipase A2-activating protein (con 99.9
KOG2055514 consensus WD40 repeat protein [General function pr 99.9
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.9
KOG1539910 consensus WD repeat protein [General function pred 99.9
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.9
KOG2096420 consensus WD40 repeat protein [General function pr 99.89
KOG1274 933 consensus WD40 repeat protein [General function pr 99.89
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.89
KOG1273405 consensus WD40 repeat protein [General function pr 99.89
KOG0646476 consensus WD40 repeat protein [General function pr 99.89
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.88
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.88
KOG2048691 consensus WD40 repeat protein [General function pr 99.88
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.88
KOG4283397 consensus Transcription-coupled repair protein CSA 99.88
KOG0300481 consensus WD40 repeat-containing protein [Function 99.88
KOG2106626 consensus Uncharacterized conserved protein, conta 99.87
KOG0269839 consensus WD40 repeat-containing protein [Function 99.87
KOG0772641 consensus Uncharacterized conserved protein, conta 99.87
KOG0302440 consensus Ribosome Assembly protein [General funct 99.87
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.86
KOG0646476 consensus WD40 repeat protein [General function pr 99.86
KOG0269839 consensus WD40 repeat-containing protein [Function 99.86
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.86
KOG0639705 consensus Transducin-like enhancer of split protei 99.86
KOG1274 933 consensus WD40 repeat protein [General function pr 99.85
KOG2106626 consensus Uncharacterized conserved protein, conta 99.85
KOG1539910 consensus WD repeat protein [General function pred 99.85
KOG4328498 consensus WD40 protein [Function unknown] 99.84
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.84
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.84
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.84
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.84
KOG4283397 consensus Transcription-coupled repair protein CSA 99.83
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.83
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.83
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.83
COG2319466 FOG: WD40 repeat [General function prediction only 99.83
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.83
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.82
KOG0270463 consensus WD40 repeat-containing protein [Function 99.82
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.82
KOG2055514 consensus WD40 repeat protein [General function pr 99.81
KOG0302440 consensus Ribosome Assembly protein [General funct 99.81
COG2319466 FOG: WD40 repeat [General function prediction only 99.81
KOG1273405 consensus WD40 repeat protein [General function pr 99.8
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.8
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.79
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.79
KOG2048691 consensus WD40 repeat protein [General function pr 99.79
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.79
KOG0270463 consensus WD40 repeat-containing protein [Function 99.79
KOG4328498 consensus WD40 protein [Function unknown] 99.78
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.77
KOG2096420 consensus WD40 repeat protein [General function pr 99.77
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.77
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.77
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.77
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.77
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.75
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.75
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.75
PRK11028330 6-phosphogluconolactonase; Provisional 99.73
KOG0303472 consensus Actin-binding protein Coronin, contains 99.73
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.73
KOG2110391 consensus Uncharacterized conserved protein, conta 99.72
KOG1188376 consensus WD40 repeat protein [General function pr 99.72
KOG4227609 consensus WD40 repeat protein [General function pr 99.72
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.71
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.71
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.71
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.71
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.69
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.69
KOG0303472 consensus Actin-binding protein Coronin, contains 99.67
KOG0649325 consensus WD40 repeat protein [General function pr 99.67
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.67
KOG1963792 consensus WD40 repeat protein [General function pr 99.67
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.67
KOG0649325 consensus WD40 repeat protein [General function pr 99.66
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.66
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.66
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.66
PRK11028330 6-phosphogluconolactonase; Provisional 99.66
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.65
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.64
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.63
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.62
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.61
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.61
PRK01742429 tolB translocation protein TolB; Provisional 99.61
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.61
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.6
KOG1188376 consensus WD40 repeat protein [General function pr 99.6
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.6
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.59
PRK01742429 tolB translocation protein TolB; Provisional 99.59
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.57
KOG1963792 consensus WD40 repeat protein [General function pr 99.56
KOG1310758 consensus WD40 repeat protein [General function pr 99.56
KOG0771398 consensus Prolactin regulatory element-binding pro 99.55
KOG0771398 consensus Prolactin regulatory element-binding pro 99.55
KOG2139445 consensus WD40 repeat protein [General function pr 99.55
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.54
KOG2111346 consensus Uncharacterized conserved protein, conta 99.54
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.54
KOG1334559 consensus WD40 repeat protein [General function pr 99.54
KOG2110391 consensus Uncharacterized conserved protein, conta 99.54
KOG4227609 consensus WD40 repeat protein [General function pr 99.54
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.53
PRK03629429 tolB translocation protein TolB; Provisional 99.51
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.5
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.5
PRK05137435 tolB translocation protein TolB; Provisional 99.5
KOG1310758 consensus WD40 repeat protein [General function pr 99.5
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.48
KOG2321703 consensus WD40 repeat protein [General function pr 99.48
PRK03629429 tolB translocation protein TolB; Provisional 99.47
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.47
PRK04922433 tolB translocation protein TolB; Provisional 99.47
KOG2111346 consensus Uncharacterized conserved protein, conta 99.46
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.46
PRK04922433 tolB translocation protein TolB; Provisional 99.46
PRK02889427 tolB translocation protein TolB; Provisional 99.45
PRK02889427 tolB translocation protein TolB; Provisional 99.44
PRK05137435 tolB translocation protein TolB; Provisional 99.44
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.43
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.42
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.41
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.4
KOG2139445 consensus WD40 repeat protein [General function pr 99.39
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.39
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.39
KOG1334559 consensus WD40 repeat protein [General function pr 99.38
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.37
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.36
PRK00178430 tolB translocation protein TolB; Provisional 99.33
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.33
PRK00178430 tolB translocation protein TolB; Provisional 99.31
KOG4547541 consensus WD40 repeat-containing protein [General 99.29
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.29
PRK01029428 tolB translocation protein TolB; Provisional 99.28
KOG2315566 consensus Predicted translation initiation factor 99.28
PRK04792448 tolB translocation protein TolB; Provisional 99.27
PRK01029428 tolB translocation protein TolB; Provisional 99.24
PRK04792448 tolB translocation protein TolB; Provisional 99.24
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 99.22
KOG4547541 consensus WD40 repeat-containing protein [General 99.21
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.2
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.19
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.18
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.18
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.18
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.18
KOG2315566 consensus Predicted translation initiation factor 99.16
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.15
KOG2321703 consensus WD40 repeat protein [General function pr 99.15
KOG41901034 consensus Uncharacterized conserved protein [Funct 99.14
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.1
KOG1409404 consensus Uncharacterized conserved protein, conta 99.1
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.08
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.08
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.05
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.05
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.02
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.99
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.98
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.98
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.97
PRK04043419 tolB translocation protein TolB; Provisional 98.96
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.96
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.96
KOG2314698 consensus Translation initiation factor 3, subunit 98.94
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.93
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.93
KOG2314698 consensus Translation initiation factor 3, subunit 98.92
COG4946668 Uncharacterized protein related to the periplasmic 98.9
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.89
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.88
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.88
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.88
PRK04043419 tolB translocation protein TolB; Provisional 98.88
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.86
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.83
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.83
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.8
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.79
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.79
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.79
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.76
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.75
KOG1409404 consensus Uncharacterized conserved protein, conta 98.75
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.74
COG4946668 Uncharacterized protein related to the periplasmic 98.72
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.71
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.69
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.64
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.64
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.62
KOG2695425 consensus WD40 repeat protein [General function pr 98.61
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.6
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.6
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.55
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.55
KOG2695425 consensus WD40 repeat protein [General function pr 98.52
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 98.5
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.49
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.48
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.47
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.47
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 98.46
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.42
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.4
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.38
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.36
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.32
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 98.3
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 98.29
PRK02888635 nitrous-oxide reductase; Validated 98.28
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.27
PRK02888635 nitrous-oxide reductase; Validated 98.17
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.13
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.12
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.11
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.09
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.08
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.06
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.01
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 98.0
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.98
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.93
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.92
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.92
COG3391381 Uncharacterized conserved protein [Function unknow 97.9
COG3391381 Uncharacterized conserved protein [Function unknow 97.9
KOG1008783 consensus Uncharacterized conserved protein, conta 97.89
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.87
KOG3621726 consensus WD40 repeat-containing protein [General 97.86
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.84
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.83
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.81
KOG3621726 consensus WD40 repeat-containing protein [General 97.81
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.81
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.8
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.79
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.79
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.78
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.72
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.72
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.7
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.66
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.56
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.53
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.48
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.42
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.41
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.4
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.38
KOG1008783 consensus Uncharacterized conserved protein, conta 97.38
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.38
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.34
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.31
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.21
KOG2395644 consensus Protein involved in vacuole import and d 97.11
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.11
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 97.1
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.08
KOG2395644 consensus Protein involved in vacuole import and d 97.04
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 97.0
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.97
PRK13616591 lipoprotein LpqB; Provisional 96.95
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 96.94
PRK13616591 lipoprotein LpqB; Provisional 96.89
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.78
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.72
PHA02713557 hypothetical protein; Provisional 96.71
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 96.68
PHA02713557 hypothetical protein; Provisional 96.64
COG3490366 Uncharacterized protein conserved in bacteria [Fun 96.63
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.6
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.59
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.57
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 96.55
COG3490366 Uncharacterized protein conserved in bacteria [Fun 96.46
PRK13684334 Ycf48-like protein; Provisional 96.42
KOG2444238 consensus WD40 repeat protein [General function pr 96.42
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.41
PF15390671 DUF4613: Domain of unknown function (DUF4613) 96.38
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.36
PRK10115686 protease 2; Provisional 96.33
PRK10115686 protease 2; Provisional 96.31
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.29
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 96.29
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 96.09
PHA03098534 kelch-like protein; Provisional 95.99
KOG18971096 consensus Damage-specific DNA binding complex, sub 95.88
PRK13684334 Ycf48-like protein; Provisional 95.83
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 95.77
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 95.67
KOG18971096 consensus Damage-specific DNA binding complex, sub 95.59
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 95.55
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 95.53
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 95.42
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 95.4
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.32
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 95.25
PHA02790480 Kelch-like protein; Provisional 95.24
PHA03098534 kelch-like protein; Provisional 95.23
KOG2444238 consensus WD40 repeat protein [General function pr 95.19
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 95.03
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 95.0
PF15390671 DUF4613: Domain of unknown function (DUF4613) 94.87
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 94.71
PF14727418 PHTB1_N: PTHB1 N-terminus 94.63
PLN00033398 photosystem II stability/assembly factor; Provisio 94.55
smart00036302 CNH Domain found in NIK1-like kinases, mouse citro 94.41
PHA02790480 Kelch-like protein; Provisional 93.99
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 93.89
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 93.62
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 93.58
COG5276370 Uncharacterized conserved protein [Function unknow 93.56
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 93.43
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 93.36
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 93.31
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 93.28
COG5167776 VID27 Protein involved in vacuole import and degra 93.05
COG1520370 FOG: WD40-like repeat [Function unknown] 93.05
COG1520370 FOG: WD40-like repeat [Function unknown] 93.02
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 92.9
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 92.83
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 92.8
COG5167776 VID27 Protein involved in vacuole import and degra 92.29
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 92.23
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 91.67
PLN00033398 photosystem II stability/assembly factor; Provisio 91.63
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 91.6
COG3823262 Glutamine cyclotransferase [Posttranslational modi 90.95
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 90.8
COG3823262 Glutamine cyclotransferase [Posttranslational modi 90.79
COG3292671 Predicted periplasmic ligand-binding sensor domain 90.69
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 90.32
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 89.86
PLN02193470 nitrile-specifier protein 89.84
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 89.61
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 89.59
PLN02153341 epithiospecifier protein 89.59
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 89.33
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 88.77
COG4590733 ABC-type uncharacterized transport system, permeas 88.75
PF14727418 PHTB1_N: PTHB1 N-terminus 88.72
KOG1983 993 consensus Tomosyn and related SNARE-interacting pr 88.35
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 88.31
PF13449326 Phytase-like: Esterase-like activity of phytase 88.29
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 88.12
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 87.27
PF08801422 Nucleoporin_N: Nup133 N terminal like; InterPro: I 87.16
KOG2247615 consensus WD40 repeat-containing protein [General 86.99
PF13449326 Phytase-like: Esterase-like activity of phytase 86.91
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 86.81
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 86.31
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 86.25
PF10395670 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an 86.22
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 86.07
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 85.94
KOG1983 993 consensus Tomosyn and related SNARE-interacting pr 85.9
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 85.67
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 85.12
KOG2247615 consensus WD40 repeat-containing protein [General 85.07
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 84.87
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 84.69
PLN02153341 epithiospecifier protein 84.53
COG5276370 Uncharacterized conserved protein [Function unknow 84.29
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 84.09
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 84.06
PF10433504 MMS1_N: Mono-functional DNA-alkylating methyl meth 83.97
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 83.65
KOG18981205 consensus Splicing factor 3b, subunit 3 [RNA proce 83.06
PF10433504 MMS1_N: Mono-functional DNA-alkylating methyl meth 82.94
PRK05560805 DNA gyrase subunit A; Validated 82.17
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 81.73
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 81.36
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 81.28
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 81.02
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 80.76
KOG2377657 consensus Uncharacterized conserved protein [Funct 80.26
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
Probab=100.00  E-value=2.9e-85  Score=720.96  Aligned_cols=767  Identities=47%  Similarity=0.668  Sum_probs=579.1

Q ss_pred             CCcccceeE-----EEEecCCCCEEEEEEeeCCCcEEEEEECCCeEEEEECCCCceEEEecCCCCCeEEEEEcCCCCEEE
Q 003556            1 MTTKRAYKL-----QEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVA   75 (811)
Q Consensus         1 ms~kr~~ki-----~~~~~H~~~V~~lafsp~~~~lLatgs~Dg~I~VWdl~t~~~~~~l~~h~~~V~~l~fspdg~~La   75 (811)
                      |.+++.+++     +++.+|...|.|+.. ....+.+++|+.|..+.+|.+.....+..+.+|..+|.++.|++.+.+|+
T Consensus         8 m~~~~~t~Lr~~~~~~~~~hsaav~~lk~-~~s~r~~~~Gg~~~k~~L~~i~kp~~i~S~~~hespIeSl~f~~~E~Lla   86 (825)
T KOG0267|consen    8 MKTKRATKLRVWDTREFVAHSAAVGCLKI-RKSSRSLVTGGEDEKVNLWAIGKPNAITSLTGHESPIESLTFDTSERLLA   86 (825)
T ss_pred             ceeeeeeccccccchhhhhhhhhhceeee-eccceeeccCCCceeeccccccCCchhheeeccCCcceeeecCcchhhhc
Confidence            678888888     699999999999999 45889999999999999999999999999999999999999999999999


Q ss_pred             EEECCCeEEEEECCCCeEEEEEcCCCCCeEEEEEeCCCCEEEEEECCCcEEEEECCCCeEEEEEecCCCCeEEEEEcCCC
Q 003556           76 AGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDG  155 (811)
Q Consensus        76 sgs~DG~I~IWDl~t~~~v~~l~~h~~~I~sl~fspdg~~Lasgs~Dg~I~IwDl~~~~~i~~~~~h~~~I~si~fspdg  155 (811)
                      +|+.+|+|++||++.++.++++.+|...+..+.|+|.+.|++.|+.|+.+++||++...|.+.+++|...+.+++|+|+|
T Consensus        87 agsasgtiK~wDleeAk~vrtLtgh~~~~~sv~f~P~~~~~a~gStdtd~~iwD~Rk~Gc~~~~~s~~~vv~~l~lsP~G  166 (825)
T KOG0267|consen   87 AGSASGTIKVWDLEEAKIVRTLTGHLLNITSVDFHPYGEFFASGSTDTDLKIWDIRKKGCSHTYKSHTRVVDVLRLSPDG  166 (825)
T ss_pred             ccccCCceeeeehhhhhhhhhhhccccCcceeeeccceEEeccccccccceehhhhccCceeeecCCcceeEEEeecCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CEEEEEECCCeEEEEECCCCeEEEEEecCCCCeEEEEEeCCCCEEEEEECCCeEEEEECCCCeEEEEeCCCCCCeeEEEE
Q 003556          156 RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTF  235 (811)
Q Consensus       156 ~~L~sgs~Dg~I~IwDl~t~~~i~~~~~h~~~V~sv~fspdg~~Lasgs~Dg~I~IwDl~~~~~l~~~~~~~~~I~sl~f  235 (811)
                      +|++.|++|..++|||+..|+.+.+|..|.+.+..+.|||...+++.|+.|++|+|||+++++.+....+...+|.+++|
T Consensus       167 r~v~~g~ed~tvki~d~~agk~~~ef~~~e~~v~sle~hp~e~Lla~Gs~d~tv~f~dletfe~I~s~~~~~~~v~~~~f  246 (825)
T KOG0267|consen  167 RWVASGGEDNTVKIWDLTAGKLSKEFKSHEGKVQSLEFHPLEVLLAPGSSDRTVRFWDLETFEVISSGKPETDGVRSLAF  246 (825)
T ss_pred             ceeeccCCcceeeeecccccccccccccccccccccccCchhhhhccCCCCceeeeeccceeEEeeccCCccCCceeeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCCCEEEEEECCCEE------------EEEecCCceeeeeeccccceeEeeecCCCEEE--EEECCCeEEEEEecCCCc
Q 003556          236 NPDGRTLLCGLHESLK------------VFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLG--CSYNQSCVGVWVVDISRI  301 (811)
Q Consensus       236 spdg~~Lasgs~d~I~------------Vwd~~~~~~~~~~~~~~~~i~~l~~~dg~lLa--sg~~Dg~V~IWdvd~~~~  301 (811)
                      +|+|..+++|....+.            ++.|++..+...+...+.....+......+..  .+..+..-++.+..-   
T Consensus       247 n~~~~~~~~G~q~sl~~~~~a~ah~~~~~~~~Ep~~~~~~vqs~~~~ek~v~v~~d~~~ln~~~s~~~~~kl~~~~~---  323 (825)
T KOG0267|consen  247 NPDGKIVLSGEQISLSESRTASAHVRKTLARWEPEMDGAVVQSNSHKEKVVAVGRDPQDLNAFSSKVNLSKLEDSTY---  323 (825)
T ss_pred             cCCceeeecCchhhhhhhhcccceeeccccccccccccceeeecCCcccccccccCccccccccccccccccccccc---
Confidence            9999999999777655            44455544444444444333222221111110  111110001100000   


Q ss_pred             eeeeeccceeeccccccccCCCCCccccccCccccccCCcccc-CCCccccccccccCcccccCCCCccccccccccccc
Q 003556          302 EPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVS-QNSDPLVKETKSLGRLSVSQNSDPLLKETKTLGRLS  380 (811)
Q Consensus       302 ~p~~~~~~~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  380 (811)
                                              .++.   ..-..+++++++ +..++..+.++.-++-+.+++++....+.+..+...
T Consensus       324 ------------------------~p~l---~~t~~l~rl~~S~q~dep~~~~~k~~~~s~t~~~s~~~~~~s~P~~r~~  376 (825)
T KOG0267|consen  324 ------------------------VPLL---KETKSLGRLSVSYQTDEPLDKSTKPHRRSSTSQNSDRSEVESKPLTRES  376 (825)
T ss_pred             ------------------------ccee---ccccchhccccccccCCCcccCCCCcccccccccccccccccCcccccc
Confidence                                    0000   001122333332 333333333333333445555554444444443333


Q ss_pred             ccCCCCccccccccccCCCCCCCCcccccCCCCCc-ccccc---ccccccccccccccCCCcCcccCCCCccccccCCCC
Q 003556          381 VSQNSEPAKESKVLSSTGSVPGTPQRVNLNMGSKT-SVVNS---TAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNT  456 (811)
Q Consensus       381 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~-~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~r~~~  456 (811)
                      .....++.+...-+.+.+.++..|.|....+.++. +++.+   .++.++....+++++.+.. ....+..||+.+ ..+
T Consensus       377 s~~~~di~~~s~~lss~e~~~~~P~r~s~tn~~k~~sgvSs~~~rs~ts~~~~~k~n~ka~~~-~~e~~~~~v~~~-~~p  454 (825)
T KOG0267|consen  377 SNLSPDIPKESRTLSSTESNSEYPHRVSPTNPVKIVSGVSSSVTRSPTSPVNPGKANPKAEIA-SVEQDNNPVIQD-PLP  454 (825)
T ss_pred             CCCCcccccccccccccccCCCCCCcccccCccccccccccccccCCCCCCCccccCcccccc-ccccccccccCC-Ccc
Confidence            32233333344555566677888888877665555 55543   4455555555555555432 235566788776 555


Q ss_pred             ccccccccccccccccccCCCCcCCcccccccccCCCCCCCCcccccccccCCCCccccccccccc--cccccccccccc
Q 003556          457 RFEQAVESRKDIDVIGRTMPFSLQSKATDSRKFQNSGDEVDQPAVSVLCENTGSKATEVSSVADRN--TFAAIKGSIQGV  534 (811)
Q Consensus       457 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~  534 (811)
                      ..+.+.......+...|++|.+.++...+.|  ++.++++..++... ...+.+....+.-...++  +++....+.+. 
T Consensus       455 ~~~q~~Esp~~~~~~arttP~s~~P~~~~~r--~~~rs~~~~~~st~-~~rtssspvmpv~lp~~s~~ty~~~~v~a~~-  530 (825)
T KOG0267|consen  455 TIEQATESPVPSTRIARTTPASVQPIALNSR--SNSRSDPPPPTSTV-PERTSSSPVMPVILPQASMSTYPEPPVGASS-  530 (825)
T ss_pred             cccccccCccccccccccCCccccccccccc--ccCCCCCCCccccc-ccccccCCccccccCCCcccccCCCCccccC-
Confidence            5556666666667677889999998877887  67777776555433 344555566665555555  77777766543 


Q ss_pred             ceeccCCcccceeeccCCCCCcCCCCCCCcccccccccCCCCCCCCCccccccCCccccccccccccCCCCCCCCCCccc
Q 003556          535 SVTERNSKEDIFTVSGKSGTMSMSESPASYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINWEKRGSSPNYDGPTSSI  614 (811)
Q Consensus       535 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  614 (811)
                       .++.......+-.|++++..+.++.+......++.+..--.+.  +..-.+..++--+..++.++.....+...|+..+
T Consensus       531 -~a~~s~~r~~~~~~~~a~~~~~~~~~~~l~r~r~~~pa~~~~t--k~~~~~~~t~~~s~iasr~r~s~t~~~~tPa~~~  607 (825)
T KOG0267|consen  531 -TARTSSARILPVTFNQANNISSEEAPVTLRRQRRNSPARVMPT--KLNQSVNMTSDTSHIASRHRVSPTQMLATPAVID  607 (825)
T ss_pred             -cccccccccccccccccccccCcCCccccccccCCCccccccc--ccchhhcccccccchhhhhccCccccccccceec
Confidence             2333333344555666666666666655544333311111100  0000112233344555556555555666666665


Q ss_pred             CC--------CCcccccccCCCCcccccCCCCChHHHHHHHHhhHHHHHHHHHHHHHhHHHHHHHhhcCCHHHHHHHHHh
Q 003556          615 SS--------GTVSTFKQRGYSSSAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQK  686 (811)
Q Consensus       615 ~~--------~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~h~~~~~~l~~R~~~l~~~~~~w~~~~~~~~i~~~~~  686 (811)
                      .+        .+.++.++++.... |+.....+|+|+.++||..|++|+..|++|+++||+||+||+++|||++|.+++|
T Consensus       608 ~~~~mt~~et~~t~~~~q~~n~~~-ee~~~s~~eedI~e~im~~Hde~lstlqSRl~kLqiVR~~Wer~DiK~sI~s~~k  686 (825)
T KOG0267|consen  608 QVGDMTADETRPTNMQPQRDNLVQ-EEPIISDREEDIVEDIMGTHNEFLSTLQSRLTKLQIVRHFWERSDIKGSIGSLRK  686 (825)
T ss_pred             cccccccccccccccccccccccc-cccccCcchhhhhhhhhhcchHHHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHH
Confidence            55        23456677776666 6666668899999999999999999999999999999999999999999999999


Q ss_pred             cCCceEEeehHHHhhcccceeeehhhhhhhhhHHhhhccccchhHHHHHHHHHHHHHHHhHhHHhhhcCCCcccccchHH
Q 003556          687 MADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAE  766 (811)
Q Consensus       687 ~~d~~v~~d~l~~~~~~~~~~~l~~c~~~lp~~~~ll~s~~e~~~~~~~~~l~~~~~~f~~~i~~~~~~~~~~gvd~~~E  766 (811)
                      |.|++|.||+|+||++|.++|+||+|++|||++..||.||||+|+.|+|+||++||+.||++|+++++||+.|||||+||
T Consensus       687 l~D~sV~ADvL~Iltek~eiLtLDl~t~l~P~lt~LLgS~~e~~v~vsld~Llklv~~fgt~I~stlsAp~~VGVDi~ae  766 (825)
T KOG0267|consen  687 LADNSVQADVLNILTEKIEILTLDLCTQLLPVLTALLGSKTERPVNVSLDMLLKLVAVFGTVIYSTLSAPRSVGVDIHAE  766 (825)
T ss_pred             hhhhhHHHHHHHHHhhhhhHhhHHHHHHHHHHHHHHhcccchhhhhhHHHHHHHHHHHhhhhhhhhhhCCcccccccchH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHhhccchhhcCcchhhHHHHHHhhcc
Q 003556          767 QRIERCNRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQ  808 (811)
Q Consensus       767 eR~~~c~~c~~~l~~i~~~~~~~~~~~g~~~~~~~el~~~~~  808 (811)
                      ||.++|..||.+|.+|...++.+.+.+|..++..++++....
T Consensus       767 er~~~~~lc~~~l~kl~~~~~s~s~~s~s~~~~~~s~~~~~~  808 (825)
T KOG0267|consen  767 ERKERYSLCFVELPKLFCGLASLSKNSSSFIKKRRSLNKKGS  808 (825)
T ss_pred             HHHhhhhhhhhhcchhhccccccccccccchhhhhhhccccc
Confidence            999999999999999999999999999999999999987653



>PF13925 Katanin_con80: con80 domain of Katanin Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF08801 Nucleoporin_N: Nup133 N terminal like; InterPro: IPR014908 Nucleoporins are the main components of the nuclear pore complex (NPC) in eukaryotic cells, and mediate bidirectional nucleocytoplasmic transport, especially of mRNA and proteins Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF10395 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an essential component of the nuclear tRNA export machinery in Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF10433 MMS1_N: Mono-functional DNA-alkylating methyl methanesulfonate N-term; PDB: 2B5M_A 4A0K_C 4A0B_C 3I7L_A 2B5N_C 3I8E_A 4A09_A 4A0A_A 3EI4_C 2B5L_A Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>PF10433 MMS1_N: Mono-functional DNA-alkylating methyl methanesulfonate N-term; PDB: 2B5M_A 4A0K_C 4A0B_C 3I7L_A 2B5N_C 3I8E_A 4A09_A 4A0A_A 3EI4_C 2B5L_A Back     alignment and domain information
>PRK05560 DNA gyrase subunit A; Validated Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query811
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 3e-31
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 3e-30
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 5e-11
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 1e-26
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 3e-17
2gnq_A336 Structure Of Wdr5 Length = 336 4e-25
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 4e-25
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 5e-25
2h9l_A329 Wdr5delta23 Length = 329 7e-25
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 8e-25
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 8e-25
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 8e-25
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 8e-25
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 9e-25
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 1e-24
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 1e-24
2g99_A308 Structural Basis For The Specific Recognition Of Me 1e-24
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 1e-24
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 1e-24
2g9a_A311 Structural Basis For The Specific Recognition Of Me 1e-24
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 3e-24
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 5e-24
3zey_7318 High-resolution Cryo-electron Microscopy Structure 4e-22
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 7e-21
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 2e-08
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 3e-20
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 5e-20
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 6e-20
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 8e-10
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 7e-20
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 7e-20
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 9e-20
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 1e-19
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 6e-19
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 7e-19
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 1e-11
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 9e-19
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 1e-18
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 1e-18
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 1e-18
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 1e-18
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 1e-18
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 7e-18
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 2e-10
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 7e-18
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 2e-10
3mkq_A814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 1e-17
3mkq_A814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 6e-11
2ynp_A604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 1e-17
2ynp_A604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 2e-10
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 7e-17
4gga_A420 Structural Analysis Of Human Cdc20 Supports Multi-S 8e-17
4ggd_A431 Structural Analysis Of Human Cdc20 Supports Multisi 9e-17
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 1e-16
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 2e-16
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 2e-16
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 3e-16
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 3e-16
4ggc_A318 Structural Analysis Of Human Cdc20 Supports Multi-S 4e-16
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 6e-16
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 3e-15
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 9e-09
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 3e-15
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 4e-15
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 6e-15
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 8e-09
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 1e-14
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 1e-12
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 1e-08
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 8e-13
1gxr_A337 Wd40 Region Of Human Groucho/tle1 Length = 337 3e-12
1gxr_A337 Wd40 Region Of Human Groucho/tle1 Length = 337 3e-06
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 9e-12
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 3e-04
3odt_A313 Crystal Structure Of Wd40 Beta Propeller Domain Of 2e-11
3odt_A313 Crystal Structure Of Wd40 Beta Propeller Domain Of 2e-04
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 2e-10
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 1e-07
4aez_A401 Crystal Structure Of Mitotic Checkpoint Complex Len 4e-10
1nr0_A611 Two Seven-Bladed Beta-Propeller Domains Revealed By 2e-09
4a11_B408 Structure Of The Hsddb1-Hscsa Complex Length = 408 2e-09
4a11_B408 Structure Of The Hsddb1-Hscsa Complex Length = 408 9e-05
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 9e-09
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 1e-08
2pm9_A416 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 1e-08
2pm9_A416 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 6e-06
4gqb_B344 Crystal Structure Of The Human Prmt5:mep50 Complex 3e-07
3acp_A417 Crystal Structure Of Yeast Rpn14, A Chaperone Of Th 3e-07
3vl1_A420 Crystal Structure Of Yeast Rpn14 Length = 420 3e-07
3zwl_B369 Structure Of Eukaryotic Translation Initiation Fact 1e-06
3mmy_A368 Structural And Functional Analysis Of The Interacti 2e-06
4e5z_B436 Damaged Dna Induced Uv-Damaged Dna-Binding Protein 4e-06
3ei4_B436 Structure Of The Hsddb1-Hsddb2 Complex Length = 436 4e-06
4e54_B435 Damaged Dna Induced Uv-Damaged Dna-Binding Protein 4e-06
4i79_A399 Crystal Structure Of Human Nup43 Length = 399 8e-06
4i79_A399 Crystal Structure Of Human Nup43 Length = 399 2e-05
1pgu_A615 Yeast Actin Interacting Protein 1 (aip1), Se-met Pr 1e-04
1pi6_A615 Yeast Actin Interacting Protein 1 (Aip1), Orthorhom 2e-04
2b4e_A402 Crystal Structure Of Murine Coronin-1: Monoclinic F 3e-04
4g56_B357 Crystal Structure Of Full Length Prmt5/mep50 Comple 8e-04
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure

Iteration: 1

Score = 133 bits (335), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 78/235 (33%), Positives = 128/235 (54%), Gaps = 8/235 (3%) Query: 9 LQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAIL-SLSGHTSGIDSVSF 67 LQ HSS+VN + R + + + +D V LW + +L +L+GH+S + V+F Sbjct: 255 LQTLTGHSSSVNGVAF-RPDGQTIASASDDKTVKLW--NRNGQLLQTLTGHSSSVWGVAF 311 Query: 68 DSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKI 127 +A+ + T+KLW+ + ++TLTGH S+ V F P G+ AS S D +K+ Sbjct: 312 SPDGQTIASASDDKTVKLWN-RNGQHLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKL 370 Query: 128 WDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQ 187 W+ R + T GH+ V + F+PDG+ + S +D TVKLW+ G+LL H Sbjct: 371 WN-RNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRN-GQLLQTLTGHSSS 428 Query: 188 IQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTL 242 + + F P + +A+ S D+TVK W+ +L+ + +S VR + F+PDG+T+ Sbjct: 429 VWGVAFSPDDQTIASASDDKTVKLWN-RNGQLLQTLTGHSSSVRGVAFSPDGQTI 482
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|4GGC|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 318 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|1GXR|A Chain A, Wd40 Region Of Human Groucho/tle1 Length = 337 Back     alignment and structure
>pdb|1GXR|A Chain A, Wd40 Region Of Human Groucho/tle1 Length = 337 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|3ODT|A Chain A, Crystal Structure Of Wd40 Beta Propeller Domain Of Doa1 Length = 313 Back     alignment and structure
>pdb|3ODT|A Chain A, Crystal Structure Of Wd40 Beta Propeller Domain Of Doa1 Length = 313 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|4AEZ|A Chain A, Crystal Structure Of Mitotic Checkpoint Complex Length = 401 Back     alignment and structure
>pdb|1NR0|A Chain A, Two Seven-Bladed Beta-Propeller Domains Revealed By The Structure Of A C. Elegans Homologue Of Yeast Actin Interacting Protein 1 (Aip1). Length = 611 Back     alignment and structure
>pdb|4A11|B Chain B, Structure Of The Hsddb1-Hscsa Complex Length = 408 Back     alignment and structure
>pdb|4A11|B Chain B, Structure Of The Hsddb1-Hscsa Complex Length = 408 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|2PM9|A Chain A, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 416 Back     alignment and structure
>pdb|2PM9|A Chain A, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 416 Back     alignment and structure
>pdb|4GQB|B Chain B, Crystal Structure Of The Human Prmt5:mep50 Complex Length = 344 Back     alignment and structure
>pdb|3ACP|A Chain A, Crystal Structure Of Yeast Rpn14, A Chaperone Of The 19s Reg Particle Of The Proteasome Length = 417 Back     alignment and structure
>pdb|3VL1|A Chain A, Crystal Structure Of Yeast Rpn14 Length = 420 Back     alignment and structure
>pdb|3ZWL|B Chain B, Structure Of Eukaryotic Translation Initiation Factor Eif3i Complex With Eif3b C-Terminus (655-700) Length = 369 Back     alignment and structure
>pdb|3MMY|A Chain A, Structural And Functional Analysis Of The Interaction Between The Nucleoporin Nup98 And The Mrna Export Factor Rae1 Length = 368 Back     alignment and structure
>pdb|4E5Z|B Chain B, Damaged Dna Induced Uv-Damaged Dna-Binding Protein (Uv-Ddb) Dimerization And Its Roles In Chromatinized Dna Repair Length = 436 Back     alignment and structure
>pdb|3EI4|B Chain B, Structure Of The Hsddb1-Hsddb2 Complex Length = 436 Back     alignment and structure
>pdb|4E54|B Chain B, Damaged Dna Induced Uv-Damaged Dna-Binding Protein (Uv-Ddb) Dimerization And Its Roles In Chromatinized Dna Repair Length = 435 Back     alignment and structure
>pdb|4I79|A Chain A, Crystal Structure Of Human Nup43 Length = 399 Back     alignment and structure
>pdb|4I79|A Chain A, Crystal Structure Of Human Nup43 Length = 399 Back     alignment and structure
>pdb|1PGU|A Chain A, Yeast Actin Interacting Protein 1 (aip1), Se-met Protein, Monoclinic Crystal Form Length = 615 Back     alignment and structure
>pdb|1PI6|A Chain A, Yeast Actin Interacting Protein 1 (Aip1), Orthorhombic Crystal Form Length = 615 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|4G56|B Chain B, Crystal Structure Of Full Length Prmt5/mep50 Complexes From Xenopus Laevis Length = 357 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 811
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-39
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 5e-33
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-27
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-21
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-11
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-35
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 9e-31
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-26
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-18
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-09
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 4e-29
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-27
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-21
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 4e-11
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-27
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 4e-27
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-23
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-20
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-20
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-18
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-23
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 8e-22
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 7e-21
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-20
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 6e-13
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 7e-21
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 8e-18
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-13
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-13
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-12
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-11
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-11
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 6e-08
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-19
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 6e-16
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-15
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-14
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 9e-18
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-17
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-15
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-09
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 7e-08
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 4e-17
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-16
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 8e-16
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-10
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 6e-09
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-16
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-14
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 5e-13
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-11
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-16
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-13
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 8e-13
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-10
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-10
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-09
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 5e-08
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 7e-16
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-15
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-13
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-12
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-10
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 4e-10
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-09
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-15
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-13
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-11
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-10
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 8e-10
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-09
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-08
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 8e-08
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 5e-15
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 1e-11
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 3e-08
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 7e-15
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 7e-15
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-11
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 2e-11
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-14
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-14
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-11
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-10
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 7e-10
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-14
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-12
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-11
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 8e-10
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-09
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 1e-13
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-09
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 8e-09
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 4e-08
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 7e-13
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 4e-11
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-09
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 8e-09
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-06
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 4e-12
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 9e-12
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 6e-07
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-11
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 5e-10
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-09
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 6e-09
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 4e-11
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 3e-08
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 6e-08
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 5e-07
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 8e-07
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 5e-05
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 8e-04
d1qnia2441 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-ter 4e-06
d1qnia2441 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-ter 5e-06
d1qnia2441 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-ter 3e-05
d2p4oa1302 b.68.6.3 (A:4-305) Hypothetical protein All0351 ho 0.004
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  146 bits (367), Expect = 2e-39
 Identities = 47/206 (22%), Positives = 88/206 (42%), Gaps = 20/206 (9%)

Query: 28  SSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWD 87
           +   +V+   D  + +W +     + + +GH   +  V  +    L+A+ +   T+++W 
Sbjct: 112 NGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWV 171

Query: 88  LEEAKIVRTLTGHRSNCISVDFH--------------------PFGEFFASGSLDTNLKI 127
           +   +    L  HR     + +                       G F  SGS D  +K+
Sbjct: 172 VATKECKAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKM 231

Query: 128 WDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQ 187
           WD+    C+ T  GH   V  + F   G++++S  +D T+++WD    + +     HE  
Sbjct: 232 WDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHF 291

Query: 188 IQCIDFHPHEFLLATGSADRTVKFWD 213
           +  +DFH     + TGS D+TVK W+
Sbjct: 292 VTSLDFHKTAPYVVTGSVDQTVKVWE 317


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Length = 441 Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Length = 441 Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Length = 441 Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Length = 302 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query811
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.98
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.98
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.97
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.96
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.95
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.95
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.95
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.94
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.94
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.93
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.93
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.93
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.92
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.91
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.9
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.88
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.88
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.86
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.82
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.82
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.81
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.78
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.73
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.68
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.59
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.58
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.55
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.5
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.45
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.44
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.38
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.37
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.37
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.33
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.33
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.26
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.15
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.06
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.04
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.02
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.96
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.94
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.87
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.81
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.76
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.59
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.52
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.32
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 98.1
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.96
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.9
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.88
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.78
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.77
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.37
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.24
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.22
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.21
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.71
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.68
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 96.62
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.53
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.49
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 96.48
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.26
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 95.82
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 95.59
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 95.04
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 94.46
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 93.71
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 93.37
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 90.51
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 90.45
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 90.4
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 88.65
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 86.17
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 80.52
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.9e-41  Score=282.06  Aligned_cols=286  Identities=23%  Similarity=0.374  Sum_probs=250.4

Q ss_pred             CEEEEEEECCCCCEEEEEEEECCCCEEEEEECCCEEEEEECCCCC-----EEEEECCCCCCEEEEEECCCCCEEEEEECC
Q ss_conf             515899833798779999920899399999789919999889993-----489962789995899995999999999889
Q 003556            6 AYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPN-----AILSLSGHTSGIDSVSFDSSEVLVAAGAAS   80 (811)
Q Consensus         6 ~~ki~~l~~H~~~V~~iafsp~~~~lLatgs~DG~I~IWdi~~~~-----~i~~l~~h~~~V~~I~fspdg~~Lasgs~D   80 (811)
                      ..++..+ .|...|+|++|+| ++++|++|+ ||.|+|||+....     ......+|.+.|.+++|+|++.+|++++.|
T Consensus        42 ~~~~~~~-~H~~~V~~v~fs~-~g~~latg~-dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~~l~s~~~d  118 (337)
T d1gxra_          42 ARQINTL-NHGEVVCAVTISN-PTRHVYTGG-KGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEA  118 (337)
T ss_dssp             EEEEEEE-CCSSCCCEEEECS-SSSEEEEEC-BSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSSEEEEEESS
T ss_pred             CEEEEEC-CCCCCEEEEEECC-CCCEEEEEE-CCEEEEEECCCCCCCCEEEEEEECCCCCCEEEEEECCCCCEEEEEECC
T ss_conf             5499987-9999289999989-999999997-998899773677633116876404889968999986799889886123


Q ss_pred             CEEEEEECCC--CEEEEEECCCCCCEEEEEEECCCCEEEEEECCCCEEEEECCCCEEEEEEECCCCCEEEEEECCCCCEE
Q ss_conf             9099998799--83999982889885999991799899999799919999889991899981689885999993899999
Q 003556           81 GTIKLWDLEE--AKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWV  158 (811)
Q Consensus        81 G~I~IWDl~t--~~~i~~l~~h~~~I~si~fspdg~~Lasgs~Dg~I~IwDi~~~~~i~~l~~h~~~I~si~fspdg~~L  158 (811)
                      |.|++||+..  .+....+..|...+.+++|+|++.++++++.++.|++|++.++++......|...+.+++|++++..+
T Consensus       119 g~i~iwd~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~~~~~~~~~~~~v~~l~~s~~~~~~  198 (337)
T d1gxra_         119 STLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKL  198 (337)
T ss_dssp             SEEEEEECCCC--EEEEEEECSSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEECCCSSCEEEEEECTTSSEE
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             32111111111111111111111111111111111111111111111111111111111111111111101234443211


Q ss_pred             EEEECCCEEEEEECCCCEEEEEEECCCCCEEEEEEECCCCEEEEEECCCEEEEEECCCCEEEEEECCCCCCEEEEEEECC
Q ss_conf             99978992999988999289997328998699999179989999979991999988998199872899988269999069
Q 003556          159 VSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPD  238 (811)
Q Consensus       159 vsgs~Dg~I~iwDl~t~~~i~~~~~h~~~V~si~fspdg~~Lasgs~Dg~I~IwDl~~~~~i~~~~~~~~~I~si~fspd  238 (811)
                      ++++.|+.+++||+++++.+..+. +...|.+++|+|++.+|++++.|+.+++||++..+.. ....|...|++++|+|+
T Consensus       199 ~~~~~d~~v~i~d~~~~~~~~~~~-~~~~i~~l~~~~~~~~l~~~~~d~~i~i~d~~~~~~~-~~~~~~~~i~~v~~s~~  276 (337)
T d1gxra_         199 WTGGLDNTVRSWDLREGRQLQQHD-FTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKY-QLHLHESCVLSLKFAYC  276 (337)
T ss_dssp             EEEETTSEEEEEETTTTEEEEEEE-CSSCEEEEEECTTSSEEEEEETTSCEEEEETTSSCEE-EECCCSSCEEEEEECTT
T ss_pred             CCCCCCCCCCCCCCCCCEEECCCC-CCCCEEEEEECCCCCCCCEECCCCCCCCCCCCCCCCC-CCCCCCCCCCEEEECCC
T ss_conf             223566553211111100000246-6661579997153030000002564211111111100-00124565416999899


Q ss_pred             CCEEEEEECCC-EEEEEECCCCEEEEEECCCCCEEEEEE-CCCCEEEEEECCCEEEEEEEC
Q ss_conf             99999997898-999994698221001035651157663-299799999979929999902
Q 003556          239 GRTLLCGLHES-LKVFSWEPIRCHDAVDVGWSRLSDLNV-HEGKLLGCSYNQSCVGVWVVD  297 (811)
Q Consensus       239 g~~Lasgs~d~-I~Iwd~~~~~~~~~~~~~~~~i~~l~~-~dg~lLasg~~Dg~V~IWdvd  297 (811)
                      |++|++++.++ +++|+....+........ ..+..+.+ +++++|++++.|+.|++|++-
T Consensus       277 g~~l~s~s~Dg~i~iwd~~~~~~~~~~~~~-~~v~~~~~s~d~~~l~t~s~D~~I~vWdl~  336 (337)
T d1gxra_         277 GKWFVSTGKDNLLNAWRTPYGASIFQSKES-SSVLSCDISVDDKYIVTGSGDKKATVYEVI  336 (337)
T ss_dssp             SSEEEEEETTSEEEEEETTTCCEEEEEECS-SCEEEEEECTTSCEEEEEETTSCEEEEEEE
T ss_pred             CCEEEEEECCCEEEEEECCCCCEEEECCCC-CCEEEEEEECCCCEEEEEECCCEEEEEEEE
T ss_conf             999999948996999989999799992699-987999992799999999089969999778



>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure