Citrus Sinensis ID: 003619

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------
MTAIHSLISFRVELPKPYNYTKSIPKSAKPLKFTRKCQSRTNFLHRSFTVLCELSQPGDTSKPTEEDFVTRVLKENPSQVEPKYLIGERFYSLKERQNLSEKNDVGIFQSLAEKLNSKENSKKESDNQNVSGSVYLKDILREYKGKLYVPEQVFGHELSEEEEFHKNVKELPKMSIEEFKKYMESDKVKLLTSKGINGVAFANGYRDFIVDLKDIPGNKKLQRTKWAMRLDDNEAQALLDEYTGPQYEIEKHMTSWVGKLPEYPHPVASSISSRLMVELGMVTAIMAAAAAIVGGFLASAVFAVTSFIFVTTVYVVWPIARPFVNIFRGLILGIIENISDYIVDLSGEGGILSKFYEFYTFGGLSASLEMLKPITLVILTMVLLIRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKDTTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRAPNAKGRTEILKIHASKVKMSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAVRKGHESILSSDMDDAVDRLTVGPKRRGIELGNQGQSRRAATEVGVAMISHLLRRYENAKVECCDRISIVPRGQTLSQLVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRASVNYLADASWLAHGIWRIQWSYMENHLHGERK
cccccHHHHcccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccHHHHHHHHHcccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHccccccccccccccccHHHHHHHHccccccccHHHHHHHHHcccEEEEEEccccccccccccccEEEEEEccccccHHHHHHHHHHccHHHHHHHHHHHccccEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEEEEEEEEEcccccccccccEEEEEEccccHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHcccccccEEEEEcccccHHHHHHHHHHccccccEEEcccccEEEEEccccHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccccccccccEEEEEcHHHHHHHHHHHHcccccccccEEEEEEccccccccEEcccccccccccccHHHHHHHHHHHHcHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccccccc
cccccEEEEEEEEcccccccccccccccccccccccccccHHHHccccEEEEEEcccccccccccccHHHHHHccccccccccEEEccccccHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccccEEHHHHHHHHccccEccHHHccccccHHHHHHHHHHHcccccHHHHHHHHHcccEEEEEEcccccccHccccccEEEEcccccccccHHHHHHHHEccHHHHHHHHHHcccccEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEccccccHEEccccccEEEHHccccHHHHHHHHHHHHHHHccHHHHHHHccccccEEEEEcccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHccHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHccccccccEEEEEEEccccccccHHHccccccccEEEEcccccccHHHHHHHHHccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHcccEEcHHHHHHHHHHHHccHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEcccccEEEEEccccccccccccHHHHHHHHHHHHccHHHHHEEcccccccccccHHHHHHHHHHHHHHHHccccHHccccccc
MTAIHSLISFRvelpkpynytksipksakplkftrkcqsrtnFLHRSFTVLcelsqpgdtskpteeDFVTRVlkenpsqvepkyligerFYSLkerqnlsekndVGIFQSLAEKLNSkenskkesdnqnvsgsVYLKDILREYkgklyvpeqvfghelseEEEFHKNVKELPKMSIEEFKKYMESDKVKLltskgingvafanGYRDFivdlkdipgnkklqRTKWAMRLDDNEAQALLdeytgpqyeiEKHMTswvgklpeyphpvassISSRLMVELGMVTAIMAAAAAIVGGFLASAVFAVTSFIFVTTVYVvwpiarpfvNIFRGLILGIIENISDYIVDlsgeggilSKFYEFYtfgglsasleMLKPITLVILTMVLLIRFTlsrrpknfrkwdlwqgidfsrskaearvdgstgvkfsdvaGIDEAVEELQELVRYLKnpelfdkmgikpphgvllegppgcgkTLVAKAIageagvpfyqmaGSEFVEVLVGVGSARIRDLFKRakvnkpsvifIDEIDALATRRQGIFKDTTDHLYNAATQERETTLNQLLIEldgfdtgkgVIFLAATnrrdlldpallrpgrfdrkirirapnakgRTEILKIHAskvkmsdsvdlssyaknlpgwtGARLAQLVQEAALVAVRKGHESilssdmddavdrltvgpkrrgielgnqgqsrRAATEVGVAMISHLLRRYENakveccdrisivprgqtlSQLVFHrlddesymferRPQLLHRLQVLLGGRAAEEVIYGQDTSRASVNYLADASWLAHGIWRIQWSYMENHLHGERK
mtaihslisfrvelpkpynytksipksakplkfTRKCQSRTNFLHRSFTVLcelsqpgdtskpteEDFVTrvlkenpsqvepkylIGERFYSLKERQNLSEKNDVGIFQSLAEKLNSkenskkesdnqnvsgsvyLKDILREYKGKLYVPEQVFGhelseeeefhknvkelPKMSIEEFKKYMESDKVKLLTSKGINGVAFANGYRDFivdlkdipgnkklqrtkWAMRLDDNEAQALLDEYTGPQYEIEKHMTSWVGKLPEYPHPVASSISSRLMVELGMVTAIMAAAAAIVGGFLASAVFAVTSFIFVTTVYVVWPIARPFVNIFRGLILGIIENISDYIVDLSGEGGILSKFYEFYTFGGLSASLEMLKPITLVILTMVLLIRFtlsrrpknfrkwdlwqgidfsrskaearvdgstgvkfsdvagIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLfkrakvnkpsvifiDEIDALATRRQGIFKDTTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAatnrrdlldpallrpgrfdrkirirapnakgrteilkihaskvkmsdsvDLSSYAKNLPGWTGARLAQLVQEAALVAVRKGHesilssdmddavDRLTVGpkrrgielgnqgqsrraaTEVGVAMISHLLRRYENAKVECCDrisivprgqtlsqLVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRASVNYLADASWLAHGIWRIQWSYMENHLHGERK
MTAIHSLISFRVELPKPYNYTKSIPKSAKPLKFTRKCQSRTNFLHRSFTVLCELSQPGDTSKPTEEDFVTRVLKENPSQVEPKYLIGERFYSLKERQNLSEKNDVGIFQSLAeklnskenskkesdnQNVSGSVYLKDILREYKGKLYVPEQVFGHELSEEEEFHKNVKELPKMSIEEFKKYMESDKVKLLTSKGINGVAFANGYRDFIVDLKDIPGNKKLQRTKWAMRLDDNEAQALLDEYTGPQYEIEKHMTSWVGKLPEYPHPVASSISSRLMVElgmvtaimaaaaaivggflasaVFAVTSFIFVTTVYVVWPIARPFVNIFRGLILGIIENISDYIVDLSGEGGILSKFYEFYTFGGLSASLEMLKPitlviltmvlliRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKDTTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAATNrrdlldpallrpgrFDRKIRIRAPNAKGRTEILKIHASKVKMSDSVDLSSYAKNLPGWTGarlaqlvqeaalvavrKGHESILSSDMDDAVDRLTVGPKRRGIELGNQGQSRRAATEVGVAMISHLLRRYENAKVECCDRISIVPRGQTLSQLVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRASVNYLADASWLAHGIWRIQWSYMENHLHGERK
*****SLISFRVELPKPYNYTKS*******LKFTRKCQSRTNFLHRSFTVLCEL****************************KYLIGERFYSL***************************************SVYLKDILREYKGKLYVPEQVFGHE*********************FKKYMESDKVKLLTSKGINGVAFANGYRDFIVDLKDIPGNKKLQRTKWAMRLDDNEAQALLDEYTGPQYEIEKHMTSWVGKLPEYPHPVASSISSRLMVELGMVTAIMAAAAAIVGGFLASAVFAVTSFIFVTTVYVVWPIARPFVNIFRGLILGIIENISDYIVDLSGEGGILSKFYEFYTFGGLSASLEMLKPITLVILTMVLLIRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKDTTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRAPNAKGRTEILKIHASKVKMSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAVRKGHE**********************************ATEVGVAMISHLLRRYENAKVECCDRISIVPRGQTLSQLVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRASVNYLADASWLAHGIWRIQWSYMEN*******
**A*HSLISFRVELPK*******************KCQSRTNFLHRSFTVL******************TRVLKENPSQVEPKYLIGERFYSLKERQNLSEKNDVGIFQSL***********************YLKDILREYKGKLYVPEQVFGHELSEEEEFHKNVKELPKMSIEEFKKYMESDKVKLLTSKGINGVAFANGYRDFIVDLKDIPGNKKLQRTKWAMRLD*****ALLDEYTGPQYEIEKHM***************SSISSRLMVELGMVTAIMAAAAAIVGGFLASAVFAVTSFIFVTTVYVVWPIARPFVNIFRGLILGIIENISDYIVDLSGEGGILSKFYEFYTFGGLSASLEMLKPITLVILTMVLLIRF**********************************VKFSDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKDTTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRAPNAKGRTEILKIHASKVKMSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAVRKGHESILSSDMDDAVDRLTVGPKRR*****NQGQSRRAATEVGVAMISHLLRRYENAKVECCDRISIVPRGQTLSQLVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRASVNYLADASWLAHGIWRIQWSYME********
MTAIHSLISFRVELPKPYNYTKSIPKSAKPLKFTRKCQSRTNFLHRSFTVLCELSQ**********DFVTRVLKENPSQVEPKYLIGERFYSLKERQNLSEKNDVGIFQSLAEKLN*************VSGSVYLKDILREYKGKLYVPEQVFGHELSEEEEFHKNVKELPKMSIEEFKKYMESDKVKLLTSKGINGVAFANGYRDFIVDLKDIPGNKKLQRTKWAMRLDDNEAQALLDEYTGPQYEIEKHMTSWVGKLPEYPHPVASSISSRLMVELGMVTAIMAAAAAIVGGFLASAVFAVTSFIFVTTVYVVWPIARPFVNIFRGLILGIIENISDYIVDLSGEGGILSKFYEFYTFGGLSASLEMLKPITLVILTMVLLIRFTLSRRPKNFRKWDLWQGIDFSRS********STGVKFSDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKDTTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRAPNAKGRTEILKIHASKVKMSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAVRKGHESILSSDMDDAVDRLTVGPKRRGIEL*********ATEVGVAMISHLLRRYENAKVECCDRISIVPRGQTLSQLVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRASVNYLADASWLAHGIWRIQWSYME********
**AIHSLISFRVELPKPYNYTKSIPKSAKPLKFTRKCQSRTNFLHRSFTVLCELSQ*********EDFVTRVLKENPSQVEPKYLIGERFYSLKERQNLSEKNDVGIFQSLAEKLNSK*************GSVYLKDILREYKGKLYVPEQVFGHELSEEEEFHKNVKELPKMSIEEFKKYMESDKVKLLTSKGINGVAFANGYRDFIVDLKDIPGNKKLQRTKWAMRLDDNEAQALLDEYTGPQYEIEKHMTSWVGKLPEYPHPVASSISSRLMVELGMVTAIMAAAAAIVGGFLASAVFAVTSFIFVTTVYVVWPIARPFVNIFRGLILGIIENISDYIVDLSGEGGILSKFYEFYTFGGLSASLEMLKPITLVILTMVLLIRFTLSRRPKNF*************SKAEARVDGSTGVKFSDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFK*****L**AATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRAPNAKGRTEILKIHASKVKMSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAVRKGHESILSSDMDDAVDRLTVGPKRRGIELGNQGQSRRAATEVGVAMISHLLRRYENAKVECCDRISIVPRGQTLSQLVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRASVNYLADASWLAHGIWRIQWSYM*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTAIHSLISFRVELPKPYNYTKSIPKSAKPLKFTRKCQSRTNFLHRSFTVLCELSQPGDTSKPTEEDFVTRVLKENPSQVEPKYLIGERFYSLKERQNLSEKNDVGIFQSLAEKLNSKENSKKESDNQNVSGSVYLKDILREYKGKLYVPEQVFGHELSEEEEFHKNVKELPKMSIEEFKKYMESDKVKLLTSKGINGVAFANGYRDFIVDLKDIPGNKKLQRTKWAMRLDDNEAQALLDEYTGPQYEIEKHMTSWVGKLPEYPHPVASSISSRLMVELGMVTAIMAAAAAIVGGFLASAVFAVTSFIFVTTVYVVWPIARPFVNIFRGLILGIIENISDYIVDLSGEGGILSKFYEFYTFGGLSASLEMLKPITLVILTMVLLIRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKDTTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRAPNAKGRTEILKIHASKVKMSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAVRKGHESILSSDMDDAVDRLTVGPKRRGIELGNQGQSRRAATEVGVAMISHLLRRYENAKVECCDRISIVPRGQTLSQLVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRASVNYLADASWLAHGIWRIQWSYMENHLHGERK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query807 2.2.26 [Sep-21-2011]
P73179665 ATP-dependent zinc metall N/A no 0.485 0.589 0.453 2e-91
O78516631 ATP-dependent zinc metall yes no 0.433 0.554 0.478 2e-90
Q1AV13651 ATP-dependent zinc metall yes no 0.441 0.546 0.466 5e-90
Q55700627 ATP-dependent zinc metall N/A no 0.460 0.593 0.475 6e-90
B2UE66 714 ATP-dependent zinc metall yes no 0.454 0.514 0.463 8e-90
B4U7U4 636 ATP-dependent zinc metall yes no 0.468 0.594 0.448 1e-89
Q9WZ49610 ATP-dependent zinc metall yes no 0.526 0.696 0.417 2e-89
Q8YMZ8656 ATP-dependent zinc metall no no 0.458 0.564 0.468 2e-89
B3DY14 641 ATP-dependent zinc metall yes no 0.498 0.627 0.421 3e-89
A8F7F7626 ATP-dependent zinc metall yes no 0.446 0.575 0.462 4e-89
>sp|P73179|FTSH1_SYNY3 ATP-dependent zinc metalloprotease FtsH 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH1 PE=2 SV=1 Back     alignment and function desciption
 Score =  337 bits (865), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 188/415 (45%), Positives = 267/415 (64%), Gaps = 23/415 (5%)

Query: 375 TLVILTMVLLIRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDVAGIDEAV 434
            L+++ +++ +   + RR  N       Q + F +SKA  +++  TGV F DVAGIDEA 
Sbjct: 165 NLLVVAILIGLVVMVVRRSANAS----GQAMSFGKSKARFQMEAKTGVGFDDVAGIDEAK 220

Query: 435 EELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEF 494
           EELQE+V +LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEF
Sbjct: 221 EELQEVVTFLKQPEKFTAIGAKIPRGVLLIGPPGTGKTLLAKAIAGEAGVPFFSISGSEF 280

Query: 495 VEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKDTTDHLYNAATQERET 554
           VE+ VGVG++R+RDLFK+AK N P ++FIDEIDA+  R++G+        Y     ERE 
Sbjct: 281 VEMFVGVGASRVRDLFKKAKENAPCLVFIDEIDAVG-RQRGVG-------YGGGNDEREQ 332

Query: 555 TLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRAPNAKGRTEILKI 614
           TLNQLL E+DGF+   G+I +AATNR D+LD ALLRPGRFDR++ +  P+ +GR  IL I
Sbjct: 333 TLNQLLTEMDGFEGNSGIIVIAATNRPDVLDLALLRPGRFDRQVTVDYPDVQGRELILAI 392

Query: 615 HASKVKMSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAVRKGHESILSSDMDDAVDRLT 674
           HA   K+ + V L++ A+  PG+TGA LA ++ EAA+   R+  E+I  ++++DA+DR+ 
Sbjct: 393 HAQNKKLHEEVQLAAIARRTPGFTGADLANVLNEAAIFTARRRKEAITMAEVNDAIDRVV 452

Query: 675 VGPKRRGIELGNQGQSRRAA-TEVGVAMISHLLRRYENAKVECCDRISIVPRGQTLSQLV 733
            G    G  L +    R  A  EVG A+I  L   +     +  ++++++PRGQ      
Sbjct: 453 AG--MEGTPLVDSKSKRLIAYHEVGHALIGTLCPGH-----DPVEKVTLIPRGQAQGLTW 505

Query: 734 FHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGQD-TSRASVNYLADASWLA 787
           F   +D+S M   R Q++ R+  LLGGR AEEVI+G D  +  + N +   ++LA
Sbjct: 506 FTPDEDQSLM--TRNQMIARIAGLLGGRVAEEVIFGDDEVTTGAGNDIEKITYLA 558
Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins.
Synechocystis sp. (strain PCC 6803 / Kazusa) (taxid: 1111708)
EC: 3EC: .EC: 4EC: .EC: 2EC: 4EC: .EC: -
>sp|O78516|FTSH_GUITH ATP-dependent zinc metalloprotease FtsH OS=Guillardia theta GN=ftsH PE=3 SV=1 Back     alignment and function description
>sp|Q1AV13|FTSH_RUBXD ATP-dependent zinc metalloprotease FtsH OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=ftsH PE=3 SV=1 Back     alignment and function description
>sp|Q55700|FTSH2_SYNY3 ATP-dependent zinc metalloprotease FtsH 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH2 PE=1 SV=1 Back     alignment and function description
>sp|B2UE66|FTSH_RALPJ ATP-dependent zinc metalloprotease FtsH OS=Ralstonia pickettii (strain 12J) GN=ftsH PE=3 SV=1 Back     alignment and function description
>sp|B4U7U4|FTSH_HYDS0 ATP-dependent zinc metalloprotease FtsH OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=ftsH PE=3 SV=1 Back     alignment and function description
>sp|Q9WZ49|FTSH_THEMA ATP-dependent zinc metalloprotease FtsH OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ftsH PE=1 SV=1 Back     alignment and function description
>sp|Q8YMZ8|FTSH_NOSS1 ATP-dependent zinc metalloprotease FtsH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ftsH PE=3 SV=1 Back     alignment and function description
>sp|B3DY14|FTSH2_METI4 ATP-dependent zinc metalloprotease FtsH 2 OS=Methylacidiphilum infernorum (isolate V4) GN=ftsH2 PE=3 SV=1 Back     alignment and function description
>sp|A8F7F7|FTSH_THELT ATP-dependent zinc metalloprotease FtsH OS=Thermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / TMO) GN=ftsH PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query807
224058199 932 predicted protein [Populus trichocarpa] 0.980 0.848 0.793 0.0
255537837 925 Cell division protein ftsH, putative [Ri 0.975 0.850 0.773 0.0
18416240 946 FtsH extracellular protease [Arabidopsis 0.990 0.844 0.75 0.0
356527688 925 PREDICTED: ATP-dependent zinc metallopro 0.950 0.829 0.759 0.0
297803738 933 hypothetical protein ARALYDRAFT_492469 [ 0.946 0.818 0.769 0.0
449506190 962 PREDICTED: ATP-dependent zinc metallopro 0.991 0.831 0.703 0.0
225436170907 PREDICTED: ATP-dependent zinc metallopro 0.912 0.811 0.747 0.0
168002938 958 predicted protein [Physcomitrella patens 0.899 0.757 0.541 0.0
168033123 966 predicted protein [Physcomitrella patens 0.897 0.749 0.545 0.0
302782403894 hypothetical protein SELMODRAFT_98591 [S 0.898 0.810 0.510 0.0
>gi|224058199|ref|XP_002299463.1| predicted protein [Populus trichocarpa] gi|222846721|gb|EEE84268.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1251 bits (3237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/813 (79%), Positives = 710/813 (87%), Gaps = 22/813 (2%)

Query: 1   MTAIHSLISFRVELPKPYNYTKSIPKSAKPLKFTRKCQSRTNFLHRSFTVLCEL-----S 55
           MT+I +L S RV LPKPY          KPLK   K +S+T FL+RS TVLCE+     +
Sbjct: 1   MTSIDTLFSLRVCLPKPYK---------KPLKSPPKFRSKTLFLNRSLTVLCEVNSASTA 51

Query: 56  QPGDTSKPTEEDFVTRVLKENPSQVEPKYLIGERFYSLKERQNLSEKNDVGIFQSLAEKL 115
           Q GDT+K   EDFVTRVLK+NPSQ+EP+YLIG++FY+ KE+Q+LS+K +VG  + +   L
Sbjct: 52  QSGDTNK---EDFVTRVLKQNPSQIEPRYLIGDKFYTSKEKQDLSKKKNVGFIEIVDRFL 108

Query: 116 NSKENSKKE-SDNQNVSGSVYLKDILREYKGKLYVPEQVFGHELSEEEEFHKNVKELPKM 174
           N K   KKE ++++N   +VYLKDILREYKGKLYVPEQVF  +LSEEEEF +N++ELPKM
Sbjct: 109 NLKGKVKKEGNESENEEKAVYLKDILREYKGKLYVPEQVFSVKLSEEEEFDRNLEELPKM 168

Query: 175 SIEEFKKYMESDKVKLLTSKGINGVAFANGYRDFIVDLKDIPGNKKLQRTKWAMRLDDNE 234
             E+FKK MES+KVKLLTSK      +AN YR FIVDLK+IPG K L RTKW MRL++NE
Sbjct: 169 GFEDFKKAMESEKVKLLTSKEAAMGTYANDYRGFIVDLKEIPGEKSLHRTKWTMRLNENE 228

Query: 235 AQALLDEYTGPQYEIEKHMTSWVGKLPEYPHPVASSISSRLMVELGMVTAIMAAAAAIVG 294
           AQ LL+EYTGP YEIE+HM S VGKLPEYPHPVASSISSR+MVELGMVTA+MAAAA +VG
Sbjct: 229 AQTLLEEYTGPFYEIERHMASSVGKLPEYPHPVASSISSRMMVELGMVTAVMAAAAVVVG 288

Query: 295 GFLASAVFAVTSFIFVTTVYVVWPIARPFVNIFRGLILGIIENISDYIVDLSGEGGILSK 354
           GFLASAVFAVTSFIFV TVYV WPIA+PFV +F GL   I+E + DY+VD+  +GG+ SK
Sbjct: 289 GFLASAVFAVTSFIFVATVYVAWPIAKPFVKLFLGLTFSILEGVWDYVVDIFSDGGLFSK 348

Query: 355 FYEFYTFGGLSASLEMLKPITLVILTMVLLIRFTLSRRPKNFRKWDLWQGIDFSRSKAEA 414
           FYEFYTFGG+SAS+EMLKPI LV+LTMVLL+RFTLSRRPKNFRKWDLWQGIDFSRSKAEA
Sbjct: 349 FYEFYTFGGVSASIEMLKPIMLVLLTMVLLVRFTLSRRPKNFRKWDLWQGIDFSRSKAEA 408

Query: 415 RVDGSTGVKFSDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLV 474
           RVDGSTGVKFSDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEG PGCGKTLV
Sbjct: 409 RVDGSTGVKFSDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGAPGCGKTLV 468

Query: 475 AKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQ 534
           AKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQ
Sbjct: 469 AKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQ 528

Query: 535 GIFKDTTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRF 594
           GIFK++TDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRF
Sbjct: 529 GIFKESTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRF 588

Query: 595 DRKIRIRAPNAKGRTEILKIHASKVKMSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAV 654
           DRKIRIR PNAKGR EILKIHASKVKMSDSVDLS+Y KNLPGWTGA+LAQLVQEAALVAV
Sbjct: 589 DRKIRIRPPNAKGRLEILKIHASKVKMSDSVDLSTYGKNLPGWTGAKLAQLVQEAALVAV 648

Query: 655 RKGHESILSSDMDDAVDRLTVGPKRRGIELGNQGQSRRAATEVGVAMISHLLRRYENAKV 714
           R+GH +IL SDMDDAVDRLTVGPKR GIELG+QGQ RRA TE+GV M SHLLRRYENAKV
Sbjct: 649 RQGHAAILQSDMDDAVDRLTVGPKRVGIELGHQGQCRRATTELGVVMTSHLLRRYENAKV 708

Query: 715 ECCDRISIVPRGQTLSQLVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSR 774
           ECCDRISIVPRGQTLSQLVFHRLDDESYMFER PQLLHRLQV LGGRAAEEVIYG+DTSR
Sbjct: 709 ECCDRISIVPRGQTLSQLVFHRLDDESYMFERLPQLLHRLQVFLGGRAAEEVIYGRDTSR 768

Query: 775 ASVNYLADASWLAHGIWRIQWSYMENHL--HGE 805
           ASV+YLADASWLA  I  I W+ +EN +  HGE
Sbjct: 769 ASVSYLADASWLARKIITI-WN-LENPMVIHGE 799

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255537837|ref|XP_002509985.1| Cell division protein ftsH, putative [Ricinus communis] gi|223549884|gb|EEF51372.1| Cell division protein ftsH, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|18416240|ref|NP_567691.1| FtsH extracellular protease [Arabidopsis thaliana] gi|2262118|gb|AAB63626.1| cell division protein isolog [Arabidopsis thaliana] gi|4972098|emb|CAB43894.1| cell division protein-like [Arabidopsis thaliana] gi|7269243|emb|CAB81312.1| cell division protein-like [Arabidopsis thaliana] gi|332659430|gb|AEE84830.1| FtsH extracellular protease [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356527688|ref|XP_003532440.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|297803738|ref|XP_002869753.1| hypothetical protein ARALYDRAFT_492469 [Arabidopsis lyrata subsp. lyrata] gi|297315589|gb|EFH46012.1| hypothetical protein ARALYDRAFT_492469 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449506190|ref|XP_004162678.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225436170|ref|XP_002266075.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH [Vitis vinifera] gi|296090151|emb|CBI39970.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|168002938|ref|XP_001754170.1| predicted protein [Physcomitrella patens subsp. patens] gi|162694724|gb|EDQ81071.1| predicted protein [Physcomitrella patens subsp. patens] Back     alignment and taxonomy information
>gi|168033123|ref|XP_001769066.1| predicted protein [Physcomitrella patens subsp. patens] gi|162679700|gb|EDQ66144.1| predicted protein [Physcomitrella patens subsp. patens] Back     alignment and taxonomy information
>gi|302782403|ref|XP_002972975.1| hypothetical protein SELMODRAFT_98591 [Selaginella moellendorffii] gi|300159576|gb|EFJ26196.1| hypothetical protein SELMODRAFT_98591 [Selaginella moellendorffii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query807
TAIR|locus:2138146 946 FtsHi1 "FTSH inactive protease 0.990 0.844 0.678 4.7e-286
UNIPROTKB|Q55700627 ftsH2 "ATP-dependent zinc meta 0.453 0.583 0.428 1.8e-71
TAIR|locus:2052806 695 VAR2 "VARIEGATED 2" [Arabidops 0.453 0.526 0.410 5.3e-71
TIGR_CMR|GSU_1809610 GSU_1809 "cell division protei 0.449 0.595 0.394 2.1e-68
TAIR|locus:2009235685 FTSH8 "FTSH protease 8" [Arabi 0.475 0.560 0.4 2.1e-68
UNIPROTKB|Q3AFJ8619 ftsH "ATP-dependent zinc metal 0.449 0.586 0.396 3.1e-67
TIGR_CMR|CHY_0214619 CHY_0214 "cell division protei 0.449 0.586 0.396 3.1e-67
UNIPROTKB|P37476 637 ftsH "ATP-dependent zinc metal 0.439 0.557 0.397 9.4e-66
TIGR_CMR|BA_0064 633 BA_0064 "cell division protein 0.439 0.560 0.395 1.5e-65
UNIPROTKB|Q5LNU8 639 ftsH "ATP-dependent zinc metal 0.458 0.579 0.386 2.5e-65
TAIR|locus:2138146 FtsHi1 "FTSH inactive protease 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2748 (972.4 bits), Expect = 4.7e-286, P = 4.7e-286
 Identities = 554/816 (67%), Positives = 632/816 (77%)

Query:     1 MTAIHSLISFRVELPKPYNYTKSIPKSAKPLKFTRKCQSRTN--FLHRSFTVLCEL---- 54
             M +I ++ S       P N  +SI K A    F+ + Q+R     L RSFTVLCEL    
Sbjct:     1 MASIDNVFSLGTRFSIPENPKRSILKHATTSSFSARTQTRWRAPILRRSFTVLCELKTGS 60

Query:    55 SQPGDTSK-PTEEDFVTRVLKENPSQVEPKYLIGERFYSLKERQNLSEKNDV--GIFQSL 111
             S  G+T+  P  +DFVTRVLKENPSQVEP+Y +G++ Y+LKER++LS+  +   G F+ +
Sbjct:    61 SSSGETNNSPAADDFVTRVLKENPSQVEPRYRVGDKLYNLKEREDLSKGTNAATGAFEFI 120

Query:   112 AXXXXXXXXXXXXXXXQNVSGSVYLKDILREYKGKLYVPEQVFGHELSEEEEFHKNVKEL 171
                             +    SVYL DILREYKGKLYVPEQVFG ELSEEEEF KNVK+L
Sbjct:   121 KRKFDSKKKTETDKSEE----SVYLSDILREYKGKLYVPEQVFGPELSEEEEFEKNVKDL 176

Query:   172 PKMSIEEFKKYMESDKVKLLTSKGINGVAFANGYRDFIVDLKDIPGNKKLQRTKWAMRLD 231
             PKMS+E+F+K ME+DKVKLLTSK ++GV++ +GYR FIVDLK+IPG K LQRTKW+M+L+
Sbjct:   177 PKMSLEDFRKAMENDKVKLLTSKEVSGVSYTSGYRGFIVDLKEIPGVKSLQRTKWSMKLE 236

Query:   232 DNEAQALLDEYTGPQYEIEKHMTSWVGKLPEYPHPVASSISSRLMVEXXXXXXXXXXXXX 291
               EAQALL EYTGPQYEIE+HMTSWVGK+ ++P+PVASSISSR+MVE             
Sbjct:   237 VGEAQALLKEYTGPQYEIERHMTSWVGKVADFPNPVASSISSRVMVELGMVTAVIAAAAV 296

Query:   292 XXXXXXXXXVFAVTSFIFVTTVYVVWPIARPFVNIFRGLILGIIENISDYIVDLSGEGGI 351
                      VFAVTSF FVTTVYVVWPIA+PF+ +F G+ LG++E   DYIVD+  +GGI
Sbjct:   297 VVGGFLASAVFAVTSFAFVTTVYVVWPIAKPFLKLFVGVFLGVLEKSWDYIVDVLADGGI 356

Query:   352 LSKFYEFYTFGGLSASLEMLKPXXXXXXXXXXXXRFTLSRRPKNFRKWDLWQGIDFSRSK 411
              S+  +FYTFGG+++SLEMLKP            RFTLSRRPKNFRKWDLWQGI FS+SK
Sbjct:   357 FSRISDFYTFGGVASSLEMLKPILLVVMTMVLLVRFTLSRRPKNFRKWDLWQGIAFSQSK 416

Query:   412 AEARVDGSTGVKFSDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGK 471
             AEARVDGSTGVKF+DVAGIDEAV+ELQELV+YLKNP+LFDKMGIKPPHGVLLEGPPGCGK
Sbjct:   417 AEARVDGSTGVKFADVAGIDEAVDELQELVKYLKNPDLFDKMGIKPPHGVLLEGPPGCGK 476

Query:   472 TLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALAT 531
             TLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALAT
Sbjct:   477 TLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALAT 536

Query:   532 RRQGIFKDTTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAATNXXXXXXXXXXXX 591
             RRQGIFK+ +D LYNAATQERETTLNQLLIELDGFDTGKGVIFL ATN            
Sbjct:   537 RRQGIFKENSDQLYNAATQERETTLNQLLIELDGFDTGKGVIFLGATNRRDLLDPALLRP 596

Query:   592 XXFDRKIRIRAPNAKGRTEILKIHASKVKMSDSVDLSSYAKNLPGWTGXXXXXXXXXXXX 651
               FDRKIR+R PNAKGR +ILKIHASKVKMSDSVDLSSYA NLPGW+G            
Sbjct:   597 GRFDRKIRVRPPNAKGRLDILKIHASKVKMSDSVDLSSYASNLPGWSGAKLAQLVQEAAL 656

Query:   652 XXXXKGHESILSSDMDDAVDRLTVGPKRRGIELGNQGQSRRAATEVGVAMISHLLRRYEN 711
                 K H SIL SDMDDAVDRLTVGP R G+ELG+QGQ RRA TEVGVA+ SHLL RYEN
Sbjct:   657 VAVRKTHNSILQSDMDDAVDRLTVGPTRIGLELGHQGQCRRATTEVGVAITSHLLLRYEN 716

Query:   712 AKVECCDRISIVPRGQTLSQLVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGQD 771
             AK+E CDR+SI+PRGQTLSQ+VFHRLDDESYMF R PQLLHRLQVLLGGRAAEEVIYG D
Sbjct:   717 AKIERCDRVSIIPRGQTLSQVVFHRLDDESYMFGRLPQLLHRLQVLLGGRAAEEVIYGSD 776

Query:   772 TSRASVNYLADASWLAHGIWRIQWSYMENHL--HGE 805
             TS+ASV+YL+DASWLA  I  I W+ +EN +  HGE
Sbjct:   777 TSKASVDYLSDASWLARKILTI-WN-LENPMVIHGE 810
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004222 "metalloendopeptidase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0008237 "metallopeptidase activity" evidence=ISS
GO:0009658 "chloroplast organization" evidence=IMP
GO:0016887 "ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0007020 "microtubule nucleation" evidence=RCA
GO:0010020 "chloroplast fission" evidence=IMP
GO:0009536 "plastid" evidence=IDA
UNIPROTKB|Q55700 ftsH2 "ATP-dependent zinc metalloprotease FtsH 2" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
TAIR|locus:2052806 VAR2 "VARIEGATED 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1809 GSU_1809 "cell division protein FtsH" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TAIR|locus:2009235 FTSH8 "FTSH protease 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q3AFJ8 ftsH "ATP-dependent zinc metalloprotease FtsH" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0214 CHY_0214 "cell division protein FtsH" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|P37476 ftsH "ATP-dependent zinc metalloprotease FtsH" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0064 BA_0064 "cell division protein FtsH" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q5LNU8 ftsH "ATP-dependent zinc metalloprotease FtsH" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.240.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query807
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 1e-142
COG0465596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 1e-120
CHL00176638 CHL00176, ftsH, cell division protein; Validated 1e-116
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 9e-97
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 2e-93
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 3e-90
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 1e-76
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 3e-63
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 6e-63
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 4e-62
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 5e-60
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 3e-58
pfam00004131 pfam00004, AAA, ATPase family associated with vari 4e-47
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 1e-44
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 5e-39
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 4e-32
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 1e-24
smart00382148 smart00382, AAA, ATPases associated with a variety 3e-17
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 1e-15
pfam01434212 pfam01434, Peptidase_M41, Peptidase family M41 1e-15
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 3e-10
PRK13342413 PRK13342, PRK13342, recombination factor protein R 6e-09
COG2256436 COG2256, MGS1, ATPase related to the helicase subu 2e-08
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-07
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 5e-07
TIGR00763775 TIGR00763, lon, ATP-dependent protease La 6e-07
COG1224450 COG1224, TIP49, DNA helicase TIP49, TBP-interactin 2e-05
COG0466782 COG0466, Lon, ATP-dependent Lon protease, bacteria 5e-05
pfam06068395 pfam06068, TIP49, TIP49 C-terminus 7e-05
pfam05496231 pfam05496, RuvB_N, Holliday junction DNA helicase 0.001
TIGR02639730 TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi 0.002
TIGR02928365 TIGR02928, TIGR02928, orc1/cdc6 family replication 0.002
PHA02544316 PHA02544, 44, clamp loader, small subunit; Provisi 0.002
COG2255332 COG2255, RuvB, Holliday junction resolvasome, heli 0.002
pfam01078207 pfam01078, Mg_chelatase, Magnesium chelatase, subu 0.002
PRK10787784 PRK10787, PRK10787, DNA-binding ATP-dependent prot 0.003
PRK00080328 PRK00080, ruvB, Holliday junction DNA helicase Ruv 0.003
PLN03025319 PLN03025, PLN03025, replication factor C subunit; 0.003
TIGR02881261 TIGR02881, spore_V_K, stage V sporulation protein 0.004
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information 
 Score =  428 bits (1103), Expect = e-142
 Identities = 190/409 (46%), Positives = 261/409 (63%), Gaps = 20/409 (4%)

Query: 368 LEMLKPITLVILTMVLLIRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDV 427
           L  L  +   IL +V +  F   +           +   F +SKA+   +    V F DV
Sbjct: 3   LGFLFSLLPPILLLVGVWFFFRRQMQGGGG-----RAFSFGKSKAKLLNEEKPKVTFKDV 57

Query: 428 AGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFY 487
           AGIDEA EEL E+V +LKNP  F K+G K P GVLL GPPG GKTL+AKA+AGEAGVPF+
Sbjct: 58  AGIDEAKEELMEIVDFLKNPSKFTKLGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFF 117

Query: 488 QMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKDTTDHLYNA 547
            ++GS+FVE+ VGVG++R+RDLF++AK N P +IFIDEIDA+  +R        D     
Sbjct: 118 SISGSDFVEMFVGVGASRVRDLFEQAKKNAPCIIFIDEIDAVGRQRGAGLGGGND----- 172

Query: 548 ATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRAPNAKG 607
              ERE TLNQLL+E+DGF T  GVI +AATNR D+LDPALLRPGRFDR++ +  P+ KG
Sbjct: 173 ---EREQTLNQLLVEMDGFGTNTGVIVIAATNRPDVLDPALLRPGRFDRQVVVDLPDIKG 229

Query: 608 RTEILKIHASKVKMSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAVRKGHESILSSDMD 667
           R EILK+HA   K++  VDL + A+  PG++GA LA L+ EAAL+A RK    I  +D++
Sbjct: 230 REEILKVHAKNKKLAPDVDLKAVARRTPGFSGADLANLLNEAALLAARKNKTEITMNDIE 289

Query: 668 DAVDRLTVGPKRRGIELGNQGQSRRAATEVGVAMISHLLRRYENAKVECCDRISIVPRGQ 727
           +A+DR+  GP+++   +  + +   A  E G A++  LL+  +   V    +++I+PRGQ
Sbjct: 290 EAIDRVIAGPEKKSRVISEKEKKLVAYHEAGHALVGLLLK--DADPV---HKVTIIPRGQ 344

Query: 728 TLSQLVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRAS 776
            L       L +E      + QLL ++ VLLGGRAAEE+I+G+ T+ AS
Sbjct: 345 ALG--YTQFLPEEDKYLYTKSQLLAQIAVLLGGRAAEEIIFGEVTTGAS 391

HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH [Cellular processes, Cell division, Protein fate, Degradation of proteins, peptides, and glycopeptides]. Length = 495
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|216502 pfam01434, Peptidase_M41, Peptidase family M41 Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|233119 TIGR00763, lon, ATP-dependent protease La Back     alignment and domain information
>gnl|CDD|224145 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>gnl|CDD|223542 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|147949 pfam06068, TIP49, TIP49 C-terminus Back     alignment and domain information
>gnl|CDD|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|234063 TIGR02928, TIGR02928, orc1/cdc6 family replication initiation protein Back     alignment and domain information
>gnl|CDD|222866 PHA02544, 44, clamp loader, small subunit; Provisional Back     alignment and domain information
>gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI Back     alignment and domain information
>gnl|CDD|182730 PRK10787, PRK10787, DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>gnl|CDD|178596 PLN03025, PLN03025, replication factor C subunit; Provisional Back     alignment and domain information
>gnl|CDD|163057 TIGR02881, spore_V_K, stage V sporulation protein K Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 807
KOG0731774 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0734752 consensus AAA+-type ATPase containing the peptidas 100.0
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 100.0
CHL00176638 ftsH cell division protein; Validated 100.0
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 100.0
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
CHL00206 2281 ycf2 Ycf2; Provisional 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 100.0
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 100.0
PRK03992389 proteasome-activating nucleotidase; Provisional 100.0
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 100.0
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 100.0
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 100.0
CHL00195489 ycf46 Ycf46; Provisional 100.0
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 100.0
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 100.0
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 99.97
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.97
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 99.97
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.97
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.97
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.95
PF01434213 Peptidase_M41: Peptidase family M41 This is family 99.92
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.84
CHL00181287 cbbX CbbX; Provisional 99.84
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.83
PF00004132 AAA: ATPase family associated with various cellula 99.82
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.82
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.79
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.77
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.76
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.76
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.75
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 99.75
KOG0736 953 consensus Peroxisome assembly factor 2 containing 99.75
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 99.71
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.69
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.69
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.69
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.67
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.66
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.66
PRK00149450 dnaA chromosomal replication initiation protein; R 99.65
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.65
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.65
PRK04195 482 replication factor C large subunit; Provisional 99.63
PRK14088440 dnaA chromosomal replication initiation protein; P 99.61
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.61
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.61
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.6
PRK06893229 DNA replication initiation factor; Validated 99.6
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.59
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.59
PRK13342413 recombination factor protein RarA; Reviewed 99.59
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.58
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.58
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.57
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.57
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.56
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.56
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.55
PRK14086617 dnaA chromosomal replication initiation protein; P 99.55
PRK12402337 replication factor C small subunit 2; Reviewed 99.55
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.55
PLN03025319 replication factor C subunit; Provisional 99.55
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.55
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.54
PRK12422445 chromosomal replication initiation protein; Provis 99.54
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.53
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.53
PRK08084235 DNA replication initiation factor; Provisional 99.52
PHA02544316 44 clamp loader, small subunit; Provisional 99.52
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.52
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.51
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.51
PRK13341 725 recombination factor protein RarA/unknown domain f 99.51
PRK10865 857 protein disaggregation chaperone; Provisional 99.5
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.5
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.49
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.49
PRK14087450 dnaA chromosomal replication initiation protein; P 99.49
CHL00095 821 clpC Clp protease ATP binding subunit 99.49
PTZ001121164 origin recognition complex 1 protein; Provisional 99.48
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.48
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.48
PRK08727233 hypothetical protein; Validated 99.48
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.47
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.47
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.47
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.46
PRK07940394 DNA polymerase III subunit delta'; Validated 99.46
KOG2028554 consensus ATPase related to the helicase subunit o 99.45
COG0593408 DnaA ATPase involved in DNA replication initiation 99.45
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.44
PRK05642234 DNA replication initiation factor; Validated 99.44
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.44
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.43
PRK00440319 rfc replication factor C small subunit; Reviewed 99.43
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.43
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.42
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.42
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.42
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.41
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.41
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.41
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.4
PRK06620214 hypothetical protein; Validated 99.4
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.4
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.4
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.39
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.39
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.38
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.38
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.38
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.38
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.37
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.37
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.37
COG2204464 AtoC Response regulator containing CheY-like recei 99.35
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.35
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.34
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.33
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.33
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.32
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.32
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.31
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.3
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.28
PRK09087226 hypothetical protein; Validated 99.28
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.27
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.25
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.25
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.24
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.23
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 99.21
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 99.19
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.18
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.17
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.17
PHA02244383 ATPase-like protein 99.17
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.17
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 99.17
KOG1969 877 consensus DNA replication checkpoint protein CHL12 99.16
PRK13531498 regulatory ATPase RavA; Provisional 99.16
PRK10865857 protein disaggregation chaperone; Provisional 99.15
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.14
PRK15424538 propionate catabolism operon regulatory protein Pr 99.13
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.13
smart00350509 MCM minichromosome maintenance proteins. 99.12
CHL00095821 clpC Clp protease ATP binding subunit 99.12
smart00382148 AAA ATPases associated with a variety of cellular 99.11
PRK09112351 DNA polymerase III subunit delta'; Validated 99.1
COG0714329 MoxR-like ATPases [General function prediction onl 99.09
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.09
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 99.08
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.07
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.07
COG1221403 PspF Transcriptional regulators containing an AAA- 99.06
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.06
PRK11608326 pspF phage shock protein operon transcriptional ac 99.05
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 99.03
PRK09862506 putative ATP-dependent protease; Provisional 99.03
PRK07471365 DNA polymerase III subunit delta'; Validated 99.02
PRK05564313 DNA polymerase III subunit delta'; Validated 99.0
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.0
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.99
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.99
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.99
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 98.99
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 98.99
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.97
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 98.97
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.96
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.96
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.92
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 98.92
PRK07399314 DNA polymerase III subunit delta'; Validated 98.91
PRK04132846 replication factor C small subunit; Provisional 98.9
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.87
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.86
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.84
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.81
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.81
PRK05707328 DNA polymerase III subunit delta'; Validated 98.8
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 98.78
KOG1514767 consensus Origin recognition complex, subunit 1, a 98.78
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.78
PTZ00111915 DNA replication licensing factor MCM4; Provisional 98.74
PRK08058329 DNA polymerase III subunit delta'; Validated 98.74
PRK13765 637 ATP-dependent protease Lon; Provisional 98.73
PRK08116268 hypothetical protein; Validated 98.71
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 98.69
PRK12377248 putative replication protein; Provisional 98.68
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 98.67
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.65
COG3283511 TyrR Transcriptional regulator of aromatic amino a 98.65
PRK15115444 response regulator GlrR; Provisional 98.63
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.62
KOG0745564 consensus Putative ATP-dependent Clp-type protease 98.59
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.58
PRK07952244 DNA replication protein DnaC; Validated 98.58
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 98.57
PRK08181269 transposase; Validated 98.54
PF07726131 AAA_3: ATPase family associated with various cellu 98.52
PRK10365441 transcriptional regulatory protein ZraR; Provision 98.51
PRK06526254 transposase; Provisional 98.51
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.51
PRK06964342 DNA polymerase III subunit delta'; Validated 98.5
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 98.5
PRK06871325 DNA polymerase III subunit delta'; Validated 98.5
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 98.48
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.48
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 98.46
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.45
PRK08939306 primosomal protein DnaI; Reviewed 98.42
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 98.41
PF13173128 AAA_14: AAA domain 98.41
PRK09183259 transposase/IS protein; Provisional 98.39
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.39
PRK07993334 DNA polymerase III subunit delta'; Validated 98.39
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 98.39
PRK08769319 DNA polymerase III subunit delta'; Validated 98.39
PRK06835329 DNA replication protein DnaC; Validated 98.38
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.35
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.32
PRK06090319 DNA polymerase III subunit delta'; Validated 98.29
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 98.29
PRK06921266 hypothetical protein; Provisional 98.24
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.2
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 98.17
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 98.14
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 98.12
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.12
PRK08699325 DNA polymerase III subunit delta'; Validated 98.12
PF05729166 NACHT: NACHT domain 98.11
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 98.1
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.1
KOG0480764 consensus DNA replication licensing factor, MCM6 c 98.1
COG1241682 MCM2 Predicted ATPase involved in replication cont 98.09
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 98.08
KOG0478804 consensus DNA replication licensing factor, MCM4 c 98.06
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.98
COG4178604 ABC-type uncharacterized transport system, permeas 97.98
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 97.98
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 97.97
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 97.97
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.94
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.89
COG1485367 Predicted ATPase [General function prediction only 97.81
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 97.79
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.78
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 97.78
KOG0482721 consensus DNA replication licensing factor, MCM7 c 97.75
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 97.73
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 97.7
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 97.69
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 97.68
KOG2170344 consensus ATPase of the AAA+ superfamily [General 97.67
TIGR02688449 conserved hypothetical protein TIGR02688. Members 97.66
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 97.64
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 97.64
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.63
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 97.63
PRK05917290 DNA polymerase III subunit delta'; Validated 97.61
PRK05818261 DNA polymerase III subunit delta'; Validated 97.58
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 97.57
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 97.56
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.55
PRK10790592 putative multidrug transporter membrane\ATP-bindin 97.55
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 97.55
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 97.55
PRK11823446 DNA repair protein RadA; Provisional 97.54
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.53
COG4619223 ABC-type uncharacterized transport system, ATPase 97.53
KOG2383467 consensus Predicted ATPase [General function predi 97.52
KOG0477854 consensus DNA replication licensing factor, MCM2 c 97.51
PRK07276290 DNA polymerase III subunit delta'; Validated 97.5
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.49
COG4650531 RtcR Sigma54-dependent transcription regulator con 97.49
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 97.49
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.49
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 97.48
PRK10789569 putative multidrug transporter membrane\ATP-bindin 97.46
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 97.45
PRK06067234 flagellar accessory protein FlaH; Validated 97.44
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.44
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 97.43
cd01128249 rho_factor Transcription termination factor rho is 97.43
PRK00131175 aroK shikimate kinase; Reviewed 97.42
cd01394218 radB RadB. The archaeal protein radB shares simila 97.39
KOG1968 871 consensus Replication factor C, subunit RFC1 (larg 97.39
PF14516331 AAA_35: AAA-like domain 97.38
PHA00729226 NTP-binding motif containing protein 97.38
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 97.38
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.37
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 97.37
PRK07132299 DNA polymerase III subunit delta'; Validated 97.36
cd00983325 recA RecA is a bacterial enzyme which has roles in 97.35
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 97.34
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 97.32
cd03216163 ABC_Carb_Monos_I This family represents the domain 97.3
PRK08118167 topology modulation protein; Reviewed 97.27
PRK07261171 topology modulation protein; Provisional 97.26
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.25
PRK09376416 rho transcription termination factor Rho; Provisio 97.25
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 97.25
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.23
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.23
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 97.22
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 97.2
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.18
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 97.15
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.15
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 97.14
KOG2543438 consensus Origin recognition complex, subunit 5 [R 97.14
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 97.13
KOG0481729 consensus DNA replication licensing factor, MCM5 c 97.1
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 97.1
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 97.1
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.08
PRK05973237 replicative DNA helicase; Provisional 97.08
PRK15455 644 PrkA family serine protein kinase; Provisional 97.08
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.07
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 97.06
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 97.04
KOG2228408 consensus Origin recognition complex, subunit 4 [R 97.03
COG1126240 GlnQ ABC-type polar amino acid transport system, A 97.03
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 97.01
PRK00771437 signal recognition particle protein Srp54; Provisi 97.0
PRK09354349 recA recombinase A; Provisional 96.98
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.97
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 96.97
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.94
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 96.94
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 96.94
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.93
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 96.92
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 96.92
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 96.9
PLN03130 1622 ABC transporter C family member; Provisional 96.9
PLN03232 1495 ABC transporter C family member; Provisional 96.89
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 96.88
PRK14974336 cell division protein FtsY; Provisional 96.88
PRK06762166 hypothetical protein; Provisional 96.88
COG4618580 ArpD ABC-type protease/lipase transport system, AT 96.88
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 96.87
PRK13947171 shikimate kinase; Provisional 96.87
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 96.86
PTZ002651466 multidrug resistance protein (mdr1); Provisional 96.86
cd03246173 ABCC_Protease_Secretion This family represents the 96.85
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 96.85
TIGR00767415 rho transcription termination factor Rho. Members 96.83
COG1117253 PstB ABC-type phosphate transport system, ATPase c 96.82
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 96.81
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 96.8
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 96.79
PRK03839180 putative kinase; Provisional 96.77
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 96.77
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 96.77
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 96.77
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 96.76
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 96.75
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 96.75
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 96.74
COG3842352 PotA ABC-type spermidine/putrescine transport syst 96.74
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 96.73
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 96.73
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 96.73
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 96.73
PRK10536262 hypothetical protein; Provisional 96.73
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.72
PRK13948182 shikimate kinase; Provisional 96.71
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 96.71
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 96.7
COG1136226 SalX ABC-type antimicrobial peptide transport syst 96.68
PRK04841 903 transcriptional regulator MalT; Provisional 96.68
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 96.68
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 96.66
PRK00625173 shikimate kinase; Provisional 96.66
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 96.66
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.63
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 96.63
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 96.62
PRK04296190 thymidine kinase; Provisional 96.62
cd03215182 ABC_Carb_Monos_II This family represents domain II 96.61
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 96.6
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 96.6
COG4988559 CydD ABC-type transport system involved in cytochr 96.59
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 96.59
PRK13949169 shikimate kinase; Provisional 96.58
PRK12339197 2-phosphoglycerate kinase; Provisional 96.58
PRK04328249 hypothetical protein; Provisional 96.58
PRK13946184 shikimate kinase; Provisional 96.57
COG0703172 AroK Shikimate kinase [Amino acid transport and me 96.57
PRK06217183 hypothetical protein; Validated 96.55
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 96.54
PRK10867433 signal recognition particle protein; Provisional 96.54
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 96.54
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 96.54
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 96.54
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 96.53
PRK14532188 adenylate kinase; Provisional 96.53
COG4525259 TauB ABC-type taurine transport system, ATPase com 96.53
PF13479213 AAA_24: AAA domain 96.53
PRK12608380 transcription termination factor Rho; Provisional 96.51
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 96.51
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 96.51
cd03269210 ABC_putative_ATPase This subfamily is involved in 96.51
PRK10416318 signal recognition particle-docking protein FtsY; 96.5
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 96.48
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 96.46
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 96.46
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 96.45
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 96.43
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.42
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 96.41
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 96.41
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 96.41
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.41
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 96.4
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 96.4
COG4133209 CcmA ABC-type transport system involved in cytochr 96.4
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 96.4
PRK13764602 ATPase; Provisional 96.4
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 96.39
PRK06696223 uridine kinase; Validated 96.37
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 96.37
PRK14531183 adenylate kinase; Provisional 96.37
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 96.36
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 96.34
PRK08154309 anaerobic benzoate catabolism transcriptional regu 96.34
PRK04301317 radA DNA repair and recombination protein RadA; Va 96.33
PRK14530215 adenylate kinase; Provisional 96.33
PHA02624647 large T antigen; Provisional 96.33
PTZ00088229 adenylate kinase 1; Provisional 96.33
PRK09519 790 recA DNA recombination protein RecA; Reviewed 96.33
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 96.32
TIGR02236310 recomb_radA DNA repair and recombination protein R 96.32
PLN02200234 adenylate kinase family protein 96.32
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 96.31
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 96.31
PRK03731171 aroL shikimate kinase II; Reviewed 96.29
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 96.29
PF12780268 AAA_8: P-loop containing dynein motor region D4; I 96.28
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 96.28
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.27
PRK13851344 type IV secretion system protein VirB11; Provision 96.27
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 96.27
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 96.26
PRK06547172 hypothetical protein; Provisional 96.26
PRK05057172 aroK shikimate kinase I; Reviewed 96.26
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 96.25
PF05272198 VirE: Virulence-associated protein E; InterPro: IP 96.24
PTZ00035337 Rad51 protein; Provisional 96.24
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 96.23
PRK13695174 putative NTPase; Provisional 96.21
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 96.19
COG1119257 ModF ABC-type molybdenum transport system, ATPase 96.17
PRK13833323 conjugal transfer protein TrbB; Provisional 96.17
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 96.17
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 96.16
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 96.15
PRK05541176 adenylylsulfate kinase; Provisional 96.15
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 96.15
smart00487201 DEXDc DEAD-like helicases superfamily. 96.14
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 96.14
cd03115173 SRP The signal recognition particle (SRP) mediates 96.14
PRK13894319 conjugal transfer ATPase TrbB; Provisional 96.14
TIGR00064272 ftsY signal recognition particle-docking protein F 96.11
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 96.1
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 96.09
COG4088261 Predicted nucleotide kinase [Nucleotide transport 96.08
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 96.08
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 96.07
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 96.07
PTZ00202550 tuzin; Provisional 96.07
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 96.06
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 96.05
PRK09302 509 circadian clock protein KaiC; Reviewed 96.04
PRK08099399 bifunctional DNA-binding transcriptional repressor 96.02
PRK11607377 potG putrescine transporter ATP-binding subunit; P 96.02
TIGR02533486 type_II_gspE general secretory pathway protein E. 96.01
PRK10522547 multidrug transporter membrane component/ATP-bindi 96.0
PRK14528186 adenylate kinase; Provisional 95.99
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 95.98
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=4.9e-80  Score=714.93  Aligned_cols=634  Identities=38%  Similarity=0.525  Sum_probs=474.3

Q ss_pred             cccccccccchhhcccCCCCCCCC-CCchhHHHHHhhcCCCCcCcccccccchhhhHhhhhccccCcc--chhHHHHHhh
Q 003619           39 SRTNFLHRSFTVLCELSQPGDTSK-PTEEDFVTRVLKENPSQVEPKYLIGERFYSLKERQNLSEKNDV--GIFQSLAEKL  115 (807)
Q Consensus        39 ~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~  115 (807)
                      +.....+|..+.+|..+.....++ ..+.++..+.++.+|++         +.+.+|...+..++.|.  +.++.   ..
T Consensus        23 ~~~~~~~r~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~---------~~~~~k~~~~~~~~~~~s~~~~~~---~~   90 (774)
T KOG0731|consen   23 ESSRSLRRFSETRSVLLIVRKENGSVAKVGAALGFLKKEPEK---------KLKLRKGASELSEKKNESVGIMED---VK   90 (774)
T ss_pred             ccccccccccceeeeecccccccccccchhhhhhhhcccchh---------hccccccchhhcccccccchhhhh---hh
Confidence            355667788888776443334444 88899999999999998         67777777666665544  33333   11


Q ss_pred             hcccccccccccCCCCCcccHHHHHHhhcCcccccccccccccchhHHHhhhhcccCcccHHHHHHhhhccceeEEeecC
Q 003619          116 NSKENSKKESDNQNVSGSVYLKDILREYKGKLYVPEQVFGHELSEEEEFHKNVKELPKMSIEEFKKYMESDKVKLLTSKG  195 (807)
Q Consensus       116 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  195 (807)
                      ..+.+          ...++.......++.++|.+++.........++         .+.+.++.+.     +.+.|+++
T Consensus        91 ~~~~~----------~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~---------~~~~~~~~~~-----~~~~t~~~  146 (774)
T KOG0731|consen   91 ESKRE----------KEQKSFESELLSSKTKLSRSEEGQELVRAQREE---------NRPLPDMRKR-----FVQSTPKG  146 (774)
T ss_pred             ccchh----------hhhcccccccccccccccchhhhhhhhhccccc---------CCCccccccc-----ceecchhH
Confidence            11111          112233344567899999999988776665554         2222232222     67778887


Q ss_pred             cccccccccccceeEEeccCCCccccccccceeecChhHHHHHHhhccCCeeEeeccccccccCCCCCCcccccccchhh
Q 003619          196 INGVAFANGYRDFIVDLKDIPGNKKLQRTKWAMRLDDNEAQALLDEYTGPQYEIEKHMTSWVGKLPEYPHPVASSISSRL  275 (807)
Q Consensus       196 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  275 (807)
                      ...  |...|..+.++.+   .-+-..+.-|.+-|.+.+.+.+.-..   ++...+++..++...-.             
T Consensus       147 ~~~--f~~~~~~~~~~~~---~~ei~~~df~~~~le~g~v~~~evv~---~~~~~rv~~~~~~~~~~-------------  205 (774)
T KOG0731|consen  147 LAV--FMEALDLDRVESG---WQEITWRDFKQKLLEKGEVGKLEVVN---PYAVVRVELDRGRIPGD-------------  205 (774)
T ss_pred             HHH--HHHHhcccccccc---ceeeeHHHHHHHHhhccceeeEEeec---cceeEEEEEeccccccc-------------
Confidence            766  6666776666654   11111223334444444333222111   23333333333322211             


Q ss_pred             hhhhhHHHHHHHHHHHHHhhhhhhhhccccceEEEEEEEEeccccccccccccccchhhhhhhHHHHHHhhcCCCccccc
Q 003619          276 MVELGMVTAIMAAAAAIVGGFLASAVFAVTSFIFVTTVYVVWPIARPFVNIFRGLILGIIENISDYIVDLSGEGGILSKF  355 (807)
Q Consensus       276 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  355 (807)
                                                         ...+++|=.+.+            ++.+.+.+..+.-..++....
T Consensus       206 -----------------------------------~~~~~~~~~i~~------------v~~F~~kl~~a~~~l~~~~~~  238 (774)
T KOG0731|consen  206 -----------------------------------RLIQKVWFNIRS------------VDNFERKLDEAQRNLGIDTVV  238 (774)
T ss_pred             -----------------------------------cceeeEEEEecc------------cchHHHHHHHHHHHhCCCcee
Confidence                                               122233322222            333334444444444444433


Q ss_pred             cccc---CcchHHHHHHhHHHHHHHHHHHHHHHHHHHhcCCC---Cccccccccccccccccc--ccccCCCCCcccCcc
Q 003619          356 YEFY---TFGGLSASLEMLKPITLVILTMVLLIRFTLSRRPK---NFRKWDLWQGIDFSRSKA--EARVDGSTGVKFSDV  427 (807)
Q Consensus       356 ~~~~---~~g~~~~~l~~l~~~~~~~~~~~~l~~~~~~~~~~---~~~~~~~~~~~~~~~~~~--~~~~~~~~~v~F~dV  427 (807)
                      ..++   ..+.+...+..+.|.++.+..+..     +.+...   ............|+.+++  +...+..++++|+||
T Consensus       239 ~~pV~~~~~~~~~~~~~~~~pti~~~~~l~~-----l~r~~~~~~~~~~gg~~g~~~f~~~ks~~k~~~~~~t~V~FkDV  313 (774)
T KOG0731|consen  239 RVPVTYISESLLDLILGLLLPTILLLGGLLY-----LSRRSEGMGKGGPGGGLGPRLFGVSKSYKKFKNEGNTGVKFKDV  313 (774)
T ss_pred             EeeeEEeecchhhhhhhhhhHHHHHHHhHhe-----eeeecccccccCCccccCcceeeeccceeeeccCCCCCCccccc
Confidence            3333   223333344445552222222222     222111   111111112133444444  444567788999999


Q ss_pred             cccHHHHHHHHHHHHHhcChhhhhhcCCCCCceEEEEcCCCChHHHHHHHHHHhcCCCEEEEeCchhHHHHhhhhhHHHH
Q 003619          428 AGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIR  507 (807)
Q Consensus       428 vG~devkeeL~eiV~~L~~pe~~~~lGl~~p~gVLL~GPPGTGKT~LArALA~elg~pfi~Is~sel~~~~vG~~~~~ir  507 (807)
                      +|++++|++|.|++.+|++|+.|+++|++.|+|+||+||||||||+||||+|+|+++||+.+++++|++.++|.+..+++
T Consensus       314 AG~deAK~El~E~V~fLKNP~~Y~~lGAKiPkGvLL~GPPGTGKTLLAKAiAGEAgVPF~svSGSEFvE~~~g~~asrvr  393 (774)
T KOG0731|consen  314 AGVDEAKEELMEFVKFLKNPEQYQELGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSVSGSEFVEMFVGVGASRVR  393 (774)
T ss_pred             cCcHHHHHHHHHHHHHhcCHHHHHHcCCcCcCceEEECCCCCcHHHHHHHHhcccCCceeeechHHHHHHhcccchHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCCcEEEeccchhhhhhhcCcccCcchhhhhhhhHHHHHHHHHHHHhhcCCCCCCceEEEeccCccCCCCcc
Q 003619          508 DLFKRAKVNKPSVIFIDEIDALATRRQGIFKDTTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPA  587 (807)
Q Consensus       508 ~lF~~A~~~~PsILfIDEID~L~~~r~~~~~~~~d~~~~~~~~e~~~tLn~LL~eLdg~~~~~~VIVIAATN~pd~LDpA  587 (807)
                      ++|..|+.++|||+||||||+++..|++..       ....+++.++++||||.+||++....+|+|+|+||+++.||+|
T Consensus       394 ~lf~~ar~~aP~iifideida~~~~r~G~~-------~~~~~~e~e~tlnQll~emDgf~~~~~vi~~a~tnr~d~ld~a  466 (774)
T KOG0731|consen  394 DLFPLARKNAPSIIFIDEIDAVGRKRGGKG-------TGGGQDEREQTLNQLLVEMDGFETSKGVIVLAATNRPDILDPA  466 (774)
T ss_pred             HHHHHhhccCCeEEEecccccccccccccc-------cCCCChHHHHHHHHHHHHhcCCcCCCcEEEEeccCCccccCHH
Confidence            999999999999999999999998885211       1226778999999999999999999999999999999999999


Q ss_pred             cCCCccccEEEeccCCCHHHHHHHHHHHhhcCCCC-CccCHHHHHhhCCCCcHHHHHHHHHHHHHHHHHhCCCccCHHHH
Q 003619          588 LLRPGRFDRKIRIRAPNAKGRTEILKIHASKVKMS-DSVDLSSYAKNLPGWTGARLAQLVQEAALVAVRKGHESILSSDM  666 (807)
Q Consensus       588 LlRpGRFdr~I~I~lPd~eeR~eILk~~L~~~~l~-~dvdL~~LA~~T~GfSgaDL~~Lv~eAal~A~rr~~~~It~edl  666 (807)
                      |+||||||++|++++|+..+|.+|++.|+++.++. +++|+..+|..|+||+|+||.|+||+|+..|.+++...|+..|+
T Consensus       467 llrpGRfdr~i~i~~p~~~~r~~i~~~h~~~~~~~~e~~dl~~~a~~t~gf~gadl~n~~neaa~~a~r~~~~~i~~~~~  546 (774)
T KOG0731|consen  467 LLRPGRFDRQIQIDLPDVKGRASILKVHLRKKKLDDEDVDLSKLASLTPGFSGADLANLCNEAALLAARKGLREIGTKDL  546 (774)
T ss_pred             hcCCCccccceeccCCchhhhHHHHHHHhhccCCCcchhhHHHHHhcCCCCcHHHHHhhhhHHHHHHHHhccCccchhhH
Confidence            99999999999999999999999999999999986 78889999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcCCcccCcccccCcchhHHHHHHHHHHHHHHhhhcccccccccceeEeecCCccCceeEEecccccccccCC
Q 003619          667 DDAVDRLTVGPKRRGIELGNQGQSRRAATEVGVAMISHLLRRYENAKVECCDRISIVPRGQTLSQLVFHRLDDESYMFER  746 (807)
Q Consensus       667 ~~Al~rv~~g~~~~~~~l~~~ek~~iA~hEaGhAvva~lL~~~~~~~~~~v~~vsI~pRg~~lG~~~~~~~~~~~~~~~t  746 (807)
                      ..|++|++.|...+...++.++++.+|+||+|||+++|+++++     +++.+++|+| |+++||++|.|.+  .++++ 
T Consensus       547 ~~a~~Rvi~G~~~~~~~~~~~~~~~~a~~eagha~~g~~l~~~-----dpl~kvsIiP-GqalG~a~~~P~~--~~l~s-  617 (774)
T KOG0731|consen  547 EYAIERVIAGMEKKSRVLSLEEKKTVAYHEAGHAVVGWLLEHA-----DPLLKVSIIP-GQALGYAQYLPTD--DYLLS-  617 (774)
T ss_pred             HHHHHHHhccccccchhcCHhhhhhhhhhhccchhhhcccccc-----CcceeEEecc-CCccceEEECCcc--ccccc-
Confidence            9999999999999899999999999999999999999998877     9999999999 7799999999973  35555 


Q ss_pred             HHHHHHHHHHHhhHHHHHHHHhC-CCCcccCCchHHHHHHHHHHHHHhhccCCCC
Q 003619          747 RPQLLHRLQVLLGGRAAEEVIYG-QDTSRASVNYLADASWLAHGIWRIQWSYMEN  800 (807)
Q Consensus       747 r~~l~~~I~v~LaGRaAEel~fG-~~stga~~d~l~~At~lA~~~v~~~~G~~~~  800 (807)
                      +++|+++||+.|||||||+++|| ++||||.+| +++||++|++||.. || |++
T Consensus       618 k~ql~~rm~m~LGGRaAEev~fg~~iTtga~dd-l~kvT~~A~~~V~~-~G-ms~  669 (774)
T KOG0731|consen  618 KEQLFDRMVMALGGRAAEEVVFGSEITTGAQDD-LEKVTKIARAMVAS-FG-MSE  669 (774)
T ss_pred             HHHHHHHHHHHhCcchhhheecCCccCchhhcc-HHHHHHHHHHHHHH-cC-ccc
Confidence            99999999999999999999997 789999888 99999999999998 99 876

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01434 Peptidase_M41: Peptidase family M41 This is family M41 in the peptidase classification Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>KOG2383 consensus Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query807
2ce7_A476 Edta Treated Length = 476 1e-72
3kds_E465 Apo-ftsh Crystal Structure Length = 465 4e-72
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 4e-65
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 5e-65
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 3e-54
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 3e-51
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 1e-50
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 3e-50
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 9e-50
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 2e-46
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 1e-37
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 1e-36
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 2e-36
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 2e-36
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 2e-36
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 2e-36
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 3e-36
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 2e-35
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 9e-35
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 6e-34
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 3e-32
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 4e-32
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 9e-32
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 4e-29
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 4e-23
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 1e-22
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 1e-22
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 1e-22
3vfd_A389 Human Spastin Aaa Domain Length = 389 1e-21
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 6e-21
1xwi_A322 Crystal Structure Of Vps4b Length = 322 2e-20
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 2e-19
3b9p_A297 Spastin Length = 297 7e-19
1ofh_A310 Asymmetric Complex Between Hslv And I-domain Delete 1e-05
2di4_A 238 Crystal Structure Of The Ftsh Protease Domain Lengt 5e-05
3m6a_A543 Crystal Structure Of Bacillus Subtilis Lon C-Termin 3e-04
3pvs_A447 Structure And Biochemical Activities Of Escherichia 4e-04
2c9o_A456 3d Structure Of The Human Ruvb-Like Helicase Ruvbl1 5e-04
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure 
Iteration: 1

 Score =  271 bits (693), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 149/373 (39%), Positives = 220/373 (58%), Gaps = 15/373 (4%)
Query: 418 GSTGVKFSDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKA 477
           G+  V F DV G +EA+EEL+E+V +LK+P  F+++G + P G+LL GPPG GKTL+A+A
Sbjct: 9   GNKRVTFKDVGGAEEAIEELKEVVEFLKDPSKFNRIGARMPKGILLVGPPGTGKTLLARA 68
Query: 478 IAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIF 537
           +AGEA VPF+ ++GS+FVE+ VGVG+AR+RDLF +AK + P ++FIDEIDA+   R    
Sbjct: 69  VAGEANVPFFHISGSDFVELFVGVGAARVRDLFAQAKAHAPCIVFIDEIDAVGRHRGAGL 128
Query: 538 KDTTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAATNXXXXXXXXXXXXXXFDRK 597
               D        ERE TLNQLL+E+DGFD+ +G+I +AATN              FD+K
Sbjct: 129 GGGHD--------EREQTLNQLLVEMDGFDSKEGIIVMAATNRPDILDPALLRPGRFDKK 180
Query: 598 IRIRAPNAKGRTEILKIHASKVKMSDSVDLSSYAKNLPGWTGXXXXXXXXXXXXXXXXKG 657
           I +  P+  GR +IL+IH     +++ V+L   AK  PG+ G                +G
Sbjct: 181 IVVDPPDMLGRKKILEIHTRNKPLAEDVNLEIIAKRTPGFVGADLENLVNEAALLAAREG 240
Query: 658 HESILSSDMDDAVDRLTVGPKRRGIELGNQGQSRRAATEVGVAMISHLLRRYENAKVECC 717
            + I   D ++A+DR+  GP R+ + +    +   A  E G A++S ++        E  
Sbjct: 241 RDKITMKDFEEAIDRVIAGPARKSLLISPAEKRIIAYHEAGHAVVSTVV-----PNGEPV 295
Query: 718 DRISIVPRGQTLSQLVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRASV 777
            RISI+PRG        H  +++ Y+  R  +LL +L  LLGGRAAEEV++G  TS A+ 
Sbjct: 296 HRISIIPRGYKALGYTLHLPEEDKYLVSRN-ELLDKLTALLGGRAAEEVVFGDVTSGAA- 353
Query: 778 NYLADASWLAHGI 790
           N +  A+ +A  +
Sbjct: 354 NDIERATEIARNM 366
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|1OFH|A Chain A, Asymmetric Complex Between Hslv And I-domain Deleted Hslu (h. Influenzae) Length = 310 Back     alignment and structure
>pdb|2DI4|A Chain A, Crystal Structure Of The Ftsh Protease Domain Length = 238 Back     alignment and structure
>pdb|3M6A|A Chain A, Crystal Structure Of Bacillus Subtilis Lon C-Terminal Domain Length = 543 Back     alignment and structure
>pdb|3PVS|A Chain A, Structure And Biochemical Activities Of Escherichia Coli Mgsa Length = 447 Back     alignment and structure
>pdb|2C9O|A Chain A, 3d Structure Of The Human Ruvb-Like Helicase Ruvbl1 Length = 456 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query807
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 1e-138
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 1e-137
2r62_A268 Cell division protease FTSH homolog; ATPase domain 1e-122
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 1e-121
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 1e-118
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 1e-116
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 1e-116
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 8e-97
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 9e-89
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 2e-88
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 2e-85
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 7e-84
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-70
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 7e-67
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 2e-65
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 4e-64
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 5e-64
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 9e-63
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 2e-62
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 1e-59
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 2e-59
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 2e-57
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 7e-23
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 2e-22
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 3e-21
2krk_A86 26S protease regulatory subunit 8; structural geno 2e-20
3kw6_A78 26S protease regulatory subunit 8; structural geno 2e-19
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 5e-17
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 6e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-11
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 3e-09
3pvs_A447 Replication-associated recombination protein A; ma 7e-09
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 4e-08
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 1e-07
2di4_A 238 Zinc protease, cell division protein FTSH homolog; 1e-07
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 7e-06
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 9e-06
2chg_A226 Replication factor C small subunit; DNA-binding pr 1e-05
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 1e-05
2chq_A319 Replication factor C small subunit; DNA-binding pr 2e-05
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 3e-05
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 5e-05
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 1e-04
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 1e-04
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 3e-04
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 3e-04
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 6e-04
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 6e-04
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
 Score =  417 bits (1075), Expect = e-138
 Identities = 169/373 (45%), Positives = 238/373 (63%), Gaps = 23/373 (6%)

Query: 407 FSRSKAEARVDGSTGVKFSDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGP 466
           F++S+A    +    V F DVAG +EA EEL+E+V +LKNP  F +MG + P GVLL GP
Sbjct: 14  FTKSRARVLTEAPK-VTFKDVAGAEEAKEELKEIVEFLKNPSRFHEMGARIPKGVLLVGP 72

Query: 467 PGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEI 526
           PG GKT +A+A+AGEA VPF   +GS+FVE+ VGVG+AR+RDLF+ AK + P ++FIDEI
Sbjct: 73  PGVGKTHLARAVAGEARVPFITASGSDFVEMFVGVGAARVRDLFETAKRHAPCIVFIDEI 132

Query: 527 DALATRRQGIFKDTTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDP 586
           DA+  +R        D        ERE TLNQLL+E+DGF+    ++ +AATNR D+LDP
Sbjct: 133 DAVGRKRGSGVGGGND--------EREQTLNQLLVEMDGFEKDTAIVVMAATNRPDILDP 184

Query: 587 ALLRPGRFDRKIRIRAPNAKGRTEILKIHASKVKMSDSVDLSSYAKNLPGWTGARLAQLV 646
           ALLRPGRFDR+I I AP+ KGR +IL+IHA    +++ VDL+  AK  PG+ GA L  L+
Sbjct: 185 ALLRPGRFDRQIAIDAPDVKGREQILRIHARGKPLAEDVDLALLAKRTPGFVGADLENLL 244

Query: 647 QEAALVAVRKGHESILSSDMDDAVDRLTVGPKRRGIELGNQGQSRRAATEVGVAMISHLL 706
            EAAL+A R+G   I   D+++A DR+ + P ++ + L  + +   A  E G A+ +H L
Sbjct: 245 NEAALLAAREGRRKITMKDLEEAADRVMMLPAKKSLVLSPRDRRITAYHEAGHALAAHFL 304

Query: 707 RRYENAKVECCD---RISIVPRGQTLSQLVFHRLDDESYMFERRPQLLHRLQVLLGGRAA 763
                   E  D   +++IVPRG+ L   +  R +D  +    R +LL ++ V L GRAA
Sbjct: 305 --------EHADGVHKVTIVPRGRALG-FMMPRREDMLHW--SRKRLLDQIAVALAGRAA 353

Query: 764 EEVIYGQDTSRAS 776
           EE+++   T+ A 
Sbjct: 354 EEIVFDDVTTGAE 366
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Length = 412 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>2di4_A Zinc protease, cell division protein FTSH homolog; metalloproteinase, hexamer-ring, hydrolase; 2.79A {Aquifex aeolicus} SCOP: a.269.1.1 Length = 238 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Length = 324 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Length = 310 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 323 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 340 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Length = 191 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} PDB: 2axp_A* Length = 173 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Length = 368 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 807
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 3e-97
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 7e-94
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 3e-66
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 1e-59
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 5e-53
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 1e-39
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 3e-38
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 6e-34
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 2e-28
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 1e-21
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 2e-20
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 5e-18
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 4e-12
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 3e-09
d1g41a_443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 7e-09
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 6e-08
d2ce7a1193 a.269.1.1 (A:411-603) Cell division protein FtsH, 2e-07
d2di4a1202 a.269.1.1 (A:406-607) Cell division protein FtsH, 4e-07
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 6e-06
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 3e-05
d1sxje2252 c.37.1.20 (E:4-255) Replication factor C5 {Baker's 2e-04
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 6e-04
d1qvra3315 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus 0.001
d1knqa_171 c.37.1.17 (A:) Gluconate kinase {Escherichia coli 0.002
d1a5ta2207 c.37.1.20 (A:1-207) delta prime subunit of DNA pol 0.002
d1sxjd2237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 0.003
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

 Score =  300 bits (771), Expect = 3e-97
 Identities = 128/255 (50%), Positives = 177/255 (69%), Gaps = 8/255 (3%)

Query: 422 VKFSDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGE 481
             F+DVAG DEA EE+ ELV YL+ P  F K+G K P GVL+ GPPG GKTL+AKAIAGE
Sbjct: 9   TTFADVAGCDEAKEEVAELVEYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGE 68

Query: 482 AGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKDTT 541
           A VPF+ ++GS+FVE+ VGVG++R+RD+F++AK   P +IFIDEIDA+  +R        
Sbjct: 69  AKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQR-------- 120

Query: 542 DHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIR 601
                    ERE TLNQ+L+E+DGF+  +G+I +AATNR D+LDPALLRPGRFDR++ + 
Sbjct: 121 GAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVG 180

Query: 602 APNAKGRTEILKIHASKVKMSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAVRKGHESI 661
            P+ +GR +ILK+H  +V ++  +D +  A+  PG++GA LA LV EAAL A R     +
Sbjct: 181 LPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKRVV 240

Query: 662 LSSDMDDAVDRLTVG 676
              + + A D++ +G
Sbjct: 241 SMVEFEKAKDKIMMG 255
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d2ce7a1 a.269.1.1 (A:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 193 Back     information, alignment and structure
>d2di4a1 a.269.1.1 (A:406-607) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 202 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 315 Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 207 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query807
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 100.0
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.96
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.95
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.93
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.93
d2ce7a1193 Cell division protein FtsH, C-terminal domain {The 99.92
d2di4a1202 Cell division protein FtsH, C-terminal domain {Aqu 99.91
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.85
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.83
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.82
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.82
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.82
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.82
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.81
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.77
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.77
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.75
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.75
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.72
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.68
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.65
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.64
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.62
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.6
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.57
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.51
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.48
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.46
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 99.38
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.17
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.03
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.44
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.43
d2hyda1255 Putative multidrug export ATP-binding/permease pro 97.97
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.95
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 97.91
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.89
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 97.86
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.85
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.79
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.78
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.72
d1g2912240 Maltose transport protein MalK, N-terminal domain 97.7
d2awna2232 Maltose transport protein MalK, N-terminal domain 97.67
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 97.6
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.59
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 97.59
d2qy9a2211 GTPase domain of the signal recognition particle r 97.59
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.58
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 97.57
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.56
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.55
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.53
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.5
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.5
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.49
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 97.48
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.47
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.45
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 97.41
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 97.4
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.39
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.35
d1okkd2207 GTPase domain of the signal recognition particle r 97.33
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.32
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.27
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.26
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 97.24
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.24
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.23
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.22
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 97.22
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.21
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.18
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.17
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.14
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.13
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 97.11
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.09
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.06
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 97.06
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 97.02
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.02
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.01
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.98
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 96.96
d1vmaa2213 GTPase domain of the signal recognition particle r 96.96
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.94
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.91
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.9
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.89
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.89
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.88
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.86
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 96.84
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.83
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.82
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.79
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.76
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.69
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.63
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.6
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 96.48
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.42
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.29
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.26
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.2
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.14
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 96.09
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 96.08
d2fh5b1207 Signal recognition particle receptor beta-subunit 96.02
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.98
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.92
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.9
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 95.86
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.83
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.81
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.78
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 95.6
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.58
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.5
d1tuea_205 Replication protein E1 helicase domain {Human papi 95.47
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.27
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.24
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.23
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 95.22
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 95.22
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 95.2
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 95.1
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 95.06
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.05
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 94.99
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.99
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 94.87
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 94.77
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 94.64
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.53
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.52
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 94.47
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 94.44
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.3
d1nrjb_209 Signal recognition particle receptor beta-subunit 94.17
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.11
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.11
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.09
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 94.05
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 93.96
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 93.78
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 93.63
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 93.61
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 93.48
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 93.36
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.12
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 93.0
d1xpua3289 Transcription termination factor Rho, ATPase domai 92.89
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 92.84
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 92.72
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.7
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.56
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 92.53
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.32
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 92.31
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 92.19
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 92.19
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 92.13
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 91.88
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 91.67
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 91.43
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 91.41
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.36
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 91.36
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 91.23
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 91.19
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.15
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 91.03
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.63
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 90.39
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 90.29
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 90.23
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.19
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 90.15
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 90.15
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 90.13
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 90.07
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 90.03
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 89.99
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 89.96
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 89.93
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 89.84
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.62
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.55
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 89.55
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 89.55
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 89.54
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 89.52
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 89.31
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 89.29
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 89.29
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.12
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 89.05
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 89.01
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 88.91
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 88.84
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 88.81
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 88.5
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 88.49
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 88.4
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 88.39
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 88.33
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.21
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 88.17
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 88.04
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 87.98
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 87.94
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 87.77
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 87.68
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 87.61
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 87.58
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 87.4
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 87.29
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 87.01
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 86.79
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 86.76
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 86.75
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 86.5
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 86.49
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 86.23
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 86.07
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 85.79
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 85.6
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 85.18
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 85.17
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 84.89
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 84.08
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 84.03
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 83.93
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 83.02
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 82.74
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 82.72
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 82.14
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 82.02
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 82.0
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 81.61
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 81.57
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 81.42
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=0  Score=366.04  Aligned_cols=254  Identities=50%  Similarity=0.876  Sum_probs=237.8

Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCEEEEECCHHH
Q ss_conf             47898854574336389999999999991490233102998995399985999849999999999419988998171257
Q 003619          416 VDGSTGVKFSDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  495 (807)
Q Consensus       416 ~~~~~~v~F~dIvG~devkeeL~eiI~~L~~pe~~~~lG~~~pkGILL~GPPGTGKTlLAkAIA~ea~~pfi~is~sel~  495 (807)
                      .++.+.++|+||+|++++|++|++++.++++++.|+.+|.++|+|+||+||||||||++|+++|++++.+++.++++++.
T Consensus         3 ~~~~~~~t~~Di~Gl~~~k~~l~e~v~~~~~~~~~~~~g~~~~~~iLL~GppGtGKT~la~~iA~~~~~~~~~i~~~~l~   82 (256)
T d1lv7a_           3 TEDQIKTTFADVAGCDEAKEEVAELVEYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFV   82 (256)
T ss_dssp             EECSSCCCGGGSCSCHHHHHHTHHHHHHHHCGGGC-----CCCCEEEEECCTTSCHHHHHHHHHHHHTCCEEEECSCSST
T ss_pred             CCCCCCCCHHHHHCHHHHHHHHHHHHHHHHCHHHHHHCCCCCCCEEEEECCCCCCCCHHHHHHHHHCCCCEEEEEHHHHH
T ss_conf             88899989999816399999999999998799999986999888678668998882289999999829987998869942


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEE
Q ss_conf             89853214799999999882899379963300565310276567510110131489999999999852198899815898
Q 003619          496 EVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKDTTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFL  575 (807)
Q Consensus       496 ~~~vG~s~~~ir~lF~~Ak~~~PsILfIDEIDsL~~~r~~~~~~~~d~~~~~~~~e~~~tLnqLL~eLDgl~~~~~VIVI  575 (807)
                      +.|+|+++.+++.+|+.|+..+||||||||+|.++..++.....        .......++++|+.++|++..+.+|+||
T Consensus        83 ~~~~g~~~~~l~~~f~~A~~~~P~il~iDeiD~l~~~r~~~~~~--------~~~~~~~~~~~ll~~~d~~~~~~~v~vI  154 (256)
T d1lv7a_          83 EMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGG--------GHDEREQTLNQMLVEMDGFEGNEGIIVI  154 (256)
T ss_dssp             TSCCCCCHHHHHHHHHHHHTTCSEEEEETTHHHHTCCCSTTSCC--------TTCHHHHHHHHHHHHHHTCCSSSCEEEE
T ss_pred             HCCHHHHHHHHHHHHHHHHHCCCEEEEEECHHHHCCCCCCCCCC--------CCHHHHHHHHHHHHHHHCCCCCCCEEEE
T ss_conf             60010789999999999997599899997756657567898888--------7489999999999995387777998999


Q ss_pred             ECCCCCCCCCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             31586687893457886333788136899889999999986028888743778898619999699999999999999888
Q 003619          576 AATNRRDLLDPALLRPGRFDRKIRIRAPNAKGRTEILKIHASKVKMSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAVR  655 (807)
Q Consensus       576 aATN~pd~LDpALlRpGRFdr~I~I~lPd~eeR~eILk~~l~~~~l~~dvdL~~LA~~T~G~SgaDL~nLv~eAal~Air  655 (807)
                      ||||+|+.+|++++||||||..|+|++|+.++|.+||+.++++..+..++++..++..|.||+++||.+++++|+..|.+
T Consensus       155 atTn~~~~ld~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~~~~~~~~~~~~la~~t~G~s~adi~~l~~~A~~~a~~  234 (256)
T d1lv7a_         155 AATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAAR  234 (256)
T ss_dssp             EEESCTTTSCGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTTSCBCTTCCHHHHHHTCTTCCHHHHHHHHHHHHHHHHH
T ss_pred             EECCCCCCCCHHHCCCCCCCEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             80799310798576898787798779959999999999842599868656999999868998999999999999999998


Q ss_pred             HCCCCCCHHHHHHHHHHHHCCC
Q ss_conf             1998647988999997871698
Q 003619          656 KGHESILSSDMDDAVDRLTVGP  677 (807)
Q Consensus       656 r~~~~It~edI~~Ai~rv~~g~  677 (807)
                      +++..|+..|++.|+++++.|.
T Consensus       235 ~~~~~i~~~d~~~Al~rv~~g~  256 (256)
T d1lv7a_         235 GNKRVVSMVEFEKAKDKIMMGL  256 (256)
T ss_dssp             TTCSSBCHHHHHHHHHHHTTCC
T ss_pred             CCCCCCCHHHHHHHHHHHHCCC
T ss_conf             2898348999999999996699
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ce7a1 a.269.1.1 (A:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2di4a1 a.269.1.1 (A:406-607) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure