Citrus Sinensis ID: 003639


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800------
MGSQKNFSIDILNEEEAWRLFKLVADDHVENREFKSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKIFMLCSLLGNSICTSYLFQCCMGLGILQKVNKLEDARNKLYALVHELRDSCLLLEGDSNQELSMHDVIRDVAISIACREQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLECPRLEFLHINPKDSLFDINNPCNFFTGMRKLRVVDFTRMQLLLLPSSIDLLVNLQTLCLVECMLDDIAIIGKLKNLEILSFWGSGIVKLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEELYMSNCFVEWDDEGPNSERINARLDELMHLPRLATLEVHVKNDNVLPEGFFARKLERLSWALFAIDDHETMRTLKLKLNSVSICSKKLQGIKDVEYLCLEKLQDVKNVLFDLDTEGFSQLKHLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLIKLERICQDRLSVQSFNELKTIRVEHCDQLSNIFLLSAAKCLPRLERIAVINCRNIQEIFAVDGEYDAIDHQRIEFGQLRTLCLGSLPELTSFCCGVKKNRQAQGMHETCSNEISSLEDKLDISSALFNEKVALSNLEVLEMNKVNIEKIWPNQLPVAMFLCFQNLTRLILRKCPKLKYIFSASMLGSFEHLQHLEIRHCKGLQEIISKEGADDHVPPNFVFLQVTTLILLGLPELKCLYPGMHTSEWPALKLLDVSACDQVTVFDSELFSFFKSSEEDKPDIPARQPLFLLEKV
cccccEEEcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccHHHHHHHcccccccHHHHHHHHHcccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccEEEccccEEEEccHHHHHHHHHHHccccEEEEEccccccccccccEEEEEEEEEEccccccccccccccccEEEEcccccccccccccccccccccccEEEEccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccHHHHccccccEEEEcccccccccccccccccccccEEcccccEEEcccccccHHHHHHHcccccccccccEEEEEEcccccccccccccccccccEEEcccccccccccEEEcccccccccccccccccccEEccccccccccccccccccccccccEEEEEcccccEEEEccccccccccccccccEEEEEccccccEEccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccEEccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEEEEcccccccccccccccccccccEEEEEccccccEEccccccccccccccccccccEEEEEccccccEEcccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccc
cccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccHHHHEEcHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccccccEEEHHHHHHHHHHHHHccccEEEEEccccccccccccccccEEEEEEcccccccccccccccccEEEEEcccccccEcccccHHHHcccccEEEEEcccccccccccccccccccEEEEcccccccccccccccccEEEEEcccccccccccHcccccccEEEEccccccccccHHHHHccccccEEEEccccccEcccccccccccccHHHHcccccccccccccccccccHHHcccccHHHcccccccccccccccEEEEcccccccccccccccccccEEEEEccccccccccccccccccccEEEEEcccccHEEccccccccccccccccccEEEEcccccccEccccccccccccccEEEEEcccHHHHHcccccHHcccccccEEEEcccccccEcccccccccHccccccccccccEEEEccccccccccccccccccccccccccEEEEccccccccccHHHccccccccccEEEEccccccEEccccccccccccccccccEEEEcccccccccccHHHHcccccccEEEEcccccHHEccccccccccccccccccccEEEEEcccccHHHccccccccccccccEEEEccccccccccccccccccccEEEccccccHHHHHHHccc
MGSQKNFSIDILNEEEAWRLFKLVADdhvenrefKSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQElrmpsevnfegvpaeaySTIELSFKNLKGEQLKKIFMLCSLLGNSICTSYLFQCCMGLGILQKVNKLEDARNKLYALVHELRDSClllegdsnqelsmhDVIRDVAISIACREQHAVLVRnedvwewpddialkecyaislrgcsihelpeglecprleflhinpkdslfdinnpcnfftgmrkLRVVDFTRMQLLLLPSSIDLLVNLQTLCLVECMLDDIAIIGKLKNLEILSFWgsgivklpeelghltklrqldlsncfklkviapnVISRLVRLEELYMSncfvewddegpnseRINARLDElmhlprlatlevhvkndnvlpegFFARKLERLSWALFAIDDHETMRTLKLKLNSVSICSKKLQGIKDVEYLCLEKLQDVKNVLFDLDTEGFSQLKHlhvqnnpdfmcivdskervplddafpileslnlynLIKLERICQDrlsvqsfnelKTIRVEHCDQLSNIFLLSAakclprlerIAVINCRNIQEifavdgeydaidhqriefGQLRtlclgslpeltsfccgvkknrqaqgmhetcsNEISSLEDKLDISSALFNEKVALSNLEVLEMNKVNiekiwpnqlpVAMFLCFQNLTrlilrkcpklKYIFSAsmlgsfehLQHLEIRHCKGLQEIIskegaddhvppnfVFLQVTTLILlglpelkclypgmhtsewpalklldvsacdqvtVFDSELFSFfksseedkpdiparqplfllekv
MGSQKNFSIDILNEEEAWRLFKLVADDHVENREFKSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKIFMLCSLLGNSICTSYLFQCCMGLGILQKVNKLEDARNKLYALVHELRDSCLLLEGDSNQELSMHDVIRDVAISIACREQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLECPRLEFLHINPKDSLFDINNPCNFFTGMRKLRVVDFTRMQLLLLPSSIDLLVNLQTLCLVECMLDDIAIIGKLKNLEILSFWGSGIVKLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEELYMSNCfvewddegpNSERINARLDELMHLPRLATLEVHVKNDNVLPEGFFARKLERLSWALFAIDDHETMRTLKLKLNSVSICSKKLQGIKDVEYLCLEKLQDVKNVLFDLDTEGFSQLKHLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLIKLERICQDRLSVQSFNELKTIRVEHCDQLSNIFLLSAAKCLPRLERIAVINCRNIQEIFAVDGEYDAIDHQRIEFGQLRTLCLGSLPELTSFCCGVKKNRQAQGMHETCSNEISSLEDKLDISSALFNEKVALSNLEVLEMNKVNIEKIWPNQLPVAMFLCFQNLTRLILRKCPKLKYIFSASMLGSFEHLQHLEIRHCKGLQEIISKEGADDHVPPNFVFLQVTTLILLGLPELKCLYPGMHTSEWPALKLLDVSACDQVTVFDSELFSffksseedkpdiparqplfllekv
MGSQKNFSIDILNEEEAWRLFKLVADDHVENREFKSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKIFMLCSLLGNSICTSYLFQCCMGLGILQKVNKLEDARNKLYALVHELRDSCLLLEGDSNQELSMHDVIRDVAISIACREQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLECPRLEFLHINPKDSLFDINNPCNFFTGMRKLRVVDFTRMQllllpssidllvnlQTLCLVECMLDDIAIIGKLKNLEILSFWGSGIVKLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEELYMSNCFVEWDDEGPNSERINARLDELMHLPRLATLEVHVKNDNVLPEGFFARKLERLSWALFAIDDHETMRTLKLKLNSVSICSKKLQGIKDVEYLCLEKLQDVKNVLFDLDTEGFSQLKHLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLIKLERICQDRLSVQSFNELKTIRVEHCDQLSNIFLLSAAKCLPRLERIAVINCRNIQEIFAVDGEYDAIDHQRIEFGQLRTLCLGSLPELTSFCCGVKKNRQAQGMHETCSNEISSLEDKLDISSALFNEKVALSNLEVLEMNKVNIEKIWPNQLPVAMFLCFQNLTRLILRKCPKLKYIFSASMLGSFEHLQHLEIRHCKGLQEIISKEGADDHVPPNFVFLQVTTLILLGLPELKCLYPGMHTSEWPALKLLDVSACDQVTVfdselfsffksseedkPDIPARQPLFLLEKV
*******SIDILNEEEAWRLFKLVADDHVENREFKSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKIFMLCSLLGNSICTSYLFQCCMGLGILQKVNKLEDARNKLYALVHELRDSCLLLEGDSNQELSMHDVIRDVAISIACREQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLECPRLEFLHINPKDSLFDINNPCNFFTGMRKLRVVDFTRMQLLLLPSSIDLLVNLQTLCLVECMLDDIAIIGKLKNLEILSFWGSGIVKLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEELYMSNCFVEWDDEGP**ERINARLDELMHLPRLATLEVHVKNDNVLPEGFFARKLERLSWALFAIDDHETMRTLKLKLNSVSICSKKLQGIKDVEYLCLEKLQDVKNVLFDLDTEGFSQLKHLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLIKLERICQDRLSVQSFNELKTIRVEHCDQLSNIFLLSAAKCLPRLERIAVINCRNIQEIFAVDGEYDAIDHQRIEFGQLRTLCLGSLPELTSFCCGVKKN*******************KLDISSALFNEKVALSNLEVLEMNKVNIEKIWPNQLPVAMFLCFQNLTRLILRKCPKLKYIFSASMLGSFEHLQHLEIRHCKGLQEIISKEGADDHVPPNFVFLQVTTLILLGLPELKCLYPGMHTSEWPALKLLDVSACDQVTVFDSELFSFF**********************
**SQKNFSIDILNEEEAWRLFKLVADDHVENREFKSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPS**NFEGVPAEAYSTIELSFKNLKGEQLKKIFMLCSLLGNSICTSYLFQCCMGLGILQKVNKLEDARNKLYALVHELRDSCLLLEGDSNQELSMHDVIRDVAISIACREQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLECPRLEFLHINPKDSLFDINNPCNFFTGMRKLRVVDFTRMQLLLLPSSIDLLVNLQTLCLVECMLDDIAIIGKLKNLEILSFWGSGIVKLPEELGHLTKLRQLDLSNCFKLKV*******RLVRLEELYMSNCFVEWDDEGPN********DELMHLPRLATLEVHVKNDNVLPEGFFARKLERLSWALFAIDDHETMRTLKLKLNSVSICSKKLQGIKDVEYLCLEKLQDVKNVLFDLDTEGFSQLKHLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLIKLERICQDRLSVQSFNELKTIRVEHCDQLSNIFLLSAAKCLPRLERIAVINCRNIQEIFAVDGEYDAIDHQRIEFGQLRTLCLGSLPELTSFCCGVKKNRQAQGMHETCSNEISSLEDKLDI*SALFNEKVALSNLEVLEMNKVNIEKIWPNQLPVAMFLCFQNLTRLILRKCPKLKYIFSASMLGSFEHLQHLEIRHCKGLQEIIS***********FVFLQVTTLILLGLPELKCLYPGMHTSEWPALKLLDVSACDQVTVFDSE**************IPARQPLFLLEKV
MGSQKNFSIDILNEEEAWRLFKLVADDHVENREFKSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKIFMLCSLLGNSICTSYLFQCCMGLGILQKVNKLEDARNKLYALVHELRDSCLLLEGDSNQELSMHDVIRDVAISIACREQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLECPRLEFLHINPKDSLFDINNPCNFFTGMRKLRVVDFTRMQLLLLPSSIDLLVNLQTLCLVECMLDDIAIIGKLKNLEILSFWGSGIVKLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEELYMSNCFVEWDDEGPNSERINARLDELMHLPRLATLEVHVKNDNVLPEGFFARKLERLSWALFAIDDHETMRTLKLKLNSVSICSKKLQGIKDVEYLCLEKLQDVKNVLFDLDTEGFSQLKHLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLIKLERICQDRLSVQSFNELKTIRVEHCDQLSNIFLLSAAKCLPRLERIAVINCRNIQEIFAVDGEYDAIDHQRIEFGQLRTLCLGSLPELTSFCCGVKKN*****************EDKLDISSALFNEKVALSNLEVLEMNKVNIEKIWPNQLPVAMFLCFQNLTRLILRKCPKLKYIFSASMLGSFEHLQHLEIRHCKGLQEIISKEGADDHVPPNFVFLQVTTLILLGLPELKCLYPGMHTSEWPALKLLDVSACDQVTVFDSELFSFFKSSEEDKPDIPARQPLFLLEKV
*****NFSIDILNEEEAWRLFKLVADDHVENREFKSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKIFMLCSLLGNSICTSYLFQCCMGLGILQKVNKLEDARNKLYALVHELRDSCLLLEGDSNQELSMHDVIRDVAISIACREQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLECPRLEFLHINPKDSLFDINNPCNFFTGMRKLRVVDFTRMQLLLLPSSIDLLVNLQTLCLVECMLDDIAIIGKLKNLEILSFWGSGIVKLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEELYMSNCFVEWDDEGPNSERINARLDELMHLPRLATLEVHVKNDNVLPEGFFARKLERLSWALFAIDDHETMRTLKLKLNSVSICSKKLQGIKDVEYLCLEKLQDVKNVLFDLDTEGFSQLKHLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLIKLERICQDRLSVQSFNELKTIRVEHCDQLSNIFLLSAAKCLPRLERIAVINCRNIQEIFAVDGEYDAIDHQRIEFGQLRTLCLGSLPELTSFCCGVKKNRQAQGMHETCSNEISSLEDKLDISSALFNEKVALSNLEVLEMNKVNIEKIWPNQLPVAMFLCFQNLTRLILRKCPKLKYIFSASMLGSFEHLQHLEIRHCKGLQEIISKEGADDHVPPNFVFLQVTTLILLGLPELKCLYPGMHTSEWPALKLLDVSACDQVTVFDSELFSFFKSSEEDKPDIPARQPLFLLEK*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSQKNFSIDILNEEEAWRLFKLVADDHVENREFKSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKIFMLCSLLGNSICTSYLFQCCMGLGILQKxxxxxxxxxxxxxxxxxxxxxCLLLEGDSNQELSMHDVIRDVAISIACREQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLECPRLEFLHINPKDSLFDINNPCNFFTGMRKLRVVDFTRMQLLLLPSSIDLLVNLQTLCLVECMLDDIAIIGKLKNLEILSFWGSGIVKLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEELYMSNCFVEWDDEGPNSERINARLDELMHLPRLATLEVHVKNDNVLPEGFFARKLERLSWALFAIDDHETMRTLKLKLNSVSICSKKLQGIKDVEYLCLEKLQDVKNVLFDLDTEGFSQLKHLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLIKLERICQDRLSVQSFNELKTIRVEHCDQLSNIFLLSAAKCLPRLERIAVINCRNIQEIFAVDGEYDAIDHQRIEFGQLRTLCLGSLPELTSFCCGVKKNRQAQGMHETCSNEISSLEDKLDISSALFNEKVALSNLEVLEMNKVNIEKIWPNQLPVAMFLCFQNLTRLILRKCPKLKYIFSASMLGSFEHLQHLEIRHCKGLQEIISKEGADDHVPPNFVFLQVTTLILLGLPELKCLYPGMHTSEWPALKLLDVSACDQVTVFDSELFSFFKSSEEDKPDIPARQPLFLLEKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query806 2.2.26 [Sep-21-2011]
Q9T048985 Disease resistance protei yes no 0.725 0.593 0.260 4e-41
O81825919 Probable disease resistan no no 0.732 0.642 0.275 5e-41
Q42484909 Disease resistance protei no no 0.656 0.581 0.270 2e-39
Q9FG91848 Probable disease resistan no no 0.645 0.613 0.263 9e-25
Q9C8K0854 Probable disease resistan no no 0.590 0.557 0.249 4e-22
Q9LVT4843 Probable disease resistan no no 0.627 0.600 0.245 3e-21
Q9FLB4874 Putative disease resistan no no 0.374 0.345 0.281 1e-19
O64973889 Disease resistance protei no no 0.643 0.583 0.270 4e-19
Q8RXS5888 Probable disease resistan no no 0.346 0.314 0.310 3e-18
Q9FG90862 Probable disease resistan no no 0.383 0.358 0.28 4e-18
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function desciption
 Score =  170 bits (431), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 166/637 (26%), Positives = 296/637 (46%), Gaps = 52/637 (8%)

Query: 1   MGSQKNFSIDILNEEEAWRLFKLVADDHVENREFKSTATEVAQACKGLPIALTTIARALR 60
           M +  +  +D L EE+AW LF   A D V +   +  A  V+Q C GLP+A+ T+  A+R
Sbjct: 291 MKTDLDVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMR 350

Query: 61  N-KSVPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKIFMLCSLLGN-- 117
             K+V  W   L +L   S    + +  + +  ++LS+  L+ ++ K  F+LC+L     
Sbjct: 351 GKKNVKLWNHVLSKLS-KSVPWIKSIEEKIFQPLKLSYDFLE-DKAKFCFLLCALFPEDY 408

Query: 118 SICTSYLFQCCMGLGILQKVNKLEDARNKLYALVHELRDSCLLLEGDSNQELSMHDVIRD 177
           SI  + + +  M  G ++++   ED+ N+    V  L+D CLL +GD    + MHDV+RD
Sbjct: 409 SIEVTEVVRYWMAEGFMEELGSQEDSMNEGITTVESLKDYCLLEDGDRRDTVKMHDVVRD 468

Query: 178 VAISIACREQ---HAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLE--CPRLE 232
            AI I    Q   H++++    + +   D        +SL    +  LP+ +E  C +  
Sbjct: 469 FAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVEEFCVKTS 528

Query: 233 FLHINPKDSLFDINNPCNFFTGMRKLRVVDFTRMQLLLLPS-SIDLLVNLQTLCLVECM- 290
            L +     L ++  P  F      LR+++ +  ++   PS S+  L +L +L L +C  
Sbjct: 529 VLLLQGNFLLKEV--PIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCFK 586

Query: 291 LDDIAIIGKLKNLEILSFWGSGIVKLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVR 350
           L  +  +  L  LE+L   G+ I++ P  L  L + R LDLS    L+ I   V+SRL  
Sbjct: 587 LVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSS 646

Query: 351 LEELYMSNCFVEWDDEGPNSERINARLDELMHLPRLATLEVHVKNDNVL--PEGFFARKL 408
           LE L M++    W  +G  +++  A ++E+  L RL  L + + +   L      + ++L
Sbjct: 647 LETLDMTSSHYRWSVQG-ETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKRL 705

Query: 409 ERLS------WALFAIDDHETMRTLKLKLNSVSICSKKLQGIKDVEYLCLEKLQDVKNVL 462
           ++        + L    D   +    L ++ VSI       +     L L   Q ++ ++
Sbjct: 706 KKFQLVVGSRYILRTRHDKRRLTISHLNVSQVSIG----WLLAYTTSLALNHCQGIEAMM 761

Query: 463 FDL--DTEGFSQLKHLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLI-KLERICQ 519
             L  D +GF  LK L ++N      I+++   V +       +S ++ +L+  LE +  
Sbjct: 762 KKLVSDNKGFKNLKSLTIEN-----VIINTNSWVEMVSTNTSKQSSDILDLLPNLEELHL 816

Query: 520 DRLSVQSFNELKT-----------IRVEHCDQLSNIFLLSAAKCLPRLERIAVINCRNIQ 568
            R+ +++F+EL+T           I +  C +L  +        +P LE I +  C ++Q
Sbjct: 817 RRVDLETFSELQTHLGLKLETLKIIEITMCRKLRTLLDKRNFLTIPNLEEIEISYCDSLQ 876

Query: 569 EIFAVDGEYDAIDHQRIEFGQLRTLCLGSLPELTSFC 605
            +      ++A+ + +     LR L L +LP L S C
Sbjct: 877 NL------HEALLYHQPFVPNLRVLKLRNLPNLVSIC 907




Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FG91|DRL32_ARATH Probable disease resistance protein At5g43730 OS=Arabidopsis thaliana GN=At5g43730 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8K0|DRL5_ARATH Probable disease resistance protein At1g51480 OS=Arabidopsis thaliana GN=At1g51480 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|Q9FG90|DRL33_ARATH Probable disease resistance protein At5g43740 OS=Arabidopsis thaliana GN=At5g43740 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query806
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.950 0.582 0.410 1e-147
224083434 1144 cc-nbs-lrr resistance protein [Populus t 0.946 0.666 0.409 1e-146
255563252 1603 Disease resistance protein RPS5, putativ 0.946 0.475 0.412 1e-143
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.946 0.569 0.413 1e-142
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.946 0.570 0.410 1e-140
296087872 1152 unnamed protein product [Vitis vinifera] 0.981 0.686 0.375 1e-137
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.935 0.306 0.403 1e-137
358344903 2248 Cc-nbs-lrr resistance protein [Medicago 0.931 0.334 0.381 1e-131
357439285 1531 Cc-nbs resistance protein [Medicago trun 0.937 0.493 0.378 1e-130
358344271 1587 Cc-nbs-lrr resistance protein [Medicago 0.936 0.475 0.375 1e-129
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  528 bits (1361), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 326/795 (41%), Positives = 485/795 (61%), Gaps = 29/795 (3%)

Query: 1    MGSQKNFSIDILNEEEAWRLFKLVADDHVENREFKSTATEVAQACKGLPIALTTIARALR 60
            MGS +NF I +L   EAW LF+ +    V+    +  A EVA+ C GLPI L T+ARAL+
Sbjct: 292  MGSNRNFPIQVLPASEAWNLFEKMVGVAVKKHSVRLVAAEVARRCAGLPILLATVARALK 351

Query: 61   NKSVPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKIFMLCS-LLGNSI 119
            NK +  WK AL++L   +  + + +  + Y  +ELS+K+L+G+++K +F+LC  L  N+I
Sbjct: 352  NKDLYAWKKALKQL---TRFDKDDIDDQVYLGLELSYKSLRGDEIKSLFLLCGQLRSNNI 408

Query: 120  CTSYLFQCCMGLGILQKVNKLEDARNKLYALVHELRDSCLLLEGDSNQELSMHDVIRDVA 179
              S L +  +GL + +  + LE+ RN L  LV EL+ SCLLLEGD +  + MHDV+   A
Sbjct: 409  LISDLLRYGIGLDLFKGCSTLEETRNSLLTLVDELKASCLLLEGDKDGSVKMHDVVHSFA 468

Query: 180  ISIACREQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLECPRL-EFLHINP 238
            IS+A R+ H + V +E   EWP +  L++  AISL    I +LP  LECP L  FL +N 
Sbjct: 469  ISVALRDHHVLTVADE-FKEWPANDVLQQYTAISLPFRKIPDLPAILECPNLNSFLLLN- 526

Query: 239  KDSLFDINNPCNFFTGMRKLRVVDFTRMQLLLLPSSIDLLVNLQTLCLVECMLDDIAIIG 298
            KD    I  P +FF  M++L+++D T + L  LPSS+  L NLQTLCL  C+L+DI+IIG
Sbjct: 527  KDPSLQI--PDSFFREMKELKILDLTEVNLSPLPSSLQFLENLQTLCLDHCVLEDISIIG 584

Query: 299  KLKNLEILSFWGSGIVKLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEELYMSN 358
            +L  L++LS   S IV+LP E+G +T+L+ LDLSNC +L+VI+PN +S L RLE+LYM N
Sbjct: 585  ELNKLKVLSLMSSNIVRLPREIGKVTRLQLLDLSNCERLEVISPNALSSLTRLEDLYMGN 644

Query: 359  CFVEWDDEGPNSERINARLDELMHLPRLATLEVHVKNDNVLPEGFFA--RKLERL----- 411
             FV+W+ EG +S+R NA L EL HL  L+TL + + + + +P+  F+  + LER      
Sbjct: 645  SFVKWETEGSSSQRNNACLSELKHLSNLSTLHMQITDADNMPKDLFSSFQNLERFRIFIG 704

Query: 412  -SWALFAIDDHETMRTLKLKLNSVSICSKKLQG-IKDVEYLCLEKLQDVKNVLFDLDTEG 469
              W  +++ D  T RTLKLKLN+V    + +   +K  E L L++L  VK++L DLD EG
Sbjct: 705  DGWD-WSVKD-ATSRTLKLKLNTVIQLEEGVNTLLKITEELHLQELNGVKSILNDLDGEG 762

Query: 470  FSQLKHLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLIKLERICQDRLSVQSFNE 529
            F QL+HLHVQN P    I++S    P   AF  L+SL L NL  LE+IC  +L  +S   
Sbjct: 763  FPQLRHLHVQNCPGVQYIINSIRMGP-RTAFLNLDSLFLENLDNLEKICHGQLMAESLGN 821

Query: 530  LKTIRVEHCDQLSNIFLLSAAKCLPRLERIAVINCRNIQEIFAVDGEYDAIDHQR-IEFG 588
            L+ ++VE C +L N+F +S A+ L RLE I +I+C+ ++E+ A + E DA D +  IEF 
Sbjct: 822  LRILKVESCHRLKNLFSVSMARRLVRLEEITIIDCKIMEEVVAEESENDAADGEPIIEFT 881

Query: 589  QLRTLCLGSLPELTSFCCGVKKNRQAQGMHETCSNEISSLE----DKLDISSALFNEKVA 644
            QLR L L  LP+ TSF   V+++  +Q   +  ++E  S E    ++L  S +LFN K+ 
Sbjct: 882  QLRRLTLQCLPQFTSFHSNVEESSDSQRRQKLLASEARSKEIVAGNELGTSMSLFNTKIL 941

Query: 645  LSNLEVLEMNKVNIEKIWPNQLPVAMFLCFQNLTRLILRKCPKLKYIFSASMLGSFEHLQ 704
              NLE L+++ + +EKIW +Q P     C +NL  + +  C  L Y+ ++SM+ S   L+
Sbjct: 942  FPNLEDLKLSSIKVEKIWHDQ-PSVQSPCVKNLASIAVENCRNLNYLLTSSMVESLAQLK 1000

Query: 705  HLEIRHCKGLQEIISKEG-ADDHVPPNFVFLQVTTLILLGLPELKCLYPGMHTSEWPALK 763
             LEI +CK ++EI+  E   +  +    +F ++  L L+ LP+L   +   +  E  +LK
Sbjct: 1001 KLEICNCKSMEEIVVPEDIGEGKMMSKMLFPKLLILSLIRLPKL-TRFCTSNLLECHSLK 1059

Query: 764  LLDVSACDQVTVFDS 778
            +L V  C ++  F S
Sbjct: 1060 VLTVGNCPELKEFIS 1074




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296087872|emb|CBI35155.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|358344903|ref|XP_003636525.1| Cc-nbs-lrr resistance protein [Medicago truncatula] gi|355502460|gb|AES83663.1| Cc-nbs-lrr resistance protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357439285|ref|XP_003589919.1| Cc-nbs resistance protein [Medicago truncatula] gi|355478967|gb|AES60170.1| Cc-nbs resistance protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|358344271|ref|XP_003636214.1| Cc-nbs-lrr resistance protein [Medicago truncatula] gi|355502149|gb|AES83352.1| Cc-nbs-lrr resistance protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query806
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.734 0.644 0.267 2e-43
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.735 0.602 0.254 2.7e-38
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.320 0.283 0.299 1.7e-33
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.326 0.295 0.292 9.4e-26
TAIR|locus:2170892848 AT5G43730 [Arabidopsis thalian 0.645 0.613 0.260 6.4e-25
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.317 0.288 0.313 1.8e-20
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.433 0.394 0.263 2.1e-20
TAIR|locus:2171589948 AT5G47260 [Arabidopsis thalian 0.310 0.263 0.256 6.9e-20
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.430 0.385 0.257 7.7e-20
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.424 0.383 0.273 1.5e-19
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 468 (169.8 bits), Expect = 2.0e-43, Sum P(2) = 2.0e-43
 Identities = 167/625 (26%), Positives = 274/625 (43%)

Query:     1 MGSQKNFSIDILNEEEAWRLFKLVADDHVENREFKSTATEVAQACKGLPIALTTIARALR 60
             M + +N  +  L E+EAW LF     +   +   K  A +V+  C GLP+A+ TI R LR
Sbjct:   261 MMTNENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLR 320

Query:    61 NK-SVPEWKSALQEL-RMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKIFMLCSLLGN- 117
              K  V  WK  L  L R    ++ E    + + T++LS+  L+ + +K  F+ C+L    
Sbjct:   321 GKPQVEVWKHTLNLLKRSAPSIDTE---EKIFGTLKLSYDFLQ-DNMKSCFLFCALFPED 376

Query:   118 -SICTSYLFQCCMGLGILQKVNKLEDARNKLYALVHELRDSCLLLEGDSNQELSMHDVIR 176
              SI  S L    +  G+L   +  ED  N+   LV  L+DSCLL +GDS   + MHDV+R
Sbjct:   377 YSIKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVR 436

Query:   177 DVAISIACREQ---HAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEG-LECPRLE 232
             D AI     +    H++++    + E+P D  +     +SL    +  LP   +E     
Sbjct:   437 DFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETL 496

Query:   233 FLHINPKDSLFDINNPCNFFTGMRKLRVVDFTRMQXXXXXXXXXXXXXXQTLCLVECM-L 291
              L +     + ++ N   F      LR++D + ++              ++L L  C  L
Sbjct:   497 VLLLQGNSHVKEVPN--GFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKL 554

Query:   292 DDIAIIGKLKNLEILSFWGSGIVKLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRL 351
              ++  +  L  L+ L    S I +LP  L  L+ LR + +SN ++L+ I    I +L  L
Sbjct:   555 RNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSL 614

Query:   352 EELYMSNCFVEWDDEGPNSERINARLDELMHLPRLATLEVHVKNDNVLPEGF--FARKLE 409
             E L M+     W  +G   E   A LDE+  LP L  L + + +       F    ++L 
Sbjct:   615 EVLDMAGSAYSWGIKGEEREG-QATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLT 673

Query:   410 RLSWALFAIDDHETMRTLK--LKLNSVSICSKK----LQGIKDVEYLCLEKLQDVKNVLF 463
             +  +    I       T +  L ++ V++ +      LQ +  ++    E L  +   L 
Sbjct:   674 KFQFLFSPIRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLV 733

Query:   464 DLDTEGFSQLKHLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLIKLERICQ-DRL 522
                   F  +K L +   P        + ++   D FP LE L+L N + LE I + +  
Sbjct:   734 TKSKSSFVAMKALSIHYFPSLSLASGCESQL---DLFPNLEELSLDN-VNLESIGELNGF 789

Query:   523 SVQSFNELKTIRVEHCDQLSNIFLLSA-AKCLPRLERIAVINCRNIQEIFAVDG-EYDAI 580
                   +LK ++V  C QL  +F     A  LP L+ I V++C  ++E+F       D  
Sbjct:   790 LGMRLQKLKLLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFC 849

Query:   581 DHQRIEFGQLRTLCLGSLPELTSFC 605
                 +   +L  + L  LP+L S C
Sbjct:   850 AESLLP--KLTVIKLKYLPQLRSLC 872


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170892 AT5G43730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query806
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 1e-11
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
PLN032101153 PLN03210, PLN03210, Resistant to P 0.002
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score = 65.8 bits (161), Expect = 1e-11
 Identities = 37/118 (31%), Positives = 57/118 (48%), Gaps = 6/118 (5%)

Query: 1   MGSQKNFSIDILNEEEAWRLFKLVADDH--VENREFKSTATEVAQACKGLPIALTTIARA 58
            G+ K   ++ L  EE+W LF     +       E +  A E+ + CKGLP+AL  +   
Sbjct: 145 GGTSKPHEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGL 204

Query: 59  LRNKS-VPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKIFMLCSLL 115
           L  KS V EW+  L++L        +G+  E  S + LS+ NL    LK+ F+  +L 
Sbjct: 205 LAFKSTVQEWEHVLEQLN-NELAGRDGL-NEVLSILSLSYDNLP-MHLKRCFLYLALF 259


Length = 285

>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 806
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.89
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.89
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.88
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.79
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.46
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.45
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.43
KOG4237498 consensus Extracellular matrix protein slit, conta 99.43
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.42
KOG4237498 consensus Extracellular matrix protein slit, conta 99.33
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.32
KOG4341483 consensus F-box protein containing LRR [General fu 99.11
KOG4341483 consensus F-box protein containing LRR [General fu 99.1
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.07
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.0
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.98
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.96
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.96
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.92
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.91
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.77
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.65
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.59
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.56
PRK15386 426 type III secretion protein GogB; Provisional 98.53
PRK15386 426 type III secretion protein GogB; Provisional 98.46
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.42
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.41
PLN03150623 hypothetical protein; Provisional 98.41
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.39
PLN03150623 hypothetical protein; Provisional 98.39
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.34
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.2
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.18
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.01
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.97
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.95
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.94
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.87
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.85
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.79
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.77
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.76
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.68
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.65
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.64
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.62
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.36
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.28
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.17
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.82
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.7
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.59
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.46
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.2
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.01
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.85
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.78
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.87
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.79
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.26
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.24
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.09
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.65
PRK04841903 transcriptional regulator MalT; Provisional 92.44
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.36
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.61
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.56
smart0037026 LRR Leucine-rich repeats, outliers. 89.02
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.02
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 85.06
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 82.98
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 82.11
smart0037026 LRR Leucine-rich repeats, outliers. 82.11
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 82.0
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=4.2e-58  Score=523.55  Aligned_cols=356  Identities=30%  Similarity=0.468  Sum_probs=270.2

Q ss_pred             CCCcceeeCCCCCHHHHHHHHHHhhCCC--CCChhhHHHHHHHHHHccCChhHHHHHHHHhcCC-ChhHHHHHHHHhcCC
Q 003639            1 MGSQKNFSIDILNEEEAWRLFKLVADDH--VENREFKSTATEVAQACKGLPIALTTIARALRNK-SVPEWKSALQELRMP   77 (806)
Q Consensus         1 ~~~~~~~~l~~L~~~~~~~Lf~~~a~~~--~~~~~~~~~~~~i~~kc~glPLai~~ig~~L~~~-~~~~W~~~l~~~~~~   77 (806)
                      ||+...+++++|+.+|||+||+++|++.  ...+.++++|++||+||+|||||+++||+.|+.| +.++|+++.+.+.+.
T Consensus       306 m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~  385 (889)
T KOG4658|consen  306 MGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSS  385 (889)
T ss_pred             ccCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHcccccc
Confidence            7888999999999999999999999542  3345599999999999999999999999999999 889999999988632


Q ss_pred             CCCCCCCCchhhHhHHHHhhccCCchhHHHHHHHHhhcC--CCCChhHHHHHhhhcccccccccHHHHHHHHHHHHHHHH
Q 003639           78 SEVNFEGVPAEAYSTIELSFKNLKGEQLKKIFMLCSLLG--NSICTSYLFQCCMGLGILQKVNKLEDARNKLYALVHELR  155 (806)
Q Consensus        78 ~~~~~~~~~~~i~~~L~lsY~~L~~~~lk~cfl~~s~fp--~~i~~~~li~~wiaeG~i~~~~~~e~~~~~~~~~~~~L~  155 (806)
                      ..-+..+..+.|+++|++||++||.+ +|.||+|||+||  |.|++++||.+||||||+++....+.+++.+++|+.+|+
T Consensus       386 ~~~~~~~~~~~i~~iLklSyd~L~~~-lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV  464 (889)
T KOG4658|consen  386 LAADFSGMEESILPILKLSYDNLPEE-LKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELV  464 (889)
T ss_pred             ccCCCCchhhhhHHhhhccHhhhhHH-HHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHH
Confidence            22334455778999999999999966 999999999999  999999999999999999885556778888888999999


Q ss_pred             hcccccccC---CCCceeecHHHHHHHHHHHh-----hcCceEEecCcccCCCCccccccccEEEEEeCCCCCCCCCCCC
Q 003639          156 DSCLLLEGD---SNQELSMHDVIRDVAISIAC-----REQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLE  227 (806)
Q Consensus       156 ~~~l~~~~~---~~~~~~mHdli~~l~~~~~~-----~e~~~~~~~~~~~~~~~~~~~~~~lr~l~l~~~~~~~l~~~~~  227 (806)
                      ++++++..+   ....|+|||+|||+|.++|.     +|+.++..+ .+....+....+..+|++++.++.+..++....
T Consensus       465 ~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~-~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~  543 (889)
T KOG4658|consen  465 RASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDG-VGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSE  543 (889)
T ss_pred             HHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECC-cCccccccccchhheeEEEEeccchhhccCCCC
Confidence            999999775   33679999999999999999     666444332 233334555556789999999999999999889


Q ss_pred             CCCccEEEecCCCC-cccccCCChhhhcCCCceEEEeecC-CCccCCcccccccCCcEEEecCcCCCCchhhcCCCccce
Q 003639          228 CPRLEFLHINPKDS-LFDINNPCNFFTGMRKLRVVDFTRM-QLLLLPSSIDLLVNLQTLCLVECMLDDIAIIGKLKNLEI  305 (806)
Q Consensus       228 ~~~Lr~L~l~~~~~-~~~~~~~~~~~~~l~~Lr~L~L~~~-~i~~lp~~l~~l~~L~~L~L~~~~l~~~~~i~~L~~L~~  305 (806)
                      +++|++|.+.+|.. ...+  +..+|..++.||+|||++| .+.++|++|+.|.|||||+++++.+              
T Consensus       544 ~~~L~tLll~~n~~~l~~i--s~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I--------------  607 (889)
T KOG4658|consen  544 NPKLRTLLLQRNSDWLLEI--SGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGI--------------  607 (889)
T ss_pred             CCccceEEEeecchhhhhc--CHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCc--------------
Confidence            99999999999863 5666  7777899999999999975 4555777766666666666666554              


Q ss_pred             EeccCCCCcccChhccCCCcCCEEeccCCccccccChhhhhcCCCCCEEEeecCcccccCCCCCchhhhccccccCCCCC
Q 003639          306 LSFWGSGIVKLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEELYMSNCFVEWDDEGPNSERINARLDELMHLPR  385 (806)
Q Consensus       306 L~L~~~~l~~lp~~i~~L~~L~~L~l~~~~~l~~~p~~~l~~L~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~L~~l~~  385 (806)
                              +.+|.++++|++|++|++..+..+..+|. ++..|++||+|.+......         .....+.++.++.+
T Consensus       608 --------~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~-i~~~L~~Lr~L~l~~s~~~---------~~~~~l~el~~Le~  669 (889)
T KOG4658|consen  608 --------SHLPSGLGNLKKLIYLNLEVTGRLESIPG-ILLELQSLRVLRLPRSALS---------NDKLLLKELENLEH  669 (889)
T ss_pred             --------cccchHHHHHHhhheeccccccccccccc-hhhhcccccEEEeeccccc---------cchhhHHhhhcccc
Confidence                    45555555555555555554443333322 2444555555555433211         11233445555555


Q ss_pred             CcEEEEE
Q 003639          386 LATLEVH  392 (806)
Q Consensus       386 L~~L~l~  392 (806)
                      |+.+.+.
T Consensus       670 L~~ls~~  676 (889)
T KOG4658|consen  670 LENLSIT  676 (889)
T ss_pred             hhhheee
Confidence            5555543



>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query806
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 5e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-13
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 6e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-04
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
 Score = 96.6 bits (240), Expect = 5e-21
 Identities = 24/202 (11%), Positives = 59/202 (29%), Gaps = 14/202 (6%)

Query: 1   MGSQKNFSIDILNEEEAWRLFKLVADDHVENREFKSTATEVAQACKGLPIALTTIARALR 60
             + +   +  L  +E +   +          + +    +  +   G P  L    ++  
Sbjct: 282 SQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCE 341

Query: 61  NKSVPEWKSALQELRMPSEVNFEGVPAEAYSTI----ELSFKNLKGEQLKKIFMLCSLL- 115
            K+  +      +L     V  E +   +Y ++    +   + L  E  +       ++ 
Sbjct: 342 PKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDE-DRSALAFAVVMP 400

Query: 116 -GNSICTSYLFQCCMGLGILQKVNKLED-ARNKLYALVHELRDSCLLLEGDSNQELS--M 171
            G  I                +  +L+D   ++L      L     LL G     L+  +
Sbjct: 401 PGVDIPVKLWSCVIPVDICSNEEEQLDDEVADRL----KRLSKRGALLSGKRMPVLTFKI 456

Query: 172 HDVIRDVAISIACREQHAVLVR 193
             +I      +   +  A  + 
Sbjct: 457 DHIIHMFLKHVVDAQTIANGIS 478


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 806
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 7e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 61.4 bits (148), Expect = 7e-11
 Identities = 13/111 (11%), Positives = 34/111 (30%), Gaps = 8/111 (7%)

Query: 1   MGSQKNFSIDILNEEEAWRLFKLVADDHVENREFKSTATEVAQACKGLPIALTTIARALR 60
             + +   +  L  +E +   +          + +    +  +   G P  L    ++  
Sbjct: 174 SQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCE 233

Query: 61  NKSVPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKIFML 111
            K+  +      +L     V  E +          S+K+L    L++   +
Sbjct: 234 PKTFEKMAQLNNKLESRGLVGVECI-------TPYSYKSL-AMALQRCVEV 276


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query806
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.87
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.86
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.85
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.85
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.84
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.81
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.79
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.78
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.7
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.58
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.45
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.31
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.01
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.01
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.97
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.81
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.09
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.84
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.26
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.25
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.88
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.38
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.96  E-value=2e-25  Score=158.89  Aligned_cols=79  Identities=22%  Similarity=0.316  Sum_probs=36.3

Q ss_pred             CCCCCEEEEEECCCCCCCCCCCCCCCCCCEEEECCCCCCCCHHHCCCCCCCEEECCCCCCCCCCHHCCCCCCCCEEECCC
Q ss_conf             69972499953698865870000456875898057678991000277765468613788863471105999678992568
Q 003639          254 GMRKLRVVDFTRMQLLLLPSSIDLLVNLQTLCLVECMLDDIAIIGKLKNLEILSFWGSGIVKLPEELGHLTKLRQLDLSN  333 (806)
Q Consensus       254 ~l~~Lr~L~L~~~~i~~lp~~l~~l~~Lr~L~L~~~~l~~~~~i~~L~~L~~L~L~~~~l~~lp~~i~~L~~L~~L~l~~  333 (806)
                      .+.+|++|++++++++.+. .+..+++|++|++++|.++..+.++++++|++|++++|.+..++. ++.+++|+.|++.+
T Consensus        42 ~l~~l~~L~l~~~~I~~l~-gl~~L~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~i~~i~~-l~~l~~L~~L~~~~  119 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSID-GVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITP-LANLTNLTGLTLFN  119 (384)
T ss_dssp             HHTTCCEEECCSSCCCCCT-TGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCS
T ss_pred             HHCCCCEEECCCCCCCCCC-CCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCC
T ss_conf             9578789989998987762-424589999896818817988633477110103013433322221-11233433344332


Q ss_pred             C
Q ss_conf             7
Q 003639          334 C  334 (806)
Q Consensus       334 ~  334 (806)
                      +
T Consensus       120 ~  120 (384)
T d2omza2         120 N  120 (384)
T ss_dssp             S
T ss_pred             C
T ss_conf             2



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure