Citrus Sinensis ID: 003650


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-----
MAELLVGSEIHGFHTLKDLDVANMMEEAKTRWLRPNEIHAILCNSKYFSINAKPVNLPKSGTVVLFDRKMLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYRETHEGTPATPPNSHSSSISDQSAPLLLSEEFNSGAGHAYSAGGKELQAPNESLTVQNHEMRLHELNTLEWDDLVVTNDSNDSTEPRGDKFSHFDQQNHTAIKGAASNGSFFPSHDSYAEVSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMGTQSSVSSQRNEFGEVCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSGHHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKSKWEEFQVQMRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALVAQFNDMTLAGNISGSLQTGSTITVDTQNLTEDEVYLKDTLSAYRTAAEAAARIQAAFREHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEFLNMRRQAIKIQVILLCIVL
ccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccccEEEEEHHHHHHccccccccEEccccccHHHHHHHHccccEEEEEEEEEccccccccccEEEEEcccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccEEEEEEccccccccccccccEEEEEccEEEcEEEEEccEEEEEcccccccEEEEEEEEcccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHcccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccccccEEEccccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccccEEEEEccHEEEEEcccccccEEcccccccHHHHHHHccccEEEEEEEEEccccccccEEEEEHHcccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccEEEEEEcccccccccccEEEEEEccccccccccccccEEEEEcccEccEEEEcccEEEEEccccccccEEEEEEEcccEEEEEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccccccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHcHHHHHHHHHHcccccccccccccHHHHHHHHHcHHHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcc
MAELLVGseihgfhtlkdlDVANMMEEAktrwlrpneIHAILCNskyfsinakpvnlpksgtvvLFDRKMLRNFrkdghnwkkkkdgktvKEAHEHLKVGNEERIHVYYahgedsptfVRRCYWLLDKTLENIVLVHYRethegtpatppnshsssisdqsaplllseefnsgaghaysaggkelqapnesltvqNHEMRlhelntlewddlvvtndsndsteprgdkfshfdqqNHTAikgaasngsffpshdsyaevssggcltslsqpidrsnntqfnnLDGVYSELmgtqssvssqrnefgevctgdsldilagdglqsqdSFGKWMNyimtdspgsvddpvlepsissghhqftvpehlfsitdvspawafsnektKILVTGFFhkdclhlsksnmfcvcgevrvpaefvqagvyrcflpphspglFLLYMsldghkpisqvlnfeyrspqlhapvassedksKWEEFQVQMRLAHLLFSSfkglnilsskvppnslkEAKKFASKSTCISNSWAYLFKSvgdkrtslpeakdSFFELTLKSKLKEWLLERVVegsktteydvhgQGVIHLCAMLGYTWAILLFSWsglsldfrdkygWTALHWAAYYGREKMVVDLLSagakpnlvtdptsqnpgglnaadiasKKGFDGLAAFLSEQALVAQFNDmtlagnisgslqtgstitvdtqnlteDEVYLKDTLSAYRTAAEAAARIQAAFREHSLKVQTkairfsspEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEFLNMRRQAIKIQVILLCIVL
maellvgseihgfhtlkdldvANMMEEAKTRWLRPNEIHAILCNSKYFsinakpvnlpksgtvVLFDRKMLrnfrkdghnwkkkkdgktvkeahehlkvgneerIHVYyahgedsptFVRRCYWLLDKTLENIVLVHYRETHEgtpatppnshssSISDQSAPLLLSEEFNSGAGHAYSAGGKELQAPNESLTVQNHEMRLHElntlewddlVVTNDSNDSTEPRGDKFSHFDQQNHTAIKGAASNGSFFPSHDSYAEVSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMGTQSSVSSQRNEFGEVCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSGHHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKSKWEEFQVQMRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVEGSktteydvhGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALVAQFNDMTLAGNISGSLQTGSTITVDTQNLTEDEVYLKDTLSAYRTAAEAAARIQAAFREHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIqhrfrswkVRKEFLNMRRQAIKIQVILLCIVL
MAELLVGSEIHGFHTLKDLDVANMMEEAKTRWLRPNEIHAILCNSKYFSINAKPVNLPKSGTVVLFDRKMLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYRETHEGTPATPPNSHSSSISDQSAPLLLSEEFNSGAGHAYSAGGKELQAPNESLTVQNHEMRLHELNTLEWDDLVVTNDSNDSTEPRGDKFSHFDQQNHTAIKGAASNGSFFPSHDSYAEVSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMGTQSSVSSQRNEFGEVCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSGHHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKSKWEEFQVQMRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALVAQFNDMTLAGNISGSLQTGSTITVDTQNLTEDEVYLKDTLSayrtaaeaaariqaafrEHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEFLNMRRQAIKIQVILLCIVL
****LVGSEIHGFHTLKDLDVANMMEEAKTRWLRPNEIHAILCNSKYFSINAKPVNLPKSGTVVLFDRKMLRNFRKDGHNW**************HLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYR*************************************************************LHELNTLEWDDLVV******************************************************************************************GEVCTGDSLDILAGDGLQSQDSFGKWMNYIMT******************HHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYR****************WEEFQVQMRLAHLLFSSFKGLNILS****************KSTCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGA********************IASKKGFDGLAAFLSEQALVAQFNDMTLAGNISGSLQTGSTITVDTQNLTEDEVYLKDTLSAYRTAAEAAARIQAAFREHSLKVQTKAIRF******AQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEFLNMRRQAIKIQVILLCIV*
**************TLKDLDVANMMEEAKTRWLRPNEIHAILCNSKYFSINAKPVNLPKSGTVVLFDRKMLRNFRKDGHNWKKKK**********HLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHY************************************************************************************************************************************************************************************************************************************ITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKSKWEEFQVQMRLAHLLFSSFKG***********************************************KDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLS**********************TGSTITV*********VYLKDTLSAYRTAAEAAARIQAAFREHSLK************************************MAAAARIQHRFRSWKVRKEFLNMRRQAIKIQVILLCIVL
MAELLVGSEIHGFHTLKDLDVANMMEEAKTRWLRPNEIHAILCNSKYFSINAKPVNLPKSGTVVLFDRKMLRNFRKDGH*************AHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYRET********************APLLLSEEFNSGAGHAYSAGGKELQAPNESLTVQNHEMRLHELNTLEWDDLVVTND********GDKFSHFDQQNHTAIKGAASNGSFFPSHDSYAEVSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMG************GEVCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSGHHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQL***********KWEEFQVQMRLAHLLFSSFKGLNILSSKVPPNSL**********TCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALVAQFNDMTLAGNISGSLQTGSTITVDTQNLTEDEVYLKDTLSAYRTAAEAAARIQAAFREHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEFLNMRRQAIKIQVILLCIVL
*AE*LVGSEIHGFHTLKDLDVANMMEEAKTRWLRPNEIHAILCNSKYFSINAKPVNLPKSGTVVLFDRKMLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYRETH*************************************************************************************************************************************************************************************QDSFGKWMNYIM*************************PEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKSKWEEFQVQMRLAHLLFSSFKGLNILS***********KKFASKSTCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALVAQFNDMT************************DEVYLKDTLSAYRTAAEAAARIQAAFREHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEFLNMRRQAIKIQVILLCIVL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAELLVGSEIHGFHTLKDLDVANMMEEAKTRWLRPNEIHAILCNSKYFSINAKPVNLPKSGTVVLFDRKMLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYRETHEGTPATPPNSHSSSISDQSAPLLLSEEFNSGAGHAYSAGGKELQAPNESLTVQNHEMRLHELNTLEWDDLVVTNDSNDSTEPRGDKFSHFDQQNHTAIKGAASNGSFFPSHDSYAEVSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMGTQSSVSSQRNEFGEVCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSGHHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKSKWEEFQVQMRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALVAQFNDMTLAGNISGSLQTGSTITVDTQNLTEDEVYLKDTLSAYRTAAEAAARIQAAFREHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEFLNMRRQAIKIQVILLCIVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query805 2.2.26 [Sep-21-2011]
O23463 923 Calmodulin-binding transc yes no 0.975 0.850 0.594 0.0
Q9LSP8 838 Calmodulin-binding transc no no 0.868 0.834 0.536 0.0
Q8GSA7 1032 Calmodulin-binding transc no no 0.568 0.443 0.299 6e-54
Q9FYG2 1016 Calmodulin-binding transc no no 0.527 0.418 0.350 4e-51
Q9FY74 1007 Calmodulin-binding transc no no 0.586 0.468 0.294 3e-50
Q6NPP4 1050 Calmodulin-binding transc no no 0.575 0.440 0.290 9e-49
Q9Y6Y1 1673 Calmodulin-binding transc yes no 0.149 0.071 0.4 4e-18
A2A891 1682 Calmodulin-binding transc no no 0.149 0.071 0.4 4e-18
O94983 1202 Calmodulin-binding transc no no 0.149 0.099 0.392 4e-18
Q80Y50 1208 Calmodulin-binding transc yes no 0.149 0.099 0.376 1e-16
>sp|O23463|CMTA5_ARATH Calmodulin-binding transcription activator 5 OS=Arabidopsis thaliana GN=CMTA5 PE=2 SV=2 Back     alignment and function desciption
 Score =  952 bits (2462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/807 (59%), Positives = 610/807 (75%), Gaps = 22/807 (2%)

Query: 5   LVGSEIHGFHTLKDLDVANMMEEAKTRWLRPNEIHAILCNSKYFSINAKPVNLPKSGTVV 64
           L+GSEIHGFHTL+DLD+  M++EA +RWLRPNEIHA+LCN K+F+IN KPVNLPKSGT+V
Sbjct: 9   LIGSEIHGFHTLQDLDIQTMLDEAYSRWLRPNEIHALLCNHKFFTINVKPVNLPKSGTIV 68

Query: 65  LFDRKMLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYW 124
           LFDRKMLRNFRKDGHNWKKKKDGKT+KEAHEHLKVGNEERIHVYYAHGED+PTFVRRCYW
Sbjct: 69  LFDRKMLRNFRKDGHNWKKKKDGKTIKEAHEHLKVGNEERIHVYYAHGEDTPTFVRRCYW 128

Query: 125 LLDKTLENIVLVHYRETHE--GTPATPPNSHSSSISDQSAPLLLSEEFNSGAGHAYSAGG 182
           LLDK+ E+IVLVHYRETHE    PATP NS+SSSI+D  +P +++E+ +SG  +  + G 
Sbjct: 129 LLDKSQEHIVLVHYRETHEVHAAPATPGNSYSSSITDHLSPKIVAEDTSSGVHNTCNTG- 187

Query: 183 KELQAPNESLTVQNHEMRLHELNTLEWDDLVVTNDSNDSTEPRGDKFSHFDQQNHTAIKG 242
              +  + SL  +NHE+RLHE+NTL+WD+L+V  D ++ + P  +   +F +Q  TA +G
Sbjct: 188 --FEVRSNSLGSRNHEIRLHEINTLDWDELLVPADISNQSHPTEEDMLYFTEQLQTAPRG 245

Query: 243 AASNGSFFPSHDSYAEVSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMGTQSSVSSQRN 302
           +   G+    ++   ++ S      L  P+ ++NN+             G   ++  QR 
Sbjct: 246 SVKQGNHLAGYNGSVDIPS---FPGLEDPVYQNNNSCGAGEFSSQHSHCGVDPNL--QRR 300

Query: 303 EFGEVCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSG-------- 354
           +F    T    D L  +G  SQDSFG+W+N  ++DSPGSVDDP LE   + G        
Sbjct: 301 DFSATVTDQPGDALLNNGYGSQDSFGRWVNNFISDSPGSVDDPSLEAVYTPGQDSSTPPT 360

Query: 355 --HHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPA 412
             H    +PE +F+ITDVSPAWA+S EKTKILVTGFFH    HL +SN+ C+CGE+RVPA
Sbjct: 361 VFHSHSDIPEQVFNITDVSPAWAYSTEKTKILVTGFFHDSFQHLGRSNLICICGELRVPA 420

Query: 413 EFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDK-SKWE 471
           EF+Q GVYRCFLPP SPG+  LY+S+DG+KPISQ+ +FE+RS Q        +D+  KWE
Sbjct: 421 EFLQMGVYRCFLPPQSPGVVNLYLSVDGNKPISQLFSFEHRSVQFIEKAIPQDDQLYKWE 480

Query: 472 EFQVQMRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRT 531
           EF+ Q+RLAHLLF+S   +++L+SK+ P +L EAKK AS+++ + NSWAYL KS+     
Sbjct: 481 EFEFQVRLAHLLFTSSNKISVLTSKISPENLLEAKKLASRTSHLLNSWAYLMKSIQANEV 540

Query: 532 SLPEAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSW 591
              +A+D  FELTLK++LKEWLLE+V+E   T EYD  G GVIHLCA+LGYTW+ILLFSW
Sbjct: 541 PFDQARDHLFELTLKNRLKEWLLEKVIENRNTKEYDSKGLGVIHLCAVLGYTWSILLFSW 600

Query: 592 SGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASK 651
           + +SLDFRDK GWTALHWAAYYGREKMV  LLSAGA+PNLVTDPT +  GG  AAD+A +
Sbjct: 601 ANISLDFRDKQGWTALHWAAYYGREKMVAALLSAGARPNLVTDPTKEFLGGCTAADLAQQ 660

Query: 652 KGFDGLAAFLSEQALVAQFNDMTLAGNISGSLQT-GSTITVDTQNLTEDEVYLKDTLSAY 710
           KG+DGLAAFL+E+ LVAQF DM  AGNISG+L+T  +  + +  N  E+E  LKDTL+AY
Sbjct: 661 KGYDGLAAFLAEKCLVAQFKDMQTAGNISGNLETIKAEKSSNPGNANEEEQSLKDTLAAY 720

Query: 711 RTAAEAAARIQAAFREHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAA 770
           RTAAEAAARIQ AFREH LKV++ A+RF+S EEEA+NIIAA+KIQHAFRNFEVR+K+AAA
Sbjct: 721 RTAAEAAARIQGAFREHELKVRSSAVRFASKEEEAKNIIAAMKIQHAFRNFEVRRKIAAA 780

Query: 771 ARIQHRFRSWKVRKEFLNMRRQAIKIQ 797
           ARIQ+RF++WK+R+EFLNMR++AI+IQ
Sbjct: 781 ARIQYRFQTWKMRREFLNMRKKAIRIQ 807




Regulates transcriptional activity in response to calcium signals. Binds to the consensus sequence 5'-[ACG]CGCG[GTC]-3'. Activates the expression of the V-PPase proton pump in pollen.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LSP8|CMTA6_ARATH Calmodulin-binding transcription activator 6 OS=Arabidopsis thaliana GN=CMTA6 PE=2 SV=1 Back     alignment and function description
>sp|Q8GSA7|CMTA3_ARATH Calmodulin-binding transcription activator 3 OS=Arabidopsis thaliana GN=CMTA3 PE=1 SV=1 Back     alignment and function description
>sp|Q9FYG2|CMTA4_ARATH Calmodulin-binding transcription activator 4 OS=Arabidopsis thaliana GN=CMTA4 PE=1 SV=1 Back     alignment and function description
>sp|Q9FY74|CMTA1_ARATH Calmodulin-binding transcription activator 1 OS=Arabidopsis thaliana GN=CMTA1 PE=2 SV=2 Back     alignment and function description
>sp|Q6NPP4|CMTA2_ARATH Calmodulin-binding transcription activator 2 OS=Arabidopsis thaliana GN=CMTA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9Y6Y1|CMTA1_HUMAN Calmodulin-binding transcription activator 1 OS=Homo sapiens GN=CAMTA1 PE=1 SV=4 Back     alignment and function description
>sp|A2A891|CMTA1_MOUSE Calmodulin-binding transcription activator 1 OS=Mus musculus GN=Camta1 PE=2 SV=1 Back     alignment and function description
>sp|O94983|CMTA2_HUMAN Calmodulin-binding transcription activator 2 OS=Homo sapiens GN=CAMTA2 PE=1 SV=3 Back     alignment and function description
>sp|Q80Y50|CMTA2_MOUSE Calmodulin-binding transcription activator 2 OS=Mus musculus GN=Camta2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query805
224108659 915 predicted protein [Populus trichocarpa] 0.980 0.862 0.674 0.0
356519932 920 PREDICTED: calmodulin-binding transcript 0.978 0.856 0.638 0.0
359477127 927 PREDICTED: calmodulin-binding transcript 0.985 0.855 0.633 0.0
357478931 920 Calmodulin-binding transcription activat 0.976 0.854 0.639 0.0
356564630 921 PREDICTED: calmodulin-binding transcript 0.975 0.852 0.635 0.0
356558139 911 PREDICTED: calmodulin-binding transcript 0.952 0.841 0.643 0.0
255556328 918 calmodulin-binding transcription activat 0.956 0.838 0.635 0.0
147834981 907 hypothetical protein VITISV_010763 [Viti 0.945 0.839 0.609 0.0
356532529 911 PREDICTED: calmodulin-binding transcript 0.956 0.845 0.640 0.0
449501552 910 PREDICTED: LOW QUALITY PROTEIN: calmodul 0.952 0.842 0.612 0.0
>gi|224108659|ref|XP_002314926.1| predicted protein [Populus trichocarpa] gi|222863966|gb|EEF01097.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1063 bits (2750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/806 (67%), Positives = 653/806 (81%), Gaps = 17/806 (2%)

Query: 5   LVGSEIHGFHTLKDLDVANMMEEAKTRWLRPNEIHAILCNSKYFSINAKPVNLPKSGTVV 64
           L+GSEIHGF+ L+DLDV N+MEE++TRWLRPNEIHA+LCN K F+IN KPVN PKSGT+V
Sbjct: 9   LIGSEIHGFNFLRDLDVPNIMEESRTRWLRPNEIHAMLCNYKLFTINVKPVNFPKSGTIV 68

Query: 65  LFDRKMLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYW 124
           LFDRKMLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHG+D+ TFVRRCYW
Sbjct: 69  LFDRKMLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGQDNQTFVRRCYW 128

Query: 125 LLDKTLENIVLVHYRETHEGTPATPPNSHSSSISDQSAPLLLSEEFNSGAGHAYSAGGKE 184
           LLDK+LE+IVLVHYRET EG+PATP NSHSSS+SDQSAP LLSEEF+SGA  AY +   +
Sbjct: 129 LLDKSLEHIVLVHYRETQEGSPATPVNSHSSSVSDQSAPRLLSEEFDSGAARAYDS---K 185

Query: 185 LQAPNESLTVQNHEMRLHELNTLEWDDLVVTNDSNDSTEPRGDKFSHFDQQNHTAIKGAA 244
           L   ++SLTV++H MRLHELNTLEWD+LV TND  +   P GDK   FD+QN  A+ G+ 
Sbjct: 186 LTGSSDSLTVRSHAMRLHELNTLEWDELV-TNDPGNLIPPGGDKIPCFDRQNQIAVNGSV 244

Query: 245 SNGSFFPSHDSYAEVSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMGTQSSVSSQRNEF 304
           ++G     +   AE+S+ G LT   + I RS NTQFN+ D VYS+L   Q +  +QR   
Sbjct: 245 NDGGILSGYHLSAEMSTLGNLT---KSIVRSGNTQFNSPDSVYSQLTSAQVNSDAQRKGS 301

Query: 305 GEVCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSGH--------- 355
               T DSL+ L  DGLQSQDSFG+WM+ I+  SP SVDD VLE SISSGH         
Sbjct: 302 IVPGTSDSLNNLFNDGLQSQDSFGRWMSSIIDHSPCSVDDAVLESSISSGHDSFASPGID 361

Query: 356 -HQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEF 414
            HQ +V E  F ITD SPAWAFSNE TKILVTG+FH+   HL+KSN+FC+CG+    AE 
Sbjct: 362 QHQSSVQEQTFIITDFSPAWAFSNETTKILVTGYFHEQYQHLAKSNLFCICGDTFARAEI 421

Query: 415 VQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKSKWEEFQ 474
           VQ GVY   LPPHSPGL  L +SLDG +P SQ+LNFEYR+P +H PV SSEDKSKWEEF 
Sbjct: 422 VQVGVYSFMLPPHSPGLVNLCLSLDGLEPTSQILNFEYRAPSVHDPVVSSEDKSKWEEFH 481

Query: 475 VQMRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLP 534
           +QMRLA+LLFS+ K L+++S+K+ P +LKEAKKFA K++ ISNSWAYL K++ D   S+ 
Sbjct: 482 LQMRLAYLLFSTSKTLDVISNKLSPTNLKEAKKFALKTSNISNSWAYLIKAIEDGGISVA 541

Query: 535 EAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGL 594
           +AKD FFEL+LK+ ++EWLLERV+EG KTT YD  G GVIHLCA++GYTWA+ LFSWSGL
Sbjct: 542 QAKDGFFELSLKNTIREWLLERVLEGCKTTGYDAQGLGVIHLCAIIGYTWAVYLFSWSGL 601

Query: 595 SLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGF 654
           SLDFRDK+GWTALHWAAYYGREKMV  LLSAGAKPNLVTDPT +NPGG  AAD+AS KG+
Sbjct: 602 SLDFRDKHGWTALHWAAYYGREKMVGALLSAGAKPNLVTDPTKENPGGCTAADLASAKGY 661

Query: 655 DGLAAFLSEQALVAQFNDMTLAGNISGSLQTGSTITVDTQNLTEDEVYLKDTLSAYRTAA 714
           DGLAA+LSE+ALVAQF  M +AGN++GSL T +T TV+++NL+E+E+YLKDTL+AYRTAA
Sbjct: 662 DGLAAYLSEKALVAQFESMIIAGNVTGSLPTTATNTVNSENLSEEELYLKDTLAAYRTAA 721

Query: 715 EAAARIQAAFREHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQ 774
           +AAARIQ AFREHSL V+TKA++ SSPE+EA+NIIAA+KIQHAFRN++ +KKMAAAARIQ
Sbjct: 722 DAAARIQVAFREHSLMVRTKAVQSSSPEDEARNIIAAMKIQHAFRNYDSKKKMAAAARIQ 781

Query: 775 HRFRSWKVRKEFLNMRRQAIKIQVIL 800
           HRFR+WK+R++FLNMR + IKIQ + 
Sbjct: 782 HRFRTWKIRRDFLNMRHKTIKIQAVF 807




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356519932|ref|XP_003528622.1| PREDICTED: calmodulin-binding transcription activator 5-like [Glycine max] Back     alignment and taxonomy information
>gi|359477127|ref|XP_002272118.2| PREDICTED: calmodulin-binding transcription activator 5-like [Vitis vinifera] gi|296083270|emb|CBI22906.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357478931|ref|XP_003609751.1| Calmodulin-binding transcription activator [Medicago truncatula] gi|355510806|gb|AES91948.1| Calmodulin-binding transcription activator [Medicago truncatula] Back     alignment and taxonomy information
>gi|356564630|ref|XP_003550554.1| PREDICTED: calmodulin-binding transcription activator 5-like [Glycine max] Back     alignment and taxonomy information
>gi|356558139|ref|XP_003547365.1| PREDICTED: calmodulin-binding transcription activator 5-like [Glycine max] Back     alignment and taxonomy information
>gi|255556328|ref|XP_002519198.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] gi|223541513|gb|EEF43062.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147834981|emb|CAN70197.1| hypothetical protein VITISV_010763 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356532529|ref|XP_003534824.1| PREDICTED: calmodulin-binding transcription activator 5-like [Glycine max] Back     alignment and taxonomy information
>gi|449501552|ref|XP_004161401.1| PREDICTED: LOW QUALITY PROTEIN: calmodulin-binding transcription activator 5-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query805
TAIR|locus:2130125 923 AT4G16150 [Arabidopsis thalian 0.973 0.849 0.575 2.1e-257
TAIR|locus:2060405 1032 SR1 "signal responsive 1" [Ara 0.545 0.425 0.302 2.1e-84
TAIR|locus:2019534 1016 AT1G67310 [Arabidopsis thalian 0.530 0.420 0.324 4.2e-80
TAIR|locus:2173368 1050 AT5G64220 [Arabidopsis thalian 0.681 0.522 0.260 1.5e-79
UNIPROTKB|Q9Y6Y1 1673 CAMTA1 "Calmodulin-binding tra 0.149 0.071 0.408 1.1e-31
UNIPROTKB|J9NZ90 1214 CAMTA2 "Uncharacterized protei 0.139 0.092 0.410 1.3e-31
UNIPROTKB|F1RFY4 1201 CAMTA2 "Uncharacterized protei 0.139 0.093 0.410 1.6e-31
UNIPROTKB|E1BH04 1196 Bt.24734 "Uncharacterized prot 0.139 0.093 0.410 3.2e-31
UNIPROTKB|O94983 1202 CAMTA2 "Calmodulin-binding tra 0.139 0.093 0.410 1.4e-30
UNIPROTKB|F1P8J0 1204 CAMTA2 "Uncharacterized protei 0.139 0.093 0.410 3.5e-30
TAIR|locus:2130125 AT4G16150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2432 (861.2 bits), Expect = 2.1e-257, Sum P(2) = 2.1e-257
 Identities = 465/808 (57%), Positives = 596/808 (73%)

Query:     5 LVGSEIHGFHTLKDLDVANMMEEAKTRWLRPNEIHAILCNSKYFSINAKPVNLPKSGTVV 64
             L+GSEIHGFHTL+DLD+  M++EA +RWLRPNEIHA+LCN K+F+IN KPVNLPKSGT+V
Sbjct:     9 LIGSEIHGFHTLQDLDIQTMLDEAYSRWLRPNEIHALLCNHKFFTINVKPVNLPKSGTIV 68

Query:    65 LFDRKMLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYW 124
             LFDRKMLRNFRKDGHNWKKKKDGKT+KEAHEHLKVGNEERIHVYYAHGED+PTFVRRCYW
Sbjct:    69 LFDRKMLRNFRKDGHNWKKKKDGKTIKEAHEHLKVGNEERIHVYYAHGEDTPTFVRRCYW 128

Query:   125 LLDKTLENIVLVHYRETHE--GTPATPPNSHSSSISDQSAPLLLSEEFNSGAGHAYSAGG 182
             LLDK+ E+IVLVHYRETHE    PATP NS+SSSI+D  +P +++E+ +SG  +  + G 
Sbjct:   129 LLDKSQEHIVLVHYRETHEVHAAPATPGNSYSSSITDHLSPKIVAEDTSSGVHNTCNTG- 187

Query:   183 KELQAPNESLTVQNHEMRLHELNTLEWDDLVVTNDSNDSTEPRGDKFSHFDQQNHTAIKG 242
                +  + SL  +NHE+RLHE+NTL+WD+L+V  D ++ + P  +   +F +Q  TA +G
Sbjct:   188 --FEVRSNSLGSRNHEIRLHEINTLDWDELLVPADISNQSHPTEEDMLYFTEQLQTAPRG 245

Query:   243 AASNGSFFPSHDSYAEVSSGGCLTSLSQPIDRSNNT-QFNNLDGVYSELMGTQSSVSSQR 301
             +   G+    ++   ++ S      L  P+ ++NN+         +S   G   ++  QR
Sbjct:   246 SVKQGNHLAGYNGSVDIPS---FPGLEDPVYQNNNSCGAGEFSSQHSHC-GVDPNL--QR 299

Query:   302 NEFGEVCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSG------- 354
              +F    T    D L  +G  SQDSFG+W+N  ++DSPGSVDDP LE   + G       
Sbjct:   300 RDFSATVTDQPGDALLNNGYGSQDSFGRWVNNFISDSPGSVDDPSLEAVYTPGQDSSTPP 359

Query:   355 ---HHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVP 411
                H    +PE +F+ITDVSPAWA+S EKTKILVTGFFH    HL +SN+ C+CGE+RVP
Sbjct:   360 TVFHSHSDIPEQVFNITDVSPAWAYSTEKTKILVTGFFHDSFQHLGRSNLICICGELRVP 419

Query:   412 AEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKS-KW 470
             AEF+Q GVYRCFLPP SPG+  LY+S+DG+KPISQ+ +FE+RS Q        +D+  KW
Sbjct:   420 AEFLQMGVYRCFLPPQSPGVVNLYLSVDGNKPISQLFSFEHRSVQFIEKAIPQDDQLYKW 479

Query:   471 EEFQVQMRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKR 530
             EEF+ Q+RLAHLLF+S   +++L+SK+ P +L EAKK AS+++ + NSWAYL KS+    
Sbjct:   480 EEFEFQVRLAHLLFTSSNKISVLTSKISPENLLEAKKLASRTSHLLNSWAYLMKSIQANE 539

Query:   531 TSLPEAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFS 590
                 +A+D  FELTLK++LKEWLLE+V+E   T EYD  G GVIHLCA+LGYTW+ILLFS
Sbjct:   540 VPFDQARDHLFELTLKNRLKEWLLEKVIENRNTKEYDSKGLGVIHLCAVLGYTWSILLFS 599

Query:   591 WSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIAS 650
             W+ +SLDFRDK GWTALHWAAYYGREKMV  LLSAGA+PNLVTDPT +  GG  AAD+A 
Sbjct:   600 WANISLDFRDKQGWTALHWAAYYGREKMVAALLSAGARPNLVTDPTKEFLGGCTAADLAQ 659

Query:   651 KKGFDGLAAFLSEQALVAQFNDMTLAGNISGSLQT-GSTITVDTQNLTEDEVYLKDTLSX 709
             +KG+DGLAAFL+E+ LVAQF DM  AGNISG+L+T  +  + +  N  E+E  LKDTL+ 
Sbjct:   660 QKGYDGLAAFLAEKCLVAQFKDMQTAGNISGNLETIKAEKSSNPGNANEEEQSLKDTLAA 719

Query:   710 XXXXXXXXXXXXXXXXEHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAA 769
                             EH LKV++ A+RF+S EEEA+NIIAA+KIQHAFRNFEVR+K+AA
Sbjct:   720 YRTAAEAAARIQGAFREHELKVRSSAVRFASKEEEAKNIIAAMKIQHAFRNFEVRRKIAA 779

Query:   770 AARIQHRFRSWKVRKEFLNMRRQAIKIQ 797
             AARIQ+RF++WK+R+EFLNMR++AI+IQ
Sbjct:   780 AARIQYRFQTWKMRREFLNMRKKAIRIQ 807


GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0005516 "calmodulin binding" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2060405 SR1 "signal responsive 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019534 AT1G67310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173368 AT5G64220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y6Y1 CAMTA1 "Calmodulin-binding transcription activator 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZ90 CAMTA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RFY4 CAMTA2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BH04 Bt.24734 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O94983 CAMTA2 "Calmodulin-binding transcription activator 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P8J0 CAMTA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O23463CMTA5_ARATHNo assigned EC number0.59470.97510.8504yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query805
pfam03859119 pfam03859, CG-1, CG-1 domain 1e-61
smart01076118 smart01076, CG-1, CG-1 domains are highly conserve 8e-58
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-08
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-07
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-07
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-07
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 9e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-05
pfam0183384 pfam01833, TIG, IPT/TIG domain 3e-05
smart0024830 smart00248, ANK, ankyrin repeats 9e-05
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 2e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.001
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.004
>gnl|CDD|217766 pfam03859, CG-1, CG-1 domain Back     alignment and domain information
 Score =  202 bits (516), Expect = 1e-61
 Identities = 73/119 (61%), Positives = 92/119 (77%)

Query: 24  MMEEAKTRWLRPNEIHAILCNSKYFSINAKPVNLPKSGTVVLFDRKMLRNFRKDGHNWKK 83
           ++ EAK+RWLRP EI+AIL N +   I  +P   P SG++ L++RK++R FRKDG+NWKK
Sbjct: 1   LLPEAKSRWLRPEEIYAILQNFEKHFITLEPPTRPPSGSLFLYNRKVVRYFRKDGYNWKK 60

Query: 84  KKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYRETH 142
           KKDGKT +EAHE LKVG  E ++ YYAHGED+PTF RRCYWLLD+ LE+IVLVHY    
Sbjct: 61  KKDGKTTREAHEKLKVGGVEVLNCYYAHGEDNPTFQRRCYWLLDEDLEHIVLVHYLNVK 119


CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin -binding domain and ankyrins (ANK) motifs. Length = 119

>gnl|CDD|198144 smart01076, CG-1, CG-1 domains are highly conserved domains of about 130 amino-acid residues Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|216730 pfam01833, TIG, IPT/TIG domain Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 805
KOG0520 975 consensus Uncharacterized conserved protein, conta 100.0
PF03859118 CG-1: CG-1 domain; InterPro: IPR005559 CG-1 domain 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.87
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.84
PHA02791284 ankyrin-like protein; Provisional 99.8
PHA02791284 ankyrin-like protein; Provisional 99.78
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.78
PHA02743166 Viral ankyrin protein; Provisional 99.78
PHA02875413 ankyrin repeat protein; Provisional 99.78
PHA02859209 ankyrin repeat protein; Provisional 99.76
PHA02875413 ankyrin repeat protein; Provisional 99.75
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.75
PHA02741169 hypothetical protein; Provisional 99.75
PHA03100480 ankyrin repeat protein; Provisional 99.74
PHA02878477 ankyrin repeat protein; Provisional 99.73
PHA02736154 Viral ankyrin protein; Provisional 99.73
PHA02874434 ankyrin repeat protein; Provisional 99.73
PHA02878477 ankyrin repeat protein; Provisional 99.73
PHA03095471 ankyrin-like protein; Provisional 99.72
PLN03192823 Voltage-dependent potassium channel; Provisional 99.72
PHA03100480 ankyrin repeat protein; Provisional 99.72
KOG0508 615 consensus Ankyrin repeat protein [General function 99.72
PHA02798489 ankyrin-like protein; Provisional 99.72
PHA02874434 ankyrin repeat protein; Provisional 99.71
PHA02876682 ankyrin repeat protein; Provisional 99.7
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.7
KOG0508 615 consensus Ankyrin repeat protein [General function 99.7
PHA02859209 ankyrin repeat protein; Provisional 99.69
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.68
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.68
PHA03095 471 ankyrin-like protein; Provisional 99.68
PHA02946446 ankyin-like protein; Provisional 99.68
PHA02989494 ankyrin repeat protein; Provisional 99.68
PHA02884300 ankyrin repeat protein; Provisional 99.68
PHA02795437 ankyrin-like protein; Provisional 99.68
PHA02946 446 ankyin-like protein; Provisional 99.67
PHA02876 682 ankyrin repeat protein; Provisional 99.66
PHA02989 494 ankyrin repeat protein; Provisional 99.65
KOG0510 929 consensus Ankyrin repeat protein [General function 99.65
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.65
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.64
PHA02798 489 ankyrin-like protein; Provisional 99.64
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.62
KOG0514452 consensus Ankyrin repeat protein [General function 99.61
PHA02917 661 ankyrin-like protein; Provisional 99.61
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.6
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.6
PHA02917 661 ankyrin-like protein; Provisional 99.59
KOG0514452 consensus Ankyrin repeat protein [General function 99.59
PHA02795437 ankyrin-like protein; Provisional 99.58
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.58
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.56
PHA02730672 ankyrin-like protein; Provisional 99.56
PHA02741169 hypothetical protein; Provisional 99.56
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.54
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.53
cd0117585 IPT_COE IPT domain of the COE family (Col/Olf-1/EB 99.52
KOG0510 929 consensus Ankyrin repeat protein [General function 99.5
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.5
PHA02743166 Viral ankyrin protein; Provisional 99.5
PHA02792631 ankyrin-like protein; Provisional 99.49
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.48
PHA02884300 ankyrin repeat protein; Provisional 99.47
PHA02730 672 ankyrin-like protein; Provisional 99.47
PLN03192823 Voltage-dependent potassium channel; Provisional 99.47
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.45
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.44
PHA02736154 Viral ankyrin protein; Provisional 99.42
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.41
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.41
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.41
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.41
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.4
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.37
PHA02792 631 ankyrin-like protein; Provisional 99.37
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.3
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.28
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.28
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.27
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.27
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.24
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.24
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.24
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.22
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.17
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.14
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.14
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.06
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.04
PF0183385 TIG: IPT/TIG domain; InterPro: IPR002909 This fami 99.01
KOG0520975 consensus Uncharacterized conserved protein, conta 98.99
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.98
cd0117985 IPT_plexin_repeat2 Second repeat of the IPT domain 98.97
cd0010289 IPT Immunoglobulin-like fold, Plexins, Transcripti 98.88
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.82
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 98.79
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.7
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.66
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.6
cd0060390 IPT_PCSR IPT domain of Plexins and Cell Surface Re 98.57
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.54
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.48
cd0118094 IPT_plexin_repeat1 First repeat of the IPT domain 98.46
PF1360630 Ank_3: Ankyrin repeat 98.46
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.44
smart0042990 IPT ig-like, plexins, transcription factors. 98.43
KOG0522 560 consensus Ankyrin repeat protein [General function 98.33
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.29
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.27
PF1360630 Ank_3: Ankyrin repeat 98.26
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.26
KOG0522 560 consensus Ankyrin repeat protein [General function 98.19
cd0118199 IPT_plexin_repeat3 Third repeat of the IPT domain 98.1
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.09
cd0284981 CGTase_C_term Cgtase (cyclodextrin glycosyltransfe 98.07
KOG2384223 consensus Major histocompatibility complex protein 98.03
KOG0783 1267 consensus Uncharacterized conserved protein, conta 97.83
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.82
KOG0511 516 consensus Ankyrin repeat protein [General function 97.76
KOG2384223 consensus Major histocompatibility complex protein 97.72
KOG0160 862 consensus Myosin class V heavy chain [Cytoskeleton 97.67
cd0060481 IPT_CGTD IPT domain (domain D) of cyclodextrin gly 97.6
KOG0511 516 consensus Ankyrin repeat protein [General function 97.37
PF0061221 IQ: IQ calmodulin-binding motif; InterPro: IPR0000 97.31
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.21
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 97.17
KOG2505591 consensus Ankyrin repeat protein [General function 96.76
PTZ00014821 myosin-A; Provisional 96.61
KOG3836605 consensus HLH transcription factor EBF/Olf-1 and r 96.34
smart0001526 IQ Short calmodulin-binding motif containing conse 96.32
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.1
KOG0160 862 consensus Myosin class V heavy chain [Cytoskeleton 96.05
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.38
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 95.28
KOG0164 1001 consensus Myosin class I heavy chain [Cytoskeleton 95.23
KOG0164 1001 consensus Myosin class I heavy chain [Cytoskeleton 94.88
cd00602101 IPT_TF IPT domain of eukaryotic transcription fact 94.87
KOG3610 1025 consensus Plexins (functional semaphorin receptors 94.85
KOG2505591 consensus Ankyrin repeat protein [General function 94.84
cd01178101 IPT_NFAT IPT domain of the NFAT family of transcri 94.42
PF0061221 IQ: IQ calmodulin-binding motif; InterPro: IPR0000 93.58
cd0117697 IPT_RBP-Jkappa IPT domain of the recombination sig 93.43
PF08549669 SWI-SNF_Ssr4: Fungal domain of unknown function (D 93.18
cd01177102 IPT_NFkappaB IPT domain of the transcription facto 92.91
COG5022 1463 Myosin heavy chain [Cytoskeleton] 91.5
smart0001526 IQ Short calmodulin-binding motif containing conse 87.35
PTZ00014821 myosin-A; Provisional 82.62
COG5022 1463 Myosin heavy chain [Cytoskeleton] 82.1
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
Probab=100.00  E-value=1e-123  Score=1082.81  Aligned_cols=784  Identities=38%  Similarity=0.599  Sum_probs=559.7

Q ss_pred             CccccccccccCCCCCchhhHHHHHHHHHHhcCChhHHHHHHhcCccceeccCCCCCCCCccEEeeehhhhhcccccCcc
Q 003650            1 MAELLVGSEIHGFHTLKDLDVANMMEEAKTRWLRPNEIHAILCNSKYFSINAKPVNLPKSGTVVLFDRKMLRNFRKDGHN   80 (805)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~w~~~~e~~~~l~~~~~~~~~~~~~~~p~~g~~~~~~r~~~~~~~~dg~~   80 (805)
                      +++++..++++.|.+.+.||+..|++|+++|||+|+||++||+||++|.|+++||+||.|||+||||||+|||||||||+
T Consensus         5 ~~n~~~is~~l~~~sl~~l~~~~ll~~~~~rWl~~~EI~~il~n~~~~~lt~~s~trp~sGS~flfnRk~lr~fRKDGh~   84 (975)
T KOG0520|consen    5 SSNRHIISIILPFKSLQDLDIQTLLPEAKSRWLTPEEILAILINHEKFTLTVSSPTRPQSGSIFLFNRKVLRYFRKDGHN   84 (975)
T ss_pred             cccccccceeechhhhhhhhhhhhhHHHHhccCChHHHHHHHhcccccccccCCCCCCCCCceeeeccHHHHHHhhcchh
Confidence            35688899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeccCCCchhhhhhhcccCCEeeEEEEeeecCCCCcceeeEeecccCCCCceEEEeccccCCCCCC----C----CCCC
Q 003650           81 WKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYRETHEGTPA----T----PPNS  152 (805)
Q Consensus        81 w~~~~~~~~~~e~~~~lk~~~~~~~~~~y~~~~~~~~f~rr~y~~~~~~~~~~vlvhy~~~~~g~~~----~----~~~~  152 (805)
                      |||||||||||||||||||||+|+||||||||+++||||||||||||+.++||||||||||++.+..    .    ++.+
T Consensus        85 WkKkkDGKtirEaHe~LKvg~~~~l~~~Y~Hg~~~ptF~RRcYwllq~~~~hIVLVHYl~v~~~~~~~~~~~~~~~s~~s  164 (975)
T KOG0520|consen   85 WKKKKDGKTIREAHEKLKVGGVEVLHCYYAHGEINPTFQRRCYWLLQQELEHIVLVHYLNVKGNEDAAKGAGEIFSSIIS  164 (975)
T ss_pred             hhhcCCCCcChHHHHhhccCCccceeeeeecccccchHHHHHHHhhccccCceEEEEEeecccccccccCcccccccccc
Confidence            9999999999999999999999999999999999999999999999999999999999999984321    1    1111


Q ss_pred             CCC-C---CCCCCCCcc-----cccccCCCCCCcCCCCCccccCCCCCccccccccccccccccc-cccccccCCCCCCC
Q 003650          153 HSS-S---ISDQSAPLL-----LSEEFNSGAGHAYSAGGKELQAPNESLTVQNHEMRLHELNTLE-WDDLVVTNDSNDST  222 (805)
Q Consensus       153 ~~~-~---~~~~~~~~~-----~~~~~~s~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~  222 (805)
                      +.. +   ...++++++     ..+++++..+.+    .+.......+ ...+|...+++.++.+ |..++.+.++....
T Consensus       165 d~~~S~~~~~~q~~~~~~~~~s~~~~v~~i~s~~----~~~~~g~~~~-~s~~h~i~~~~~~s~~~~~~~p~s~~s~~~~  239 (975)
T KOG0520|consen  165 DKAWSLNQLAGQLSPIFHNHSSVNEDVAEINSNQ----TGNALGSVFG-NSRNHRIRLHEVNSLDPLYKLPVSDDSLNLS  239 (975)
T ss_pred             cccccHHHhhcccCcchhcccchHHHHHHHhhhc----cccccccccC-cchhhhhcccccCCccccccccccCCccccc
Confidence            110 0   111222211     112222221100    0000001111 1235666777776665 77776654432222


Q ss_pred             CCCCCCCccccccccccccCCCCCCCCCCCCCCcc-cccCCCCc-CCCCCCccCCCC--------ccccCCccccccccc
Q 003650          223 EPRGDKFSHFDQQNHTAIKGAASNGSFFPSHDSYA-EVSSGGCL-TSLSQPIDRSNN--------TQFNNLDGVYSELMG  292 (805)
Q Consensus       223 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~-~~~~~~~~~~~~--------~~~~~~~~~~~~~~~  292 (805)
                      .+....+   .+.....-..+.++........... +....++. ....+.+.+..+        +....++...+...+
T Consensus       240 ~~~~~~~---~~~~~~~~~rs~~~s~~te~l~n~~~~~~~~g~s~s~~l~~i~~~~~~~~~~~~~p~~~nf~~~ss~~s~  316 (975)
T KOG0520|consen  240 APKPIDL---PKGPTSVKQRSSSPSYFTEILGNAPSGLVSQGNSLSSSLQRISSFTGLDNAAYEQPNSQNFEPNSSLNSH  316 (975)
T ss_pred             cCCCccc---ccCCcchhhcCCCCcchhhhcccCCCcccccccccccchhhcccccccccccccCCccccccccccCCCC
Confidence            2211110   0000000000000000000000000 00000000 000111100000        000000001111100


Q ss_pred             cccc--cccccccCCcccCCC-c----cc-ccccCCCCCcchhhhhhhhhhCCCCCC-------CC----CCCCCCCCCC
Q 003650          293 TQSS--VSSQRNEFGEVCTGD-S----LD-ILAGDGLQSQDSFGKWMNYIMTDSPGS-------VD----DPVLEPSISS  353 (805)
Q Consensus       293 ~~~~--~~~~~~~~~~~~~~~-~----~~-~~~~~~~~~~~sf~~w~~~~~~~~~~~-------~~----~~~~~~~~~~  353 (805)
                      ..+.  ....+.++++....+ .    .+ .+.++++++.|+|.+||+.....+...       .-    +++.++.+  
T Consensus       317 ~~~~~~g~g~~~~~~sa~~~~~P~~~~~~~~~~~~~l~sgdsf~~~~~t~~e~~d~~q~~s~~~~~~p~~~~~~~~~s--  394 (975)
T KOG0520|consen  317 VTGQSYGQGLQARSPSATSESRPITSAADAALSELGLKSGDSFSRWASTFGEISDLGQDPSGEAVWTPENDPMGPPGS--  394 (975)
T ss_pred             ccccccCccccCCCcccccccCCcchhhccccccccccccccccchhhhhcccccCCCCCccccccccCCCcCCCccc--
Confidence            0000  000111222211111 1    22 356889999999999999743322211       11    11122222  


Q ss_pred             CCCCCCCCCcceeeEEecCCCccCCCCeEEEEECCCCCCcccCCCCcEEEEcCCeecceeeccccceeeeCCCCCCCeeE
Q 003650          354 GHHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFL  433 (805)
Q Consensus       354 ~~~~s~~~~~~f~I~d~sP~w~~~~gg~kVlI~G~f~~~~~~~~~~~~~c~FG~v~Vpa~~~~~gvLrC~~Pph~~G~V~  433 (805)
                      ..+|| +++|+|+|+||||+|+|++||+||+|+|++.    +.+..+|+||||+++|||++|++||||||||||.||.|+
T Consensus       395 ~~~~S-~p~qlf~I~DfSP~Wsy~~ggvKVlV~G~~~----~~~~~~ysc~Fg~~~VPAeliq~GVLrC~~P~h~~G~V~  469 (975)
T KOG0520|consen  395 FLSPS-SPEQLFTITDFSPEWSYLDGGVKVLVTGFPQ----DETRSNYSCMFGEQRVPAELIQEGVLRCYAPPHEPGVVN  469 (975)
T ss_pred             ccCCC-CCcceeeeeccCcccccCCCCcEEEEecCcc----ccCCCceEEEeCCccccHHHhhcceeeeecCccCCCeEE
Confidence            34555 3499999999999999999999999999733    335899999999999999999999999999999999999


Q ss_pred             EEEEeC-CCCccccccccccCCCC--cccCCCCccccchhhHHHHHHHHHHHHhccccccccccCCCCCCchHHHhh--h
Q 003650          434 LYMSLD-GHKPISQVLNFEYRSPQ--LHAPVASSEDKSKWEEFQVQMRLAHLLFSSFKGLNILSSKVPPNSLKEAKK--F  508 (805)
Q Consensus       434 l~v~~~-n~~~~se~~~Feyr~~~--~~~~~~~~~~~~~~~el~l~~Rl~~ll~~~~~~lqil~~k~~~~~l~d~~~--~  508 (805)
                      |||+|+ ++..|+++++|+|...+  .+++.+   -++...++.++.||..++....   +++.++..+....+...  +
T Consensus       470 l~V~c~~~~~~~se~ref~~~~~~~~~~d~~s---~~d~~~~~sl~~rl~~~~~r~~---~~~~s~~~~~n~~~~~~~~l  543 (975)
T KOG0520|consen  470 LQVTCRISGLACSEVREFAYLVQPSQQIDKLS---WEDFLFQMSLLHRLETMLNRKQ---SILSSKPSTENTSDAESGNL  543 (975)
T ss_pred             EEEEecccceeeeeehheeecccCcccccccc---cccchhhhHHHHHHHHHHHHhH---hHhhccCCccccccccchhH
Confidence            999999 89999999999999743  223222   1122345566666666654222   35566777777777776  8


Q ss_pred             hhhhhcccCCHHH-HHHHhCCCCCCcccccchHHHHHHcCCcHHHHHHHHHc--CCCCCccCCCCChHHHHHHHcCCHHH
Q 003650          509 ASKSTCISNSWAY-LFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVE--GSKTTEYDVHGQGVIHLCAMLGYTWA  585 (805)
Q Consensus       509 a~~i~~~~~~~~~-li~~l~~~~~~~~~~~t~L~~Aa~~~~l~~~lv~~Ll~--Gadin~~D~~G~T~LH~Aa~~G~~~~  585 (805)
                      +.+++...+.|.+ +++....+.......+..++...++..+..||++.+++  |......|.+|+..+|++|..|+.++
T Consensus       544 ~skv~~l~~~~~~r~~~~~~~~~~~~~~~r~~lllhL~a~~lyawLie~~~e~~~~~~~eld~d~qgV~hfca~lg~ewA  623 (975)
T KOG0520|consen  544 ASKVVHLLNEWAYRLLKSISENLSSSVNFRDMLLLHLLAELLYAWLIEKVIEWAGSGDLELDRDGQGVIHFCAALGYEWA  623 (975)
T ss_pred             HHHHHHHHHHHHHHHHhhHhhhccccCCCcchHHHHHHHHHhHHHHHHHHhcccccCchhhcccCCChhhHhhhcCCcee
Confidence            8999999999999 88888777777776666777666777778999999999  55566699999999999999999999


Q ss_pred             HHHHHHCCCCCCcccCCCCchhhHHHhcCCHHHHHHHHHcCCCCCCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHHcc
Q 003650          586 ILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQA  665 (805)
Q Consensus       586 v~~LL~~Gadvn~~D~~G~TpLh~Aa~~G~~~iV~~LL~~GAd~n~~td~~~~d~~G~TpL~lA~~~g~~~iv~lLle~G  665 (805)
                      +.+.+..|..++.+|.+||||||||+.+||..++..|++.|++.+++|||+..+..|.|+.++|..+|+.++..+|.++.
T Consensus       624 ~ll~~~~~~ai~i~D~~G~tpL~wAa~~G~e~l~a~l~~lga~~~~~tdps~~~p~g~ta~~la~s~g~~gia~~lse~~  703 (975)
T KOG0520|consen  624 FLPISADGVAIDIRDRNGWTPLHWAAFRGREKLVASLIELGADPGAVTDPSPETPGGKTAADLARANGHKGIAGYLSEKA  703 (975)
T ss_pred             EEEEeecccccccccCCCCcccchHhhcCHHHHHHHHHHhccccccccCCCCCCCCCCchhhhhhcccccchHHHHhhhH
Confidence            98888999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             cccCcccccccc-ccccccccccchhhcccC---CcchhhhhhhhHHHHHhHHHHHHHHHHHHhhhhHHHHHHH-hhcCC
Q 003650          666 LVAQFNDMTLAG-NISGSLQTGSTITVDTQN---LTEDEVYLKDTLSAYRTAAEAAARIQAAFREHSLKVQTKA-IRFSS  740 (805)
Q Consensus       666 a~~~~~~~~l~~-~i~~~~~~~~~~~~~~~~---~~~~~~slkd~LaA~r~Aa~aA~~iQ~afR~~s~r~R~q~-~~~~~  740 (805)
                      +..++.++.+.+ +++.......+.......   -..+..+|+|.|+|+|+|++||+|||.+||+..++++... +..+.
T Consensus       704 L~~~~~~~~~~~~~~s~~~~~~~~~~t~~e~s~~~~~~~~sl~Dtl~avrdAa~aa~r~q~vfr~~~~~~~~a~~i~~~~  783 (975)
T KOG0520|consen  704 LSAHLSNLELADPNLSADSEEDKAEKTSSEGSPNPDEDSDSLKDTLAAVRDAAQAAARIQAVFRAQSFQKKQAREIMDAT  783 (975)
T ss_pred             HHHHHhhccccccccCCCchhhhhhhccCCCCCCCCccccccccccccccchHHHHHhhhhhhhhhhhhhhhHHHHHhhc
Confidence            888888888777 454444443333331211   1233345999999999999999999999999999954443 33334


Q ss_pred             cHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHhhhhccC
Q 003650          741 PEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEFLNMRRQAIKIQVILLCIVL  805 (805)
Q Consensus       741 ~~~~a~~l~Aa~~iq~~~r~~~~~~~~~AAv~IQ~~~Rg~~~Rk~f~~~r~~~v~IQ~~~Rg~~~  805 (805)
                      +...+..+...++++.+|+.+..+....||..||+.|||||.|++|+.+|+.+|+||+++|||++
T Consensus       784 ~~~i~~~~~~~m~~~~a~~~~~~r~~~~aa~~iq~~f~~yk~r~~~l~tr~p~v~iqa~~rg~q~  848 (975)
T KOG0520|consen  784 KEQISEELAVSMKASSAFSMCDDRSDPAAASRIQKKFRGYKQRKEFLSTRQPIVKIQAAVRGYQV  848 (975)
T ss_pred             chhhhhhhhhhhhcccchhcCccccchhHHHHhhhhhhhHHhhhhhcccCCccccchhhhhchhH
Confidence            55555778888999999988888888999999999999999999999999999999999999985



>PF03859 CG-1: CG-1 domain; InterPro: IPR005559 CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein [] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd01175 IPT_COE IPT domain of the COE family (Col/Olf-1/EBF) of non-basic, helix-loop-helix (HLH)-containing transcription factors Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PF01833 TIG: IPT/TIG domain; InterPro: IPR002909 This family consists of a domain that has an immunoglobulin like fold Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>cd01179 IPT_plexin_repeat2 Second repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) Back     alignment and domain information
>cd00102 IPT Immunoglobulin-like fold, Plexins, Transcription factors (IPT) Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>cd00603 IPT_PCSR IPT domain of Plexins and Cell Surface Receptors (PCSR) and related proteins Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>cd01180 IPT_plexin_repeat1 First repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>smart00429 IPT ig-like, plexins, transcription factors Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd01181 IPT_plexin_repeat3 Third repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>cd02849 CGTase_C_term Cgtase (cyclodextrin glycosyltransferase) C-terminus domain Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] Back     alignment and domain information
>cd00604 IPT_CGTD IPT domain (domain D) of cyclodextrin glycosyltransferase (CGTase) and similar enzymes Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>KOG3836 consensus HLH transcription factor EBF/Olf-1 and related DNA binding proteins [Transcription] Back     alignment and domain information
>smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] Back     alignment and domain information
>cd00602 IPT_TF IPT domain of eukaryotic transcription factors NF-kappaB/Rel, nuclear factor of activated Tcells (NFAT), and recombination signal J-kappa binding protein (RBP-Jkappa) Back     alignment and domain information
>KOG3610 consensus Plexins (functional semaphorin receptors) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd01178 IPT_NFAT IPT domain of the NFAT family of transcription factors Back     alignment and domain information
>PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K Back     alignment and domain information
>cd01176 IPT_RBP-Jkappa IPT domain of the recombination signal Jkappa binding protein (RBP-Jkappa) Back     alignment and domain information
>PF08549 SWI-SNF_Ssr4: Fungal domain of unknown function (DUF1750); InterPro: IPR013859 This is a fungal protein of unknown function Back     alignment and domain information
>cd01177 IPT_NFkappaB IPT domain of the transcription factor NFkappaB and related transcription factors Back     alignment and domain information
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues Back     alignment and domain information
>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query805
2cxk_A95 Crystal Structure Of The Tig Domain Of Human Calmod 9e-10
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 3e-05
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 8e-05
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 8e-05
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-04
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-04
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 3e-04
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 3e-04
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 4e-04
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 4e-04
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 4e-04
1uoh_A226 Human Gankyrin Length = 226 5e-04
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 5e-04
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 6e-04
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 6e-04
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 7e-04
2xee_A157 Structural Determinants For Improved Thermal Stabil 8e-04
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 8e-04
>pdb|2CXK|A Chain A, Crystal Structure Of The Tig Domain Of Human Calmodulin- Binding Transcription Activator 1 (Camta1) Length = 95 Back     alignment and structure

Iteration: 1

Score = 62.4 bits (150), Expect = 9e-10, Method: Composition-based stats. Identities = 30/88 (34%), Positives = 51/88 (57%), Gaps = 6/88 (6%) Query: 367 ITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPP 426 +TD SP W++ K+L+TG + + + +N C+ ++ VPA +Q GV RC+ P Sbjct: 9 VTDYSPEWSYPEGGVKVLITGPWQE-----ASNNYSCLFDQISVPASLIQPGVLRCYCPA 63 Query: 427 HSPGLFLLYMSLDGHKPISQVLNFEYRS 454 H GL L ++ + ++ IS + FEY+S Sbjct: 64 HDTGLVTLQVAFN-NQIISNSVVFEYKS 90
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query805
2cxk_A95 Camta1, calmodulin binding transcription activator 5e-31
2ix7_C58 Myosin-5A; contractIle protein/metal binding, acti 2e-09
2ix7_C58 Myosin-5A; contractIle protein/metal binding, acti 1e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-06
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-08
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-06
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-06
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-05
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-09
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-06
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-08
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-04
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-05
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-08
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-06
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-07
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-07
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-07
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-06
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 9e-05
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-07
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-07
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-07
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-04
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-08
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-08
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-07
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-07
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-08
3v30_A172 DNA-binding protein rfxank; structural genomics co 7e-08
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-07
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-06
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-04
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-06
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-06
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-08
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-05
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-07
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 5e-06
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-07
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-07
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-05
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-06
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-06
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-07
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-07
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-05
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-07
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-07
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-05
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-07
2rfa_A232 Transient receptor potential cation channel subfa 2e-07
2rfa_A232 Transient receptor potential cation channel subfa 2e-06
2rfa_A232 Transient receptor potential cation channel subfa 8e-06
2rfa_A232 Transient receptor potential cation channel subfa 1e-05
2rfa_A232 Transient receptor potential cation channel subfa 5e-05
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-07
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-04
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-05
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-05
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 8e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-04
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-07
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 9e-05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-04
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-07
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-05
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-07
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-07
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-06
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-06
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-07
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-04
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-06
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-06
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-07
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-07
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-04
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-07
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-06
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-04
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-06
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-06
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-06
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-06
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-06
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-06
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-06
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-05
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-05
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-04
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-04
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-04
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-06
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-06
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-06
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 8e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-06
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-06
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-06
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-05
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-05
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-05
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-04
2etb_A256 Transient receptor potential cation channel subfam 5e-06
2etb_A256 Transient receptor potential cation channel subfam 2e-04
2pnn_A273 Transient receptor potential cation channel subfa 9e-06
2pnn_A273 Transient receptor potential cation channel subfa 4e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-05
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-05
3muj_A138 Transcription factor COE3; immunoglobulin like fol 4e-05
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-04
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-04
1kk8_A837 Myosin heavy chain, striated muscle; actin-detache 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>2cxk_A Camta1, calmodulin binding transcription activator 1; structural genomics, TIG/IPT domain, NPPSFA; 1.85A {Homo sapiens} SCOP: b.1.18.1 Length = 95 Back     alignment and structure
 Score =  115 bits (290), Expect = 5e-31
 Identities = 30/92 (32%), Positives = 50/92 (54%), Gaps = 6/92 (6%)

Query: 364 LFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCF 423
              +TD SP W++     K+L+TG + +     + +N  C+  ++ VPA  +Q GV RC+
Sbjct: 6   SGMVTDYSPEWSYPEGGVKVLITGPWQE-----ASNNYSCLFDQISVPASLIQPGVLRCY 60

Query: 424 LPPHSPGLFLLYMSLDGHKPISQVLNFEYRSP 455
            P H  GL  L ++ +  + IS  + FEY+S 
Sbjct: 61  CPAHDTGLVTLQVAFNN-QIISNSVVFEYKSG 91


>2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 Back     alignment and structure
>2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3muj_A Transcription factor COE3; immunoglobulin like fold, helix-loop-helix, structural genom consortium, SGC, DNA binding protein; 1.92A {Homo sapiens} PDB: 3mqi_A Length = 138 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 805
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-11
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-08
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-05
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-04
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.001
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 9e-11
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.001
d2cxka182 b.1.18.1 (A:872-953) Calmodulin binding transcript 7e-10
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-06
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.003
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.004
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-04
d1kk8a2789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 2e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.004
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 63.8 bits (154), Expect = 3e-11
 Identities = 24/128 (18%), Positives = 48/128 (37%), Gaps = 11/128 (8%)

Query: 548 KLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTAL 607
            + + L++    G         G   +H+ +  G    +         ++ + K G++ L
Sbjct: 278 PVADVLIKH---GVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPL 334

Query: 608 HWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALV 667
           H AA  G   +V  LL  GA PN        +  G     IA + G+  +   L  + + 
Sbjct: 335 HQAAQQGHTDIVTLLLKNGASPNE------VSSDGTTPLAIAKRLGYISVTDVL--KVVT 386

Query: 668 AQFNDMTL 675
            + + + +
Sbjct: 387 DETSFVLV 394


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query805
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.7
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.69
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.69
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.66
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.66
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.66
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.63
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.61
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.59
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.58
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.57
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.56
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.55
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.54
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.53
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.53
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.51
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.5
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.49
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.49
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.45
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.44
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.44
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.42
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.39
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.37
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.35
d2cxka182 Calmodulin binding transcription activator 1 {Huma 99.33
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.33
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.32
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.28
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.24
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.15
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.1
d1qhoa181 Five domain "maltogenic" alpha-amylase (glucan 1,4 97.97
d1p7hl1103 T-cell transcription factor NFAT1 (NFATC2) {Human 97.94
d1uadc_92 Exocyst complex component Sec5, Ral-binding domain 97.9
d3bmva183 Cyclomaltodextrin glycanotransferase, domain D {Th 97.63
d1cyga183 Cyclomaltodextrin glycanotransferase, domain D {Ba 97.59
d1cxla187 Cyclomaltodextrin glycanotransferase, domain D {Ba 97.56
d3brda1119 DNA-binding protein LAG-1 (CSL) {Caenorhabditis el 97.53
d2mysa2794 Myosin S1, motor domain {Chicken (Gallus gallus), 97.46
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 97.4
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 96.27
d2mysa2794 Myosin S1, motor domain {Chicken (Gallus gallus), 96.2
d1imhc1101 T-cell transcription factor NFAT5 (TONEBP) {Human 94.8
d1gjia1100 p65 subunit of NF-kappa B (NFKB), dimerization dom 94.31
d1u36a_104 p50 subunit of NF-kappa B transcription factor {Hu 92.7
d1my7a_107 p65 subunit of NF-kappa B (NFKB), dimerization dom 92.65
d1w7ja2730 Myosin S1, motor domain {Chicken (Gallus gallus), 92.55
d1a3qa1101 p52 subunit of NF-kappa B (NFKB) {Human (Homo sapi 92.17
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.70  E-value=4.3e-16  Score=144.71  Aligned_cols=103  Identities=21%  Similarity=0.188  Sum_probs=95.5

Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCC-CCCCCCHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             9998755789980999999909999999999889998722-478981435988619989999999739999988899989
Q 003650          560 GSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFR-DKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQ  638 (805)
Q Consensus       560 Ga~in~~D~~G~T~LH~Aa~~G~~~~v~~LL~~Ga~in~~-D~~G~TpLh~Aa~~G~~~iV~~LL~~GA~~n~~tdp~~~  638 (805)
                      +.+++.+|..|.||||+|+..|+.+++++|+..+++.+.. +..|.||||+|+..|+.+++++|+++|++++.      +
T Consensus       148 ~~~in~~d~~g~TpLh~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~TpL~~A~~~~~~~~v~~Ll~~gadin~------~  221 (255)
T d1oy3d_         148 RLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTA------R  221 (255)
T ss_dssp             GGGTTCCCTTSCCHHHHHHHTTCHHHHHHHHHHTCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTC------C
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCC------C
T ss_conf             8663310046763223332232222221000013331221334443322001233399999999987899888------7


Q ss_pred             CCCCCCHHHHHHHCCCHHHHHHHHHCCCCC
Q ss_conf             999996999999829799999999814523
Q 003650          639 NPGGLNAADIASKKGFDGLAAFLSEQALVA  668 (805)
Q Consensus       639 d~~G~TpL~lA~~~g~~~iv~lLle~ga~~  668 (805)
                      |..|.||||+|+..++.+++++|+++||+.
T Consensus       222 d~~g~t~L~~A~~~~~~~i~~~Ll~~Ga~~  251 (255)
T d1oy3d_         222 MYGGRTPLGSALLRPNPILARLLRAHGAPE  251 (255)
T ss_dssp             CTTSCCHHHHHHTSSCHHHHHHHHHTTCCC
T ss_pred             CCCCCCHHHHHHHCCCHHHHHHHHHCCCCC
T ss_conf             999999999999878899999999769899



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhoa1 b.1.18.2 (A:496-576) Five domain "maltogenic" alpha-amylase (glucan 1,4-alpha-maltohydrolase), domain D {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p7hl1 b.1.18.1 (L:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uadc_ b.1.18.18 (C:) Exocyst complex component Sec5, Ral-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3bmva1 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1cyga1 b.1.18.2 (A:492-574) Cyclomaltodextrin glycanotransferase, domain D {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cxla1 b.1.18.2 (A:497-583) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]} Back     information, alignment and structure
>d3brda1 b.1.18.1 (A:542-660) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1imhc1 b.1.18.1 (C:368-468) T-cell transcription factor NFAT5 (TONEBP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gjia1 b.1.18.1 (A:182-281) p65 subunit of NF-kappa B (NFKB), dimerization domain {Chicken (Gallus gallus), C-rel [TaxId: 9031]} Back     information, alignment and structure
>d1u36a_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1my7a_ b.1.18.1 (A:) p65 subunit of NF-kappa B (NFKB), dimerization domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1a3qa1 b.1.18.1 (A:227-327) p52 subunit of NF-kappa B (NFKB) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure