Citrus Sinensis ID: 003662
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 805 | ||||||
| 255581042 | 856 | DNA binding protein, putative [Ricinus c | 0.970 | 0.912 | 0.605 | 0.0 | |
| 297741475 | 841 | unnamed protein product [Vitis vinifera] | 0.957 | 0.916 | 0.582 | 0.0 | |
| 225439735 | 896 | PREDICTED: uncharacterized protein LOC10 | 0.967 | 0.869 | 0.569 | 0.0 | |
| 38230506 | 868 | predicted protein [Populus tremula x Pop | 0.939 | 0.870 | 0.605 | 0.0 | |
| 356548148 | 852 | PREDICTED: uncharacterized protein LOC10 | 0.946 | 0.894 | 0.571 | 0.0 | |
| 356536874 | 855 | PREDICTED: uncharacterized protein LOC10 | 0.946 | 0.891 | 0.570 | 0.0 | |
| 449440345 | 842 | PREDICTED: uncharacterized protein LOC10 | 0.937 | 0.896 | 0.562 | 0.0 | |
| 358346906 | 897 | Chromodomain-helicase-DNA-binding protei | 0.982 | 0.881 | 0.558 | 0.0 | |
| 297827261 | 862 | PHD finger family protein [Arabidopsis l | 0.937 | 0.875 | 0.536 | 0.0 | |
| 334184778 | 829 | acyl-CoA N-acyltransferase with RING/FYV | 0.927 | 0.901 | 0.539 | 0.0 |
| >gi|255581042|ref|XP_002531337.1| DNA binding protein, putative [Ricinus communis] gi|223529059|gb|EEF31044.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 929 bits (2401), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 501/827 (60%), Positives = 594/827 (71%), Gaps = 46/827 (5%)
Query: 1 MGESAVCLEVPADGEMDVECSSRTESKQDRELLTDN-VESDSFPNGKHAKEEALNDDIKS 59
MGE+AVC+++ + + + +S TE K+D + L DN E++SFPN K AKE N+DIKS
Sbjct: 1 MGEAAVCVDITTENDNN---TSGTELKRDHQFLIDNDTETESFPNKKQAKES--NEDIKS 55
Query: 60 EVSNPVVSPKEFTSS------LQDITSQETKLVTESCNQVLSTTSTGNLSSEETLSDGDE 113
EVSNP++SPKE ++ DITSQ T+ ++ + G + E T +
Sbjct: 56 EVSNPIISPKENNNNNASSSSWHDITSQPTE-------ELATANQLGGVGGEVTSTISGN 108
Query: 114 RTESSYAETSRTDNNS----GD---VSKSHVVLEIPKHVSSSSGIRKITFKFSKRKEDYV 166
SS E S +NN+ GD VS SHVVLEIPKH +S++GIRKITFKFSKRKEDY
Sbjct: 109 SCPSS--EHSSENNNASICNGDCDSVSTSHVVLEIPKH-ASTTGIRKITFKFSKRKEDYD 165
Query: 167 APLAYE----EGRNYTLYD---DLGSSGANDGVLCARNMEIKMSKKVVPNEYPTNVKKLL 219
L E R ++ D ++ +G D CA NME+KMSKKV+PN +P+NVKKLL
Sbjct: 166 TRLNQELSPSRSREFSWVDSGTEMPETG--DRYFCAPNMELKMSKKVLPNTFPSNVKKLL 223
Query: 220 STGILDGACVKYISTSRERQLDGIVNGGGYLCGCPLCNFSKVVSAHEFEQHAGAKTRHPN 279
STGILDGA VKYIS RE L GI++GGGYLCGCP CNFS+V++A+EFE HAGAKTRHPN
Sbjct: 224 STGILDGARVKYISPQRE--LYGIIDGGGYLCGCPSCNFSRVLTAYEFELHAGAKTRHPN 281
Query: 280 NHIYLENGKPIYSIIQELKTAPLGILEEVVKKVAGSSFNEGSFRVWKASHHLRKGLVEHD 339
NHIYLENGKPI SIIQELK APLG ++EV+K AGSS NE F+VWKAS H G++ D
Sbjct: 282 NHIYLENGKPICSIIQELKAAPLGAVDEVIKDAAGSSINEEFFQVWKASLHQCNGIIGAD 341
Query: 340 EKHNMKLPSLPHSIISCSSLALEESISPTSCSFVQDTGREQTHMKEMLEERKRGVKRP-- 397
EK LP PHS+ S SS LEES P SFV + + EE KR +RP
Sbjct: 342 EKCYSMLPYSPHSLGSYSSQGLEESGCPPCSSFVHSNPFRRQKYMDSSEEHKRAFRRPSS 401
Query: 398 FMHQKRTAEGGTKKRDNDLHRLLFLPNGLPDGERLTYIVKGQRLRFGCKQGNGIVCDCCN 457
H K+T EGGT++RDNDLHRLLF+PNGLPDG L Y +KGQ++ G KQGNGIVC CC+
Sbjct: 402 LSHPKKTNEGGTRRRDNDLHRLLFMPNGLPDGAELAYYIKGQKMLAGYKQGNGIVCSCCD 461
Query: 458 KEISPSQFEAHAGMAARRQPYRHIYTSNGMTLHDIAISLAMGQRRTTGGSDDMCHVCGDG 517
+EISPSQFEAHAGMAARRQPYRHIYTSNG+TLHDIA SLA GQ TTG SDDMC CGDG
Sbjct: 462 REISPSQFEAHAGMAARRQPYRHIYTSNGLTLHDIATSLANGQNLTTGLSDDMCAECGDG 521
Query: 518 ENLLLCNGCPLAFHAACLDPLLIPESGWRCPNCRQ-GHSSSMSRS--VDLKGGLEAPGAE 574
+L+ C CP AFH CL +P W CPNC + GH + SRS + L ++ P E
Sbjct: 522 GDLIFCESCPRAFHLVCLGLKYVPSDVWHCPNCNKFGHGGNFSRSIVIRLTRVVKTPEYE 581
Query: 575 VGGCVICRSHDFSAATFDDRTVIYCDQCEKEFHVGCLRKNGLCDLKEIPKDKWFCCDDCN 634
VGGCV CR+HDFS TF+DRTVI CDQCE+EFHVGCLR NGLCDLKEIPKD WFC +DCN
Sbjct: 582 VGGCVFCRAHDFSTHTFNDRTVILCDQCEREFHVGCLRDNGLCDLKEIPKDNWFCSNDCN 641
Query: 635 RIHAALQDFVSNRAQTIPASSLSTINRKHIEKGILFDGTMNDVQWQMLKKAQCFEEKEKS 694
RI+ ALQ+FVS+ Q IP+ L+ I KH EKG+ DG ND QW++L ++E + S
Sbjct: 642 RIYEALQNFVSSGVQMIPSLQLNIITGKHAEKGLYIDGQANDFQWRILMGKSRYQE-DLS 700
Query: 695 LLSSATAIFRECFDPIIAECGRDLIPVMVYGRNISGQEFGGMYSVILTVKSVVVSAGLLR 754
LLS+A AIFRECFDPI+A+ GRDLIPVMVYGRNISGQEFGGMY V+L VK+VVVSAGLLR
Sbjct: 701 LLSAAAAIFRECFDPIVAKSGRDLIPVMVYGRNISGQEFGGMYCVLLLVKNVVVSAGLLR 760
Query: 755 IFGREVAELPLVATCREYQGKGCFQALFSCIERLLCSLNVENLVLPA 801
IFGR+VAELPLVAT RE+QGKG FQALFSCIERLLCSLNV LVLPA
Sbjct: 761 IFGRDVAELPLVATSREHQGKGYFQALFSCIERLLCSLNVVKLVLPA 807
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297741475|emb|CBI32607.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225439735|ref|XP_002273013.1| PREDICTED: uncharacterized protein LOC100246491 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|38230506|gb|AAR14274.1| predicted protein [Populus tremula x Populus alba] | Back alignment and taxonomy information |
|---|
| >gi|356548148|ref|XP_003542465.1| PREDICTED: uncharacterized protein LOC100808999 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356536874|ref|XP_003536958.1| PREDICTED: uncharacterized protein LOC100794242 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449440345|ref|XP_004137945.1| PREDICTED: uncharacterized protein LOC101207817 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|358346906|ref|XP_003637505.1| Chromodomain-helicase-DNA-binding protein [Medicago truncatula] gi|355503440|gb|AES84643.1| Chromodomain-helicase-DNA-binding protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297827261|ref|XP_002881513.1| PHD finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297327352|gb|EFH57772.1| PHD finger family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|334184778|ref|NP_181288.4| acyl-CoA N-acyltransferase with RING/FYVE/PHD-type zinc finger domain-containing protein [Arabidopsis thaliana] gi|330254317|gb|AEC09411.1| acyl-CoA N-acyltransferase with RING/FYVE/PHD-type zinc finger domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 805 | ||||||
| TAIR|locus:2040550 | 1007 | AT2G36720 "AT2G36720" [Arabido | 0.281 | 0.225 | 0.5 | 1.3e-110 | |
| TAIR|locus:2168088 | 425 | AT5G59830 "AT5G59830" [Arabido | 0.170 | 0.322 | 0.543 | 3.9e-42 | |
| TAIR|locus:2173179 | 537 | AT5G13660 "AT5G13660" [Arabido | 0.306 | 0.459 | 0.378 | 2.1e-38 | |
| TAIR|locus:2201021 | 1138 | AT1G05380 "AT1G05380" [Arabido | 0.124 | 0.087 | 0.407 | 1.3e-32 | |
| TAIR|locus:2086395 | 1189 | ROS4 "AT3G14980" [Arabidopsis | 0.293 | 0.198 | 0.291 | 2e-31 | |
| TAIR|locus:2147391 | 1179 | AT5G36740 [Arabidopsis thalian | 0.124 | 0.084 | 0.389 | 1.2e-22 | |
| TAIR|locus:2832118 | 1193 | AT5G36670 [Arabidopsis thalian | 0.124 | 0.083 | 0.389 | 1.2e-18 | |
| UNIPROTKB|F1SSZ2 | 1667 | CHD5 "Uncharacterized protein" | 0.228 | 0.110 | 0.282 | 9.8e-11 | |
| UNIPROTKB|E2R1M3 | 1812 | CHD5 "Uncharacterized protein" | 0.228 | 0.101 | 0.282 | 1.1e-10 | |
| ZFIN|ZDB-GENE-041111-187 | 1930 | chd4a "chromodomain helicase D | 0.162 | 0.067 | 0.324 | 1.2e-10 |
| TAIR|locus:2040550 AT2G36720 "AT2G36720" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 589 (212.4 bits), Expect = 1.3e-110, Sum P(3) = 1.3e-110
Identities = 115/230 (50%), Positives = 155/230 (67%)
Query: 573 AEVGGCVICRSHDFSAATFDDRTVIYCDQCEKEFHVGCLRKNGLCDLKEIPKDKWFCCDD 632
AE GCV+C DF + F RT+I CDQCEKE+H+GCL + DLKE+PK WFC D
Sbjct: 701 AETNGCVLCSGSDFCRSGFGPRTIIICDQCEKEYHIGCLSSQNIVDLKELPKGNWFCSMD 760
Query: 633 CNRIHAALQDFVSNRAQTIPASSLSTINRKHIEKGILFDGTMNDVQWQMLKKAQCFEEKE 692
C RI++ LQ + A+ + SSL I K E+ ++ + D++W+++ + +
Sbjct: 761 CTRINSTLQKLLLGGAEKLSDSSLGIIQTKQ-ERNDVYSISDLDIRWRLIS-GKVTSPES 818
Query: 693 KSLLSSATAIFRECFDPIIAEC-GRDLIPVMVYGRNISGQEFGGMYSVILTVKSVVVSAG 751
+ LLS A AIF +CFDPI+ G +LIP MVYG+ + GQ++GG+ +LTV + VVSAG
Sbjct: 819 RMLLSQALAIFHDCFDPIVDPLSGSNLIPRMVYGKTMQGQDYGGICCAVLTVNATVVSAG 878
Query: 752 LLRIFGREVAELPLVATCREYQGKGCFQALFSCIERLLCSLNVENLVLPA 801
LLR+FGREVAELPLVAT + KG FQ LFSCIE+LL SLNVE++V+PA
Sbjct: 879 LLRVFGREVAELPLVATRMCSREKGYFQLLFSCIEKLLSSLNVESIVVPA 928
|
|
| TAIR|locus:2168088 AT5G59830 "AT5G59830" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173179 AT5G13660 "AT5G13660" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201021 AT1G05380 "AT1G05380" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2086395 ROS4 "AT3G14980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2147391 AT5G36740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2832118 AT5G36670 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SSZ2 CHD5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R1M3 CHD5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041111-187 chd4a "chromodomain helicase DNA binding protein 4a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 805 | |||
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 2e-08 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 1e-07 | |
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 3e-04 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 4e-04 | |
| COG5141 | 669 | COG5141, COG5141, PHD zinc finger-containing prote | 0.003 |
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
Score = 51.0 bits (122), Expect = 2e-08
Identities = 25/48 (52%), Positives = 27/48 (56%), Gaps = 7/48 (14%)
Query: 511 CHVCG---DGENLLLCNGCPLAFHAACLDPLL----IPESGWRCPNCR 551
C VCG D LLLC+GC FH ACL P L IPE W CP C+
Sbjct: 2 CAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPECK 49
|
PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51 |
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|227470 COG5141, COG5141, PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 805 | |||
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 99.1 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 99.04 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 98.95 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 98.49 | |
| COG1246 | 153 | ArgA N-acetylglutamate synthase and related acetyl | 98.45 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 98.4 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 98.39 | |
| PF00583 | 83 | Acetyltransf_1: Acetyltransferase (GNAT) family; I | 98.38 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 98.25 | |
| PF15446 | 175 | zf-PHD-like: PHD/FYVE-zinc-finger like domain | 98.24 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 98.21 | |
| PF13673 | 117 | Acetyltransf_10: Acetyltransferase (GNAT) domain; | 98.14 | |
| smart00258 | 73 | SAND SAND domain. | 98.04 | |
| PF13508 | 79 | Acetyltransf_7: Acetyltransferase (GNAT) domain; P | 98.03 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 97.97 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 97.96 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 97.94 | |
| cd04301 | 65 | NAT_SF N-Acyltransferase superfamily: Various enzy | 97.93 | |
| PRK07922 | 169 | N-acetylglutamate synthase; Validated | 97.89 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 97.89 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 97.88 | |
| PRK07757 | 152 | acetyltransferase; Provisional | 97.86 | |
| PLN02706 | 150 | glucosamine 6-phosphate N-acetyltransferase | 97.86 | |
| PRK10146 | 144 | aminoalkylphosphonic acid N-acetyltransferase; Pro | 97.85 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 97.85 | |
| PRK03624 | 140 | putative acetyltransferase; Provisional | 97.83 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 97.79 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 97.77 | |
| PHA00673 | 154 | acetyltransferase domain containing protein | 97.74 | |
| KOG1473 | 1414 | consensus Nucleosome remodeling factor, subunit NU | 97.73 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.69 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 97.69 | |
| PTZ00330 | 147 | acetyltransferase; Provisional | 97.68 | |
| PF13527 | 127 | Acetyltransf_9: Acetyltransferase (GNAT) domain; P | 97.68 | |
| PLN02825 | 515 | amino-acid N-acetyltransferase | 97.67 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 97.66 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 97.63 | |
| PRK10975 | 194 | TDP-fucosamine acetyltransferase; Provisional | 97.63 | |
| PRK10314 | 153 | putative acyltransferase; Provisional | 97.63 | |
| PHA01807 | 153 | hypothetical protein | 97.6 | |
| PF01342 | 82 | SAND: SAND domain; InterPro: IPR000770 The SAND do | 97.58 | |
| TIGR02382 | 191 | wecD_rffC TDP-D-fucosamine acetyltransferase. This | 97.53 | |
| TIGR01575 | 131 | rimI ribosomal-protein-alanine acetyltransferase. | 97.53 | |
| PRK09491 | 146 | rimI ribosomal-protein-alanine N-acetyltransferase | 97.46 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 97.44 | |
| TIGR00124 | 332 | cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP | 97.43 | |
| TIGR01890 | 429 | N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi | 97.4 | |
| PRK12308 | 614 | bifunctional argininosuccinate lyase/N-acetylgluta | 97.38 | |
| cd02169 | 297 | Citrate_lyase_ligase Citrate lyase ligase. Citrate | 97.36 | |
| PRK10140 | 162 | putative acetyltransferase YhhY; Provisional | 97.28 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 97.25 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 97.14 | |
| PRK05279 | 441 | N-acetylglutamate synthase; Validated | 97.12 | |
| TIGR02406 | 157 | ectoine_EctA L-2,4-diaminobutyric acid acetyltrans | 97.11 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 97.09 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 97.06 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 96.95 | |
| PRK01346 | 411 | hypothetical protein; Provisional | 96.82 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 96.76 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 96.71 | |
| PRK09831 | 147 | putative acyltransferase; Provisional | 96.53 | |
| COG0456 | 177 | RimI Acetyltransferases [General function predicti | 96.5 | |
| PF13420 | 155 | Acetyltransf_4: Acetyltransferase (GNAT) domain; P | 96.46 | |
| PRK15130 | 186 | spermidine N1-acetyltransferase; Provisional | 96.42 | |
| TIGR03103 | 547 | trio_acet_GNAT GNAT-family acetyltransferase TIGR0 | 96.4 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 96.38 | |
| PF13302 | 142 | Acetyltransf_3: Acetyltransferase (GNAT) domain; P | 96.34 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 96.32 | |
| PRK13688 | 156 | hypothetical protein; Provisional | 96.3 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 96.26 | |
| PF13523 | 152 | Acetyltransf_8: Acetyltransferase (GNAT) domain; P | 96.24 | |
| KOG3139 | 165 | consensus N-acetyltransferase [General function pr | 96.15 | |
| PF08445 | 86 | FR47: FR47-like protein; InterPro: IPR013653 Prote | 95.93 | |
| TIGR03585 | 156 | PseH pseudaminic acid biosynthesis N-acetyl transf | 95.87 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 95.86 | |
| PRK10809 | 194 | ribosomal-protein-S5-alanine N-acetyltransferase; | 95.83 | |
| COG3393 | 268 | Predicted acetyltransferase [General function pred | 95.69 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 95.61 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 95.59 | |
| PRK10562 | 145 | putative acetyltransferase; Provisional | 95.52 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 95.49 | |
| PRK10514 | 145 | putative acetyltransferase; Provisional | 95.46 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 95.41 | |
| KOG3396 | 150 | consensus Glucosamine-phosphate N-acetyltransferas | 95.4 | |
| COG3153 | 171 | Predicted acetyltransferase [General function pred | 95.37 | |
| PRK10151 | 179 | ribosomal-protein-L7/L12-serine acetyltransferase; | 95.18 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 95.18 | |
| COG2153 | 155 | ElaA Predicted acyltransferase [General function p | 94.52 | |
| PF08444 | 89 | Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt | 94.51 | |
| smart00258 | 73 | SAND SAND domain. | 94.13 | |
| COG1247 | 169 | Sortase and related acyltransferases [Cell envelop | 93.86 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 93.79 | |
| KOG3216 | 163 | consensus Diamine acetyltransferase [Amino acid tr | 93.61 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 93.58 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 93.56 | |
| TIGR01211 | 522 | ELP3 histone acetyltransferase, ELP3 family. The S | 93.56 | |
| PF12746 | 265 | GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S | 93.44 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 93.36 | |
| PF14542 | 78 | Acetyltransf_CG: GCN5-related N-acetyl-transferase | 92.44 | |
| KOG2488 | 202 | consensus Acetyltransferase (GNAT) domain-containi | 92.32 | |
| PF13832 | 110 | zf-HC5HC2H_2: PHD-zinc-finger like domain | 92.3 | |
| PF01342 | 82 | SAND: SAND domain; InterPro: IPR000770 The SAND do | 91.71 | |
| COG0454 | 156 | WecD Histone acetyltransferase HPA2 and related ac | 91.66 | |
| COG2388 | 99 | Predicted acetyltransferase [General function pred | 90.69 | |
| PF12568 | 128 | DUF3749: Acetyltransferase (GNAT) domain; InterPro | 90.5 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 90.45 | |
| COG1670 | 187 | RimL Acetyltransferases, including N-acetylases of | 90.18 | |
| PF13480 | 142 | Acetyltransf_6: Acetyltransferase (GNAT) domain | 89.4 | |
| KOG3397 | 225 | consensus Acetyltransferases [General function pre | 88.4 | |
| COG4552 | 389 | Eis Predicted acetyltransferase involved in intrac | 82.54 |
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
Probab=99.10 E-value=1.8e-11 Score=127.82 Aligned_cols=83 Identities=30% Similarity=0.876 Sum_probs=72.7
Q ss_pred CCceeecCCCCCcccccccCC-----CCCCCCCccccccCcCCcCCcccccccCCCCCCCCcccccCccccCCCCCCccc
Q 003662 517 GENLLLCNGCPLAFHAACLDP-----LLIPESGWRCPNCRQGHSSSMSRSVDLKGGLEAPGAEVGGCVICRSHDFSAATF 591 (805)
Q Consensus 517 gG~LL~Cd~Cp~afH~~CL~~-----~~vP~g~W~C~~C~~~~~~~~s~pirl~r~~~~~~~e~~~C~vC~~~d~s~~~~ 591 (805)
.++|+.|..|.++-|..||.. ..+....|+|..|+. |.||+-.+
T Consensus 243 peelvscsdcgrsghpsclqft~nm~~avk~yrwqcieck~-------------------------csicgtse------ 291 (336)
T KOG1244|consen 243 PEELVSCSDCGRSGHPSCLQFTANMIAAVKTYRWQCIECKY-------------------------CSICGTSE------ 291 (336)
T ss_pred chhhcchhhcCCCCCcchhhhhHHHHHHHHhheeeeeecce-------------------------eccccCcC------
Confidence 468999999999999999996 345678999999986 99999765
Q ss_pred CCCCeeccCCCCCccCcccCCCCCCCCcccCCCCCcEEcCCchh
Q 003662 592 DDRTVIYCDQCEKEFHVGCLRKNGLCDLKEIPKDKWFCCDDCNR 635 (805)
Q Consensus 592 ~~~~LL~CdqCer~yHv~CL~p~g~~~L~eiP~g~WFCc~~C~~ 635 (805)
+++.+|+||-|+|.||++||.| +|.+.|+|.|-| .-|-+
T Consensus 292 nddqllfcddcdrgyhmyclsp----pm~eppegswsc-~KOG~ 330 (336)
T KOG1244|consen 292 NDDQLLFCDDCDRGYHMYCLSP----PMVEPPEGSWSC-HLCLE 330 (336)
T ss_pred CCceeEeecccCCceeeEecCC----CcCCCCCCchhH-HHHHH
Confidence 5789999999999999999999 889999999999 66643
|
|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A | Back alignment and domain information |
|---|
| >smart00258 SAND SAND domain | Back alignment and domain information |
|---|
| >PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >PRK07922 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >PRK07757 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02706 glucosamine 6-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03624 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >PHA00673 acetyltransferase domain containing protein | Back alignment and domain information |
|---|
| >KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PTZ00330 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B | Back alignment and domain information |
|---|
| >PLN02825 amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >PRK10975 TDP-fucosamine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10314 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PHA01807 hypothetical protein | Back alignment and domain information |
|---|
| >PF01342 SAND: SAND domain; InterPro: IPR000770 The SAND domain (named after Sp100, AIRE-1, NucP41/75, DEAF-1) is a conserved ~80 residue region found in a number of nuclear proteins, many of which function in chromatin-dependent transcriptional control | Back alignment and domain information |
|---|
| >TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase | Back alignment and domain information |
|---|
| >TIGR01575 rimI ribosomal-protein-alanine acetyltransferase | Back alignment and domain information |
|---|
| >PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase | Back alignment and domain information |
|---|
| >TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional | Back alignment and domain information |
|---|
| >cd02169 Citrate_lyase_ligase Citrate lyase ligase | Back alignment and domain information |
|---|
| >PRK10140 putative acetyltransferase YhhY; Provisional | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK05279 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01346 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >PRK09831 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0456 RimI Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A | Back alignment and domain information |
|---|
| >PRK15130 spermidine N1-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >PRK13688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A | Back alignment and domain information |
|---|
| >KOG3139 consensus N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG3393 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK10562 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10514 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3396 consensus Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >COG3153 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >COG2153 ElaA Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 | Back alignment and domain information |
|---|
| >smart00258 SAND SAND domain | Back alignment and domain information |
|---|
| >COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >TIGR01211 ELP3 histone acetyltransferase, ELP3 family | Back alignment and domain information |
|---|
| >PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A | Back alignment and domain information |
|---|
| >KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain | Back alignment and domain information |
|---|
| >PF01342 SAND: SAND domain; InterPro: IPR000770 The SAND domain (named after Sp100, AIRE-1, NucP41/75, DEAF-1) is a conserved ~80 residue region found in a number of nuclear proteins, many of which function in chromatin-dependent transcriptional control | Back alignment and domain information |
|---|
| >COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] | Back alignment and domain information |
|---|
| >COG2388 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >KOG3397 consensus Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 805 | ||||
| 1xwh_A | 66 | Nmr Structure Of The First Phd Finger Of Autoimmune | 8e-08 | ||
| 2kft_A | 56 | Nmr Solution Structure Of The First Phd Finger Doma | 2e-07 | ||
| 2l5u_A | 61 | Structure Of The First Phd Finger (Phd1) From Chd4 | 4e-06 | ||
| 3ask_A | 226 | Structure Of Uhrf1 In Complex With Histone Tail Len | 8e-06 | ||
| 4gy5_A | 241 | Crystal Structure Of The Tandem Tudor Domain And Pl | 2e-05 | ||
| 2ysm_A | 111 | Solution Structure Of The First And Second Phd Doma | 7e-05 | ||
| 2ysm_A | 111 | Solution Structure Of The First And Second Phd Doma | 7e-04 | ||
| 1mm3_A | 61 | Solution Structure Of The 2nd Phd Domain From Mi2b | 1e-04 | ||
| 2yql_A | 56 | Solution Structure Of The Phd Domain In Phd Finger | 2e-04 | ||
| 3u5m_A | 207 | Crystal Structure Of Trim33 Phd-Bromo In The Free S | 2e-04 | ||
| 1mm2_A | 61 | Solution Structure Of The 2nd Phd Domain From Mi2b | 3e-04 | ||
| 2puy_A | 60 | Crystal Structure Of The Bhc80 Phd Finger Length = | 3e-04 | ||
| 3zvz_B | 57 | Phd Finger Of Human Uhrf1 Length = 57 | 4e-04 | ||
| 3zvy_A | 72 | Phd Finger Of Human Uhrf1 In Complex With Unmodifie | 4e-04 | ||
| 3sou_A | 70 | Structure Of Uhrf1 Phd Finger In Complex With Histo | 6e-04 | ||
| 2lgg_A | 69 | Structure Of Phd Domain Of Uhrf1 In Complex With H3 | 6e-04 | ||
| 1f62_A | 51 | Wstf-Phd Length = 51 | 6e-04 | ||
| 3t6r_A | 72 | Structure Of Uhrf1 In Complex With Unmodified H3 N- | 6e-04 | ||
| 3shb_A | 77 | Crystal Structure Of Phd Domain Of Uhrf1 Length = 7 | 7e-04 |
| >pdb|1XWH|A Chain A, Nmr Structure Of The First Phd Finger Of Autoimmune Regulator Protein (Aire1): Insights Into Apeced Length = 66 | Back alignment and structure |
|
| >pdb|2KFT|A Chain A, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 56 | Back alignment and structure |
| >pdb|2L5U|A Chain A, Structure Of The First Phd Finger (Phd1) From Chd4 (Mi2b) Length = 61 | Back alignment and structure |
| >pdb|3ASK|A Chain A, Structure Of Uhrf1 In Complex With Histone Tail Length = 226 | Back alignment and structure |
| >pdb|4GY5|A Chain A, Crystal Structure Of The Tandem Tudor Domain And Plant Homeodomain Of Uhrf1 With Histone H3k9me3 Length = 241 | Back alignment and structure |
| >pdb|2YSM|A Chain A, Solution Structure Of The First And Second Phd Domain From MyeloidLYMPHOID OR MIXED-Lineage Leukemia Protein 3 Homolog Length = 111 | Back alignment and structure |
| >pdb|2YSM|A Chain A, Solution Structure Of The First And Second Phd Domain From MyeloidLYMPHOID OR MIXED-Lineage Leukemia Protein 3 Homolog Length = 111 | Back alignment and structure |
| >pdb|1MM3|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b With C- Terminal Loop Replaced By Corresponding Loop From Wstf Length = 61 | Back alignment and structure |
| >pdb|2YQL|A Chain A, Solution Structure Of The Phd Domain In Phd Finger Protein 21a Length = 56 | Back alignment and structure |
| >pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 | Back alignment and structure |
| >pdb|1MM2|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b Length = 61 | Back alignment and structure |
| >pdb|2PUY|A Chain A, Crystal Structure Of The Bhc80 Phd Finger Length = 60 | Back alignment and structure |
| >pdb|3ZVZ|B Chain B, Phd Finger Of Human Uhrf1 Length = 57 | Back alignment and structure |
| >pdb|3ZVY|A Chain A, Phd Finger Of Human Uhrf1 In Complex With Unmodified Histone H3 N-Terminal Tail Length = 72 | Back alignment and structure |
| >pdb|3SOU|A Chain A, Structure Of Uhrf1 Phd Finger In Complex With Histone H3 1-9 Peptide Length = 70 | Back alignment and structure |
| >pdb|2LGG|A Chain A, Structure Of Phd Domain Of Uhrf1 In Complex With H3 Peptide Length = 69 | Back alignment and structure |
| >pdb|1F62|A Chain A, Wstf-Phd Length = 51 | Back alignment and structure |
| >pdb|3T6R|A Chain A, Structure Of Uhrf1 In Complex With Unmodified H3 N-Terminal Tail Length = 72 | Back alignment and structure |
| >pdb|3SHB|A Chain A, Crystal Structure Of Phd Domain Of Uhrf1 Length = 77 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 805 | |||
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 1e-18 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 2e-05 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 6e-18 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 8e-05 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 2e-17 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 8e-16 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 1e-04 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 8e-16 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 1e-04 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 2e-15 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 7e-04 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 2e-15 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 2e-04 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 3e-15 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 1e-04 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 4e-14 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 3e-12 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 2e-04 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 3e-12 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 4e-04 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 1e-11 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 5e-06 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 2e-11 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 4e-11 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 3e-09 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 6e-11 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 3e-04 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 6e-11 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 3e-05 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 1e-10 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 2e-10 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-04 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 2e-10 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 5e-05 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 2e-10 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 4e-04 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 5e-09 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 1e-08 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 2e-08 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 5e-04 | |
| 1z4r_A | 168 | General control of amino acid synthesis protein 5- | 4e-08 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 1e-07 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 4e-07 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 9e-07 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 2e-06 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 5e-05 | |
| 1qst_A | 160 | TGCN5 histone acetyl transferase; GCN5-related N-a | 9e-06 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 2e-04 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 4e-04 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 5e-04 |
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 | Back alignment and structure |
|---|
Score = 81.8 bits (201), Expect = 1e-18
Identities = 21/118 (17%), Positives = 40/118 (33%), Gaps = 18/118 (15%)
Query: 444 GCKQGNGIVCDCCNKEISPSQFEAHAGMAARRQPYRHIYTSNGMTLHDIAISLAMGQRRT 503
+ C C ++++ Q ++ R P + + ++ ++
Sbjct: 2 PLGSMGIVSCTACGQQVNHFQKDS-----IYRHPSLQVLICKNCFKYYMSDDISRDSD-- 54
Query: 504 TGGSDDMCHVCGDGENLLLCNGCPLAFHAACLDPLL---------IPESGWRCPNCRQ 552
G D+ C C +G NL+ C+ C AF C+ L + W C C
Sbjct: 55 --GMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRRELSTIMDENNQWYCYICHP 110
|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Length = 168 | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Length = 160 | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Length = 90 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 805 | ||||
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 3e-12 | |
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 2e-05 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 1e-11 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 9e-06 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 1e-10 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 8e-07 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 4e-09 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 9e-05 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 2e-07 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 1e-05 | |
| d1ygha_ | 164 | d.108.1.1 (A:) Catalytic domain of GCN5 histone ac | 4e-07 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 9e-07 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 1e-04 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 2e-06 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 1e-04 | |
| d1wepa_ | 79 | g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus | 3e-05 | |
| d1wesa_ | 71 | g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I | 0.003 |
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: PHD domain domain: Nuclear corepressor KAP-1 (TIF-1beta) species: Human (Homo sapiens) [TaxId: 9606]
Score = 60.0 bits (145), Expect = 3e-12
Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 2/48 (4%)
Query: 506 GSDDMCHVCGDGENLLLCNGCPLAFHAACLDPLL--IPESGWRCPNCR 551
S +C VC +L++CN C FH C P L +P W C C
Sbjct: 5 DSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCH 52
|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 164 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 805 | |||
| d1z4ra1 | 162 | Catalytic domain of GCN5 histone acetyltransferase | 99.15 | |
| d1qsra_ | 162 | Catalytic domain of GCN5 histone acetyltransferase | 99.1 | |
| d1ygha_ | 164 | Catalytic domain of GCN5 histone acetyltransferase | 98.97 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 98.74 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 98.63 | |
| d1q2ya_ | 140 | Probable acetyltransferase YjcF {Bacillus subtilis | 98.41 | |
| d1yvka1 | 152 | Hypothetical protein YvbK (BSu33890) {Bacillus sub | 98.31 | |
| d1y9ka1 | 152 | IAA acetyltransferase {Bacillus cereus [TaxId: 139 | 98.28 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 98.25 | |
| d2jdca1 | 145 | Probable acetyltransferase YitI {Bacillus lichenif | 98.23 | |
| d1y7ra1 | 133 | Hypothetical protein SA2161 {Staphylococcus aureus | 98.22 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 98.2 | |
| d1n71a_ | 180 | Aminoglycoside 6'-N-acetyltransferase {Enterococcu | 98.2 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 98.17 | |
| d2atra1 | 137 | Probable acetyltransferase SP0256 {Streptococcus p | 98.13 | |
| d1yx0a1 | 151 | Hypothetical protein YsnE {Bacillus subtilis [TaxI | 98.11 | |
| d1y9wa1 | 140 | Probable acetyltransferase BC2806 {Bacillus cereus | 98.07 | |
| d1ghea_ | 170 | Tabtoxin resistance protein {Pseudomonas syringae | 98.02 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 97.97 | |
| d1u6ma_ | 189 | Putative acetyltransferase EF0945 {Enterococcus fa | 97.97 | |
| d1bo4a_ | 137 | Aminoglycoside 3-N-acetyltransferase {Serratia mar | 97.96 | |
| d2aj6a1 | 118 | Hypothetical protein MW0638 {Staphylococcus aureus | 97.94 | |
| d2fiwa1 | 156 | Probable N-acetyltransferase RPA1999 {Rhodopseudom | 97.92 | |
| d2g3aa1 | 137 | Probable acetyltransferase Atu2258 {Agrobacterium | 97.9 | |
| d2fe7a1 | 156 | Probable N-acetyltransferase PA0478 {Pseudomonas a | 97.88 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 97.87 | |
| d1vkca_ | 149 | Putative acetyltransferase PF0028 {Pyrococcus furi | 97.87 | |
| d1tiqa_ | 173 | Protease synthase and sporulation negative regulat | 97.85 | |
| d2ozga2 | 283 | Putative acetyltransferase Ava4977 {Anabaena varia | 97.78 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 97.74 | |
| d1s3za_ | 147 | Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal | 97.72 | |
| d2gana1 | 182 | Hypothetical protein PH0736 {Pyrococcus horikoshii | 97.72 | |
| d1i12a_ | 157 | Glucosamine-phosphate N-acetyltransferase GNA1 {Ba | 97.7 | |
| d2hv2a2 | 285 | Hypothetical protein EF1021 {Enterococcus faecalis | 97.69 | |
| d2fiaa1 | 157 | Probable acetyltransferase EF1919 {Enterococcus fa | 97.69 | |
| d2i00a2 | 291 | Putative acetyltransferase EF2353 {Enterococcus fa | 97.67 | |
| d1r57a_ | 102 | Hypothetical protein SA2309 {Staphylococcus aureus | 97.62 | |
| d1oqja_ | 90 | Glucocorticoid modulatory element binding protein- | 97.62 | |
| d1mk4a_ | 157 | Hypothetical protein YqiY {Bacillus subtilis [TaxI | 97.6 | |
| d2fl4a1 | 146 | Probable spermine/spermidine acetyltransferase EF1 | 97.56 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 97.54 | |
| d1yr0a1 | 163 | Phosphinothricin acetyltransferase {Agrobacterium | 97.54 | |
| d1xeba_ | 149 | Hypothetical protein PA0115 {Pseudomonas aeruginos | 97.52 | |
| d1z4ea1 | 150 | Transcriptional regulator BH1968 {Bacillus halodur | 97.51 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 97.49 | |
| d2ae6a1 | 161 | Putative acetyltransferase EF0244 {Enterococcus fa | 97.48 | |
| d1ufha_ | 155 | Putative acetyltransferase YycN {Bacillus subtilis | 97.46 | |
| d2cy2a1 | 174 | Probable acetyltransferase TTHA1209 {Thermus therm | 97.45 | |
| d1ufna_ | 94 | Putative nuclear protein homolog 5830484a20rik {Mo | 97.42 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 97.41 | |
| d1vhsa_ | 165 | Putative phosphinothricin acetyltransferase YwnH { | 97.34 | |
| d1yvoa1 | 169 | Hypothetical protein PA4866 {Pseudomonas aeruginos | 97.24 | |
| d2euia1 | 153 | Probable acetyltransferase PA4026 {Pseudomonas aer | 97.22 | |
| d1wwza1 | 157 | Hypothetical protein PH1933 {Pyrococcus horikoshii | 97.2 | |
| d1qsma_ | 150 | Histone acetyltransferase HPA2 {Baker's yeast (Sac | 97.18 | |
| d1h5pa_ | 95 | Nuclear autoantigen Sp100b {Human (Homo sapiens) [ | 97.16 | |
| d2i6ca1 | 160 | Putative acetyltransferase PA4794 {Pseudomonas aer | 97.16 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 97.15 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 97.08 | |
| d1m4ia_ | 181 | Aminoglycoside 2'-N-acetyltransferase {Mycobacteri | 97.06 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 97.02 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 96.94 | |
| d1cjwa_ | 166 | Serotonin N-acetyltranferase {Sheep (Ovis aries) [ | 96.89 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 96.84 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 96.76 | |
| d2ge3a1 | 164 | Probable acetyltransferase Atu2290 {Agrobacterium | 96.62 | |
| d1sqha_ | 297 | Hypothetical protein cg14615-pa {Fruit fly (Drosop | 96.54 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 96.29 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 96.28 | |
| d2b5ga1 | 167 | Diamine acetyltransferase 1 {Human (Homo sapiens) | 96.18 | |
| d1yrea1 | 183 | Hypothetical protein PA3270 {Pseudomonas aeruginos | 96.02 | |
| d2beia1 | 167 | Diamine acetyltransferase 2 {Human (Homo sapiens) | 95.93 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 95.88 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 95.49 | |
| d1nsla_ | 180 | Probable acetyltransferase YdaF {Bacillus subtilis | 95.07 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 95.02 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 94.98 | |
| d1s7ka1 | 174 | L7/L12-Ribosomal-protein-serine acetyltransferase | 93.72 | |
| d2fcka1 | 178 | Putative ribosomal-protein-serine acetyltransferas | 92.29 | |
| d1ufna_ | 94 | Putative nuclear protein homolog 5830484a20rik {Mo | 92.1 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 91.57 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 90.81 | |
| d1yk3a1 | 198 | Hypothetical protein Rv1347c/MT1389 {Mycobacterium | 83.48 | |
| d1ro5a_ | 197 | Autoinducer synthesis protein LasI {Pseudomonas ae | 82.34 |
| >d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-acetyl transferase, NAT domain: Catalytic domain of GCN5 histone acetyltransferase species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.15 E-value=2.1e-10 Score=84.74 Aligned_cols=100 Identities=16% Similarity=0.162 Sum_probs=83.3
Q ss_pred HHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCEEEEEEEEEEE-CCCEEEEEEEEEEC
Q ss_conf 65445677776634045441123688511000045689964373099999659979998787752-67215554554310
Q 003662 692 EKSLLSSATAIFRECFDPIIAECGRDLIPVMVYGRNISGQEFGGMYSVILTVKSVVVSAGLLRIF-GREVAELPLVATCR 770 (805)
Q Consensus 692 ~~s~La~Al~If~EcF~PIv~~tg~DlI~~mVygr~~~~~dF~GfYt~vL~~~~~vvs~a~lrv~-g~~~AElplvAt~~ 770 (805)
....|..+..||...|.. ..+|.|..++|.. ...++|+..+++||+++.++.+ ....|||.++||.+
T Consensus 20 ~~~~L~~~~~iF~~~lp~----m~~~yi~r~~~d~--------~~~~~v~~~~~~iIG~i~~~~~~~~~~aeI~~laV~~ 87 (162)
T d1z4ra1 20 VLLWLVGLQNVFSHQLPR----MPKEYIARLVFDP--------KHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTS 87 (162)
T ss_dssp HHHHHHHHHHHHHHHCTT----SCHHHHHHHHTCT--------TCEEEEEEETTEEEEEEEEEEETTTTEEEEEEEEECG
T ss_pred HHHHHHHHHHHHHHHCCC----CCHHHHHHHHCCC--------CCEEEEEEECCEEEEEEEEEEECCCCEEEEEEEEECH
T ss_conf 999999989999876789----7399999996598--------8469999999999999999997889989999999980
Q ss_pred CCCCCCHHHHHHHHHHHHHHCCCCCEEEECCCC
Q ss_conf 211557146599999999740896559910699
Q 003662 771 EYQGKGCFQALFSCIERLLCSLNVENLVLPACL 803 (805)
Q Consensus 771 ~~r~qG~~r~L~~~iE~~l~~lgV~~lVLPAa~ 803 (805)
+|||||+|+.||+.+++.++..|+.++++.|-.
T Consensus 88 ~~qgkGiG~~Lm~~l~~~~~~~g~~~i~~~~~~ 120 (162)
T d1z4ra1 88 NEQVKGYGTHLMNHLKEYHIKHNILYFLTYADE 120 (162)
T ss_dssp GGCSSSHHHHHHHHHHHHHHHTTCCEEEEEECG
T ss_pred HHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf 365525899999999999987798699992584
|
| >d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} | Back information, alignment and structure |
|---|
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} | Back information, alignment and structure |
|---|
| >d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1oqja_ d.217.1.1 (A:) Glucocorticoid modulatory element binding protein-1 (Gmeb1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ufna_ d.217.1.1 (A:) Putative nuclear protein homolog 5830484a20rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1h5pa_ d.217.1.1 (A:) Nuclear autoantigen Sp100b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1ufna_ d.217.1.1 (A:) Putative nuclear protein homolog 5830484a20rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|