Citrus Sinensis ID: 003736

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------80

MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSERSLKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTSGSSWGISSIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPTGLPKIHGLPTSSMYTTSSGSNDSYTASPKNPKSRKSSHSGELQSHLFSNADSNGSGRMYMPGLYPTVDH

ccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccEEEcccccccHHHHHHHccccccccccccccccccEEEEcccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccccccccccccEEEEEEcccccccccHHHHHHHHHcccccccEEEEEcccccccccHHHHHHHccccccccccEEEEEccccHHHcccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccHcHHHHHHHcccccccccccEccccEEEEEEEcccHHHHHHHHcccccEEccHHHHHHHHHHHHHHHHccccccccccEEEEEEcccEEEEEEEcccccccccEEcccccccccHHHHHHHHHccccccEEEEEEEEEEcccccccHHHHHcccEEEEEccEEEEEEccHHHHcccccHHHHHHHHHHHHHccccHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHcccccHHHHHHHHHccccEEEEcccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHcHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

madepatnttaaqsqpsavplggsvipLVNKLQDIFAQLgsqstielpqvavvgsqssgkssVLEALvgrdflprgndictrrPLVLQLLQTKTDEeygeflhlpgkrfydfsEIRREIQAQtdkeaggnkgvsdkqirlkifsphvlditlvdlpgitkvpvvtpansdlansdalqiagiadpdgyrtigiitkldimdrgTDARNLLLGKviplrlgyvgvvnrsqedimfNRSIKDALVAEEKFfrsrpvyngladrcgvPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHasygeiteskagQGALLLNILSKYSEAFSSMVegkneemstselsggaRIHYIFQSIFVksleevdpcedltddDIRTAIQnatgpksalfvpdvpfEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFlreglepsetMIGHIIEMEMDyintshpnfigGSKAVEIALQQIksskvplpitrhkdgvepdkapssersLKSRAILARQVNgimadqgvrptvevekvapagntsgsswgissifggsdnrvpagkesvtnkpfsepvqnVEHAFAMIhlrepptilrpseshseqENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTldelpleadsvergynmsadptglpkihglptssmyttssgsndsytaspknpksrksshsgelqshlfsnadsngsgrmympglyptvdh

madepatnttaaqsqpsavpLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFlprgndictrrPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQaqtdkeaggnkgvsdkqirLKIFSPHVLDITLVDLPGITKVPVVTPANSDLANSDALQiagiadpdgyrTIGIITKLDIMDRGTDARNLLLGkviplrlgyvgvvnrsqedimFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASygeiteskagqGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQnatgpksalfvpDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGnflreglepsETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKsskvplpitrhkdgvepdkapsserslksRAILARQVNGIMADQGVRPTVEVEKVapagntsgsswgisSIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQafrtldelpleadsVERGYNMSADPTGLPKIHGLPTSSMYTTSSGSNDSYTASPKNPKSRKSSHSGELQSHLfsnadsngsgrmYMPGLYPTVDH

MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSERSLKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTsgsswgissifggsDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPTGLPKIHGLPTSSMYTTSSGSNDSYTASPKNPKSRKSSHSGELQSHLFSNADSNGSGRMYMPGLYPTVDH

*********************GGSVIPLVNKLQDIFAQLGSQSTIELPQVAVV*********VLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRRE*****************KQIRLKIFSPHVLDITLVDLPGITKVPVVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYS*********************GARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQI*************************************VNGIM**********************************************************HAFAMIHL******************VEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEM******************RVLQQAFRT*******************************************************************************************

************************VIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQ************VSDKQIRLKIFSPHVLDITLVDLPGITKVPVVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVV****************LVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHAS**********QGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGG********************************************************************************************************************************************AVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLF*EMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLE************************************************************************************

****************SAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVV*********VLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQ***********SDKQIRLKIFSPHVLDITLVDLPGITKVPVVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSM*************SGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKD*************LKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTSGSSWGISSIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRP********NVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPTGLPKIHGLPTSSMY****************************QSHLFSNADSNGSGRMYMPGLYPTVDH

*******************PLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQI****************************************************************************************************HAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPT*********************************************************************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		799	2.2.26 [Sep-21-2011]
Q8S944		808	Dynamin-related protein 3	yes	no	0.881	0.871	0.754	0.0
Q8LFT2		780	Dynamin-related protein 3	no	no	0.891	0.912	0.725	0.0
P54861		757	Dynamin-related protein D	yes	no	0.814	0.859	0.391	1e-150
Q9URZ5		678	Vacuolar protein sorting-	yes	no	0.774	0.912	0.385	1e-144
Q7SXN5		691	Dynamin-1-like protein OS	yes	no	0.797	0.921	0.397	1e-143
O00429		736	Dynamin-1-like protein OS	yes	no	0.841	0.913	0.398	1e-143
Q94464		853	Dynamin-A OS=Dictyosteliu	yes	no	0.583	0.546	0.498	1e-142
Q2KIA5		749	Dynamin-1-like protein OS	yes	no	0.841	0.897	0.390	1e-142
O35303		755	Dynamin-1-like protein OS	yes	no	0.842	0.891	0.391	1e-141
Q8K1M6		742	Dynamin-1-like protein OS	yes	no	0.834	0.898	0.392	1e-141

>sp\|Q8S944\|DRP3A_ARATH Dynamin-related protein 3A OS=Arabidopsis thaliana GN=DRP3A PE=1 SV=2	Back alignment and function desciption

 Score = 1147 bits (2967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/740 (75%), Positives = 633/740 (85%), Gaps = 36/740 (4%)

Query: 17  SAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG 76
           +A PLG SVIP+VNKLQDIFAQLGSQSTI LPQV VVGSQSSGKSSVLEALVGRDFLPRG
Sbjct: 29  NAAPLGSSVIPIVNKLQDIFAQLGSQSTIALPQVVVVGSQSSGKSSVLEALVGRDFLPRG 88

Query: 77  NDICTRRPLVLQLLQTKT------DEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGN 130
           NDICTRRPLVLQLLQTK+      D+E+GEF HLP  RFYDFSEIRREI+A+T++  G N
Sbjct: 89  NDICTRRPLVLQLLQTKSRANGGSDDEWGEFRHLPETRFYDFSEIRREIEAETNRLVGEN 148

Query: 131 KGVSDKQIRLKIFSPHVLDITLVDLPGITKVPV--------------------------- 163
           KGV+D QIRLKI SP+VL+ITLVDLPGITKVPV                           
Sbjct: 149 KGVADTQIRLKISSPNVLNITLVDLPGITKVPVGDQPSDIEARIRTMILSYIKQDTCLIL 208

Query: 164 -VTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYV 222
            VTPAN+DLANSDALQIA I DPDG+RTIG+ITKLDIMD+GTDAR LLLG V+PLRLGYV
Sbjct: 209 AVTPANTDLANSDALQIASIVDPDGHRTIGVITKLDIMDKGTDARKLLLGNVVPLRLGYV 268

Query: 223 GVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAI 282
           GVVNR QEDI+ NR++K+AL+AEEKFFRS PVY+GLADR GVPQLAKKLNQILVQHIK +
Sbjct: 269 GVVNRCQEDILLNRTVKEALLAEEKFFRSHPVYHGLADRLGVPQLAKKLNQILVQHIKVL 328

Query: 283 LPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKNEEMST 342
           LP LKSRIS+ALV+ AKEH SYGE+TES+AGQGALLLN LSKY EA+SS++EGK+EEMST
Sbjct: 329 LPDLKSRISNALVATAKEHQSYGELTESRAGQGALLLNFLSKYCEAYSSLLEGKSEEMST 388

Query: 343 SELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLI 402
           SELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGP+SALFVPDVPFEVL+
Sbjct: 389 SELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPRSALFVPDVPFEVLV 448

Query: 403 RRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSE 462
           RRQI+RLLDPSLQCARFI++EL+KISH C++NELQRFPVLRKRMDEVIG+FLREGLEPSE
Sbjct: 449 RRQISRLLDPSLQCARFIFEELIKISHRCMMNELQRFPVLRKRMDEVIGDFLREGLEPSE 508

Query: 463 TMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSE 522
            MIG II+MEMDYINTSHPNFIGG+KAVE A+ Q+KSS++P P+ R KD VEPD+  SS 
Sbjct: 509 AMIGDIIDMEMDYINTSHPNFIGGTKAVEAAMHQVKSSRIPHPVARPKDTVEPDRTSSST 568

Query: 523 RSLKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTSGSSWGISSIFGGSDNRVPAGKE 582
             +KSR+ L RQ NGI+ DQGV  + + EK  PA N S + WGI SIF G D R    K+
Sbjct: 569 SQVKSRSFLGRQANGIVTDQGV-VSADAEKAQPAANASDTRWGIPSIFRGGDTRA-VTKD 626

Query: 583 SVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRK 642
           S+ NKPFSE V+++ H  +MI+L+EPP +LRP+E+HSEQE VEI +TKLLLRSYYDIVRK
Sbjct: 627 SLLNKPFSEAVEDMSHNLSMIYLKEPPAVLRPTETHSEQEAVEIQITKLLLRSYYDIVRK 686

Query: 643 NIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVL 702
           NIEDS+PKA+MHFLVNHTKRELHNVFIKKLYRENLFEEMLQEP+E+A+KRKRT++TL VL
Sbjct: 687 NIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRKRTQETLHVL 746

Query: 703 QQAFRTLDELPLEADSVERG 722
           QQA+RTLDELPLEADSV  G
Sbjct: 747 QQAYRTLDELPLEADSVSAG 766

Involved in the control of mitochondrial division and morphology.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q8LFT2\|DRP3B_ARATH Dynamin-related protein 3B OS=Arabidopsis thaliana GN=DRP3B PE=1 SV=2	Back alignment and function description

>sp\|P54861\|DNM1_YEAST Dynamin-related protein DNM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNM1 PE=1 SV=1	Back alignment and function description

>sp\|Q9URZ5\|VPS1_SCHPO Vacuolar protein sorting-associated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps1 PE=3 SV=2	Back alignment and function description

>sp\|Q7SXN5\|DNM1L_DANRE Dynamin-1-like protein OS=Danio rerio GN=dnm1l PE=2 SV=1	Back alignment and function description

>sp\|O00429\|DNM1L_HUMAN Dynamin-1-like protein OS=Homo sapiens GN=DNM1L PE=1 SV=2	Back alignment and function description

>sp\|Q94464\|DYNA_DICDI Dynamin-A OS=Dictyostelium discoideum GN=dymA PE=1 SV=2	Back alignment and function description

>sp\|Q2KIA5\|DNM1L_BOVIN Dynamin-1-like protein OS=Bos taurus GN=DNM1L PE=2 SV=1	Back alignment and function description

>sp\|O35303\|DNM1L_RAT Dynamin-1-like protein OS=Rattus norvegicus GN=Dnm1l PE=1 SV=1	Back alignment and function description

>sp\|Q8K1M6\|DNM1L_MOUSE Dynamin-1-like protein OS=Mus musculus GN=Dnm1l PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		799
359494701		831	PREDICTED: dynamin-related protein 3A-li	0.996	0.957	0.824	0.0
255584037		837	dynamin, putative [Ricinus communis] gi\|	0.996	0.951	0.832	0.0
224093258		835	predicted protein [Populus trichocarpa]	0.987	0.944	0.811	0.0
296088789		923	unnamed protein product [Vitis vinifera]	0.989	0.856	0.800	0.0
224132938		821	predicted protein [Populus trichocarpa]	0.951	0.925	0.812	0.0
449459548		822	PREDICTED: dynamin-related protein 3A-li	0.989	0.962	0.777	0.0
449511368		822	PREDICTED: LOW QUALITY PROTEIN: dynamin-	0.989	0.962	0.775	0.0
449479057		817	PREDICTED: dynamin-related protein 3A-li	0.981	0.959	0.796	0.0
356554800		823	PREDICTED: dynamin-related protein 3A-li	0.989	0.961	0.773	0.0
356549507		826	PREDICTED: dynamin-related protein 3A-li	0.968	0.937	0.782	0.0

>gi\|359494701\|ref\|XP_002269774.2\| PREDICTED: dynamin-related protein 3A-like [Vitis vinifera]	Back alignment and taxonomy information

 Score = 1372 bits (3551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 686/832 (82%), Positives = 751/832 (90%), Gaps = 36/832 (4%)

Query: 1   MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK 60
           MA+E A ++    S  SA PLG SVIP+VNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK
Sbjct: 1   MAEE-AVSSNPTHSSSSAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK 59

Query: 61  SSVLEALVGRDFLPRGNDICTRRPLVLQLLQTK-----TDEEYGEFLHLPGKRFYDFSEI 115
           SSVLEALVGRDFLPRG+DICTRRPLVLQLLQTK     ++EEYGEFLHLPGK+F+DFSEI
Sbjct: 60  SSVLEALVGRDFLPRGSDICTRRPLVLQLLQTKRRPDGSEEEYGEFLHLPGKKFFDFSEI 119

Query: 116 RREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPV------------ 163
           RREIQA+TD+EAG NKGVSDKQIRLKIFSP+VLDITLVDLPGITKVPV            
Sbjct: 120 RREIQAETDREAGENKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR 179

Query: 164 ----------------VTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDAR 207
                           VTPANSDLANSDALQIAG ADPDGYRTIG+ITKLDIMDRGTDAR
Sbjct: 180 TMIMSYIKLPSCLILAVTPANSDLANSDALQIAGNADPDGYRTIGVITKLDIMDRGTDAR 239

Query: 208 NLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQL 267
           NLLLGKVIPLRLGY+GVVNRSQEDI+ NRS+KDALVAEEKFFRSRPVYNGLADRCG+ QL
Sbjct: 240 NLLLGKVIPLRLGYIGVVNRSQEDIIMNRSVKDALVAEEKFFRSRPVYNGLADRCGITQL 299

Query: 268 AKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSE 327
           AKKLNQILVQHIK +LPGLK R++SALVSVAKEHAS GEI ESKAGQGALLLNILSKY+E
Sbjct: 300 AKKLNQILVQHIKTVLPGLKLRMNSALVSVAKEHASIGEIPESKAGQGALLLNILSKYAE 359

Query: 328 AFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGP 387
           AFSS VEGKNEEMST+ELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGP
Sbjct: 360 AFSSRVEGKNEEMSTAELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGP 419

Query: 388 KSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMD 447
           +SALFVP+VPFEVL+RRQIARLLDPSLQCARFIYDEL+KISH CLV+E+QRFP+LRKRMD
Sbjct: 420 RSALFVPEVPFEVLVRRQIARLLDPSLQCARFIYDELVKISHRCLVSEMQRFPILRKRMD 479

Query: 448 EVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPIT 507
           EV+GNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVE+ALQQIKSS++P+P+ 
Sbjct: 480 EVMGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEMALQQIKSSRLPVPVA 539

Query: 508 RHKDGVEPDKAPSSERSLKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTSGSSWGIS 567
           R KDG+EPDKAP+SERSLK+RAILAR VNGI+ADQGVRP  +VEK   +G+T+GSSWGIS
Sbjct: 540 RQKDGLEPDKAPTSERSLKARAILARPVNGIVADQGVRPVADVEKFTSSGSTTGSSWGIS 599

Query: 568 SIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIA 627
           SIFGGSDNRV A KE  TNK +SEPVQ+VEH+ +MIHL+EPPTIL+PSESHSEQE +EI+
Sbjct: 600 SIFGGSDNRVSA-KEISTNKTYSEPVQSVEHSISMIHLKEPPTILKPSESHSEQEAIEIS 658

Query: 628 VTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEE 687
           VTKLLLRSYYDIVRKNIED++PKA+MHFLVNHTKRELHNVFI+KLYRENLFEEMLQEP+E
Sbjct: 659 VTKLLLRSYYDIVRKNIEDAVPKAIMHFLVNHTKRELHNVFIRKLYRENLFEEMLQEPDE 718

Query: 688 VAMKRKRTRDTLRVLQQAFRTLDELPLEADSVERGYNM-SADPTGLPKIHGLPTSSMYTT 746
           VAMKRKRT +TLRVLQQA RTLDELP EA++VE+GY++ S+DPTGLPKIHGLPTSS+YTT
Sbjct: 719 VAMKRKRTSETLRVLQQALRTLDELPQEAETVEKGYSLGSSDPTGLPKIHGLPTSSLYTT 778

Query: 747 SSGSNDSYTASPKNPKSRKSSHSGELQSHLFSNADSNGSGRMYMPGLYPTVD 798
           S GS  SYTASPKNPKSRKSSHSGELQS    NADSNG GR YMPGLYPT+D
Sbjct: 779 SGGSTQSYTASPKNPKSRKSSHSGELQSPFHGNADSNGGGRSYMPGLYPTLD 830

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255584037\|ref\|XP_002532763.1\| dynamin, putative [Ricinus communis] gi\|223527492\|gb\|EEF29620.1\| dynamin, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224093258\|ref\|XP_002309855.1\| predicted protein [Populus trichocarpa] gi\|222852758\|gb\|EEE90305.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|296088789\|emb\|CBI38239.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224132938\|ref\|XP_002327916.1\| predicted protein [Populus trichocarpa] gi\|222837325\|gb\|EEE75704.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449459548\|ref\|XP_004147508.1\| PREDICTED: dynamin-related protein 3A-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449511368\|ref\|XP_004163937.1\| PREDICTED: LOW QUALITY PROTEIN: dynamin-related protein 3A-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449479057\|ref\|XP_004155493.1\| PREDICTED: dynamin-related protein 3A-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356554800\|ref\|XP_003545730.1\| PREDICTED: dynamin-related protein 3A-like [Glycine max]	Back alignment and taxonomy information

>gi\|356549507\|ref\|XP_003543135.1\| PREDICTED: dynamin-related protein 3A-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		799
TAIR\|locus:2059445		809	DRP3B "dynamin related protein	0.484	0.478	0.643	1.1e-273
DICTYBASE\|DDB_G0277849		853	dymA "dynamin like protein" [D	0.414	0.388	0.478	2.1e-145
SGD\|S000003924		757	DNM1 "Dynamin-related GTPase i	0.410	0.433	0.446	8.1e-138
UNIPROTKB\|G4N7U4		802	MGG_06361 "Dynamin-A" [Magnapo	0.409	0.407	0.472	6.3e-136
CGD\|CAL0000402		866	DNM1 [Candida albicans (taxid:	0.423	0.390	0.424	1.5e-134
ASPGD\|ASPL0000009085		696	vpsA [Emericella nidulans (tax	0.448	0.514	0.437	1e-133
POMBASE\|SPAC767.01c		678	vps1 "dynamin family protein V	0.421	0.497	0.437	1.3e-131
UNIPROTKB\|G4N1E7		698	MGG_09517 "Vacuolar protein so	0.423	0.484	0.432	1.6e-129
UNIPROTKB\|G8JLD5		712	DNM1L "Dynamin-1-like protein"	0.466	0.523	0.408	4.2e-129
ZFIN\|ZDB-GENE-040426-1556		691	dnm1l "dynamin 1-like" [Danio	0.464	0.536	0.401	1.5e-128

TAIR\|locus:2059445 DRP3B "dynamin related protein" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1296 (461.3 bits), Expect = 1.1e-273, Sum P(4) = 1.1e-273
 Identities = 253/393 (64%), Positives = 311/393 (79%)

Query:   359 FVKSLE--EVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQC 416
             FV   +  EVDPCEDLT DDIRTAIQNATGP+SALFVPDVPFEVL+RRQI+RLLDPSLQC
Sbjct:   417 FVSGFQFLEVDPCEDLTADDIRTAIQNATGPRSALFVPDVPFEVLVRRQISRLLDPSLQC 476

Query:   417 ARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYI 476
             ARFI+DEL+KISH C++ ELQRFPVL+KRMDEVIGNFLREGLEPS+ MI  +IEMEMDYI
Sbjct:   477 ARFIFDELVKISHQCMMKELQRFPVLQKRMDEVIGNFLREGLEPSQAMIRDLIEMEMDYI 536

Query:   477 NTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSERSLKSRAILARQVN 536
             NTSHPNFIGG+KAVE A+Q +KSS++P P+ R +D VEP++  SS   +K+R+ L RQ N
Sbjct:   537 NTSHPNFIGGTKAVEQAMQTVKSSRIPHPVARPRDTVEPERTASSGSQIKTRSFLGRQAN 596

Query:   537 GIMADQGVRPTVEVEKVAPAGNTXXXXXXXXXXXXXXDNRVPAGKESVTNKPFSEPVQNV 596
             GI+ DQ V    + E+ APAG+T              D +  A K ++ NKPFSE  Q V
Sbjct:   597 GIITDQAVPTAADAERPAPAGSTSWSGFSSIFRGS--DGQA-AAKNNLLNKPFSETTQEV 653

Query:   597 EHAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFL 656
                 + I+L+EPPTIL+ SE+HSEQE+VEI +TKLLL+SYYDIVRKN+ED +PKA+MHFL
Sbjct:   654 YQNLSTIYLKEPPTILKSSETHSEQESVEIEITKLLLKSYYDIVRKNVEDLVPKAIMHFL 713

Query:   657 VNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLEA 716
             VN+TKRELHNVFI+KLYRENL EE+L+EP+E+A+KRKRT++TLR+LQQA RTLDELPLEA
Sbjct:   714 VNYTKRELHNVFIEKLYRENLIEELLKEPDELAIKRKRTQETLRILQQANRTLDELPLEA 773

Query:   717 DSVERGYNMSADPTGLPKIHGLPTSSMYTTSSG 749
             +SVERGY + ++     ++ G   S   T  +G
Sbjct:   774 ESVERGYKIGSEAKH-EELPGTRRSRTETNGNG 805

GO:0003924 "GTPase activity" evidence=IEA;ISS

GO:0005525 "GTP binding" evidence=IEA;ISS

GO:0005739 "mitochondrion" evidence=ISM;IDA

GO:0005886 "plasma membrane" evidence=IDA

GO:0005777 "peroxisome" evidence=IDA

GO:0016559 "peroxisome fission" evidence=IMP

GO:0000266 "mitochondrial fission" evidence=IGI

GO:0005515 "protein binding" evidence=IPI

GO:0009791 "post-embryonic development" evidence=IGI

GO:0005829 "cytosol" evidence=IDA

GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA

DICTYBASE\|DDB_G0277849 dymA "dynamin like protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

SGD\|S000003924 DNM1 "Dynamin-related GTPase involved in mitochondrial organization" [Saccharomyces cerevisiae (taxid:4932)]	Back alignment and assigned GO terms

UNIPROTKB\|G4N7U4 MGG_06361 "Dynamin-A" [Magnaporthe oryzae 70-15 (taxid:242507)]	Back alignment and assigned GO terms

CGD\|CAL0000402 DNM1 [Candida albicans (taxid:5476)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000009085 vpsA [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

POMBASE\|SPAC767.01c vps1 "dynamin family protein Vps1" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

UNIPROTKB\|G4N1E7 MGG_09517 "Vacuolar protein sorting-associated protein 1" [Magnaporthe oryzae 70-15 (taxid:242507)]	Back alignment and assigned GO terms

UNIPROTKB\|G8JLD5 DNM1L "Dynamin-1-like protein" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-1556 dnm1l "dynamin 1-like" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q8K1M6	DNM1L_MOUSE	3, ., 6, ., 5, ., 5	0.3928	0.8347	0.8989	yes	no
Q8S944	DRP3A_ARATH	No assigned EC number	0.7540	0.8811	0.8712	yes	no
P54861	DNM1_YEAST	3, ., 6, ., 5, ., 5	0.3919	0.8147	0.8599	yes	no
O35303	DNM1L_RAT	3, ., 6, ., 5, ., 5	0.3918	0.8423	0.8913	yes	no
O00429	DNM1L_HUMAN	3, ., 6, ., 5, ., 5	0.3986	0.8410	0.9130	yes	no
Q8LFT2	DRP3B_ARATH	No assigned EC number	0.7256	0.8911	0.9128	no	no
Q2KIA5	DNM1L_BOVIN	3, ., 6, ., 5, ., 5	0.3905	0.8410	0.8971	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00001878001	SubName- Full=Chromosome undetermined scaffold_123, whole genome shotgun sequence; (828 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		799
pfam01031		296	pfam01031, Dynamin_M, Dynamin central region	1e-128
cd08771		278	cd08771, DLP_1, Dynamin_like protein family includ	1e-109
smart00053		240	smart00053, DYNc, Dynamin, GTPase	4e-89
pfam00350		168	pfam00350, Dynamin_N, Dynamin family	1e-52
COG0699		546	COG0699, COG0699, Predicted GTPases (dynamin-relat	1e-35
pfam02212		90	pfam02212, GED, Dynamin GTPase effector domain	2e-32
smart00302		92	smart00302, GED, Dynamin GTPase effector domain	2e-28
cd09912		180	cd09912, DLP_2, Dynamin-like protein including dyn	5e-04
cd00882		161	cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s	0.001

>gnl\|CDD\|216255 pfam01031, Dynamin_M, Dynamin central region	Back alignment and domain information

 Score =  383 bits (987), Expect = e-128
 Identities = 142/292 (48%), Positives = 205/292 (70%), Gaps = 1/292 (0%)

Query: 206 ARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVP 265
           A ++L  KV PL+LGYVGVVNRSQ+DI   +SIK+AL  E  FF + P Y  LA+RCG P
Sbjct: 1   AVDILENKVYPLKLGYVGVVNRSQQDINDKKSIKEALEDERAFFENHPHYRTLAERCGTP 60

Query: 266 QLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGE-ITESKAGQGALLLNILSK 324
            LAKKLNQ LV HI+  LP LKS+I+  L    KE   YG+   E  A +GA LL++++ 
Sbjct: 61  YLAKKLNQELVNHIRKSLPDLKSQINKKLQETEKELERYGDDPPEDPAEKGAFLLDLITA 120

Query: 325 YSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNA 384
           +++ F ++++G+ +++ST+ELSGGARI YIF   F K L+ +DP E L+D++IRTAI+N 
Sbjct: 121 FNQDFKNLIDGEEDDLSTNELSGGARIRYIFHEWFPKLLKSIDPFEKLSDEEIRTAIRNY 180

Query: 385 TGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRK 444
            G +  LFVP+  FE+L+++QI RL +P+L+C   +Y+EL +I       EL RFP L++
Sbjct: 181 RGRRLPLFVPEKAFELLVKKQIKRLEEPALKCVDLVYEELRRIFLKIASKELSRFPNLKE 240

Query: 445 RMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQ 496
            + EV+ + LRE LEP+E M+  +I+ME+ YINT+HP+FIGG +AV+   ++
Sbjct: 241 AIKEVVEDILREQLEPTEKMVRDLIDMELAYINTNHPDFIGGLQAVKKKEEE 292

This region lies between the GTPase domain, see pfam00350, and the pleckstrin homology (PH) domain, see pfam00169. Length = 296

>gnl\|CDD\|206738 cd08771, DLP_1, Dynamin_like protein family includes dynamins and Mx proteins	Back alignment and domain information

>gnl\|CDD\|197491 smart00053, DYNc, Dynamin, GTPase	Back alignment and domain information

>gnl\|CDD\|215874 pfam00350, Dynamin_N, Dynamin family	Back alignment and domain information

>gnl\|CDD\|223771 COG0699, COG0699, Predicted GTPases (dynamin-related) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|202159 pfam02212, GED, Dynamin GTPase effector domain	Back alignment and domain information

>gnl\|CDD\|128597 smart00302, GED, Dynamin GTPase effector domain	Back alignment and domain information

>gnl\|CDD\|206739 cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins	Back alignment and domain information

>gnl\|CDD\|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		799
KOG0446		657	consensus Vacuolar sorting protein VPS1, dynamin,	100.0
PF01031		295	Dynamin_M: Dynamin central region; InterPro: IPR00	100.0
smart00053		240	DYNc Dynamin, GTPase. Large GTPases that mediate v	100.0
KOG0447		980	consensus Dynamin-like GTP binding protein [Genera	99.97
smart00302		92	GED Dynamin GTPase effector domain.	99.94
PF02212		92	GED: Dynamin GTPase effector domain; InterPro: IPR	99.89
PF00350		168	Dynamin_N: Dynamin family; InterPro: IPR001401 Mem	99.81
COG0699		546	Predicted GTPases (dynamin-related) [General funct	99.49
PRK09866		741	hypothetical protein; Provisional	99.39
COG0218		200	Predicted GTPase [General function prediction only	99.38
COG0486		454	ThdF Predicted GTPase [General function prediction	99.34
COG1160		444	Predicted GTPases [General function prediction onl	99.33
COG1159		298	Era GTPase [General function prediction only]	99.29
COG1160		444	Predicted GTPases [General function prediction onl	99.21
PF02421		156	FeoB_N: Ferrous iron transport protein B; InterPro	99.19
TIGR03156		351	GTP_HflX GTP-binding protein HflX. This protein fa	99.15
TIGR00436		270	era GTP-binding protein Era. Era is an essential G	99.15
COG2262		411	HflX GTPases [General function prediction only]	99.12
PRK00089		292	era GTPase Era; Reviewed	99.11
PF05049		376	IIGP: Interferon-inducible GTPase (IIGP); InterPro	99.1
PRK11058		426	GTPase HflX; Provisional	99.06
PRK00093		435	GTP-binding protein Der; Reviewed	99.05
PRK00454		196	engB GTP-binding protein YsxC; Reviewed	99.03
cd01895		174	EngA2 EngA2 subfamily. This CD represents the seco	99.03
PRK03003		472	GTP-binding protein Der; Reviewed	99.01
COG1084		346	Predicted GTPase [General function prediction only	99.01
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	99.01
PF01926		116	MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I	98.99
cd04104		197	p47_IIGP_like p47 (47-kDa) family. The p47 GTPase	98.98
cd01897		168	NOG NOG1 is a nucleolar GTP-binding protein presen	98.98
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	98.98
PRK12298		390	obgE GTPase CgtA; Reviewed	98.98
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	98.97
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	98.97
COG3596		296	Predicted GTPase [General function prediction only	98.93
PRK12299		335	obgE GTPase CgtA; Reviewed	98.92
cd01876		170	YihA_EngB The YihA (EngB) subfamily. This subfamil	98.91
cd01852		196	AIG1 AIG1 (avrRpt2-induced gene 1). This represent	98.91
PRK05291		449	trmE tRNA modification GTPase TrmE; Reviewed	98.9
TIGR00450		442	mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE	98.89
TIGR03598		179	GTPase_YsxC ribosome biogenesis GTP-binding protei	98.89
cd01898		170	Obg Obg subfamily. The Obg nucleotide binding prot	98.88
cd01887		168	IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo	98.87
PRK15494		339	era GTPase Era; Provisional	98.84
PRK12296		500	obgE GTPase CgtA; Reviewed	98.83
cd00880		163	Era_like Era (E. coli Ras-like protein)-like. This	98.83
KOG1423		379	consensus Ras-like GTPase ERA [Cell cycle control,	98.81
PRK12297		424	obgE GTPase CgtA; Reviewed	98.81
TIGR02729		329	Obg_CgtA Obg family GTPase CgtA. This model descri	98.81
COG0370		653	FeoB Fe2+ transport system protein B [Inorganic io	98.78
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	98.78
cd04164		157	trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein	98.77
KOG0448		749	consensus Mitofusin 1 GTPase, involved in mitochon	98.77
PRK03003		472	GTP-binding protein Der; Reviewed	98.77
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	98.76
KOG1191		531	consensus Mitochondrial GTPase [Translation, ribos	98.76
cd00881		189	GTP_translation_factor GTP translation factor fami	98.74
PRK09554		772	feoB ferrous iron transport protein B; Reviewed	98.74
PF04548		212	AIG1: AIG1 family; InterPro: IPR006703 This entry	98.73
cd01894		157	EngA1 EngA1 subfamily. This CD represents the firs	98.73
PRK04213		201	GTP-binding protein; Provisional	98.73
cd01853		249	Toc34_like Toc34-like (Translocon at the Outer-env	98.7
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	98.69
cd04171		164	SelB SelB subfamily. SelB is an elongation factor	98.68
PRK00093		435	GTP-binding protein Der; Reviewed	98.67
cd01879		158	FeoB Ferrous iron transport protein B (FeoB) subfa	98.63
cd01881		176	Obg_like The Obg-like subfamily consists of five w	98.61
cd04142		198	RRP22 RRP22 subfamily. RRP22 (Ras-related protein	98.6
PF00009		188	GTP_EFTU: Elongation factor Tu GTP binding domain;	98.6
cd04165		224	GTPBP1_like GTPBP1-like. Mammalian GTP binding pro	98.6
TIGR00991		313	3a0901s02IAP34 GTP-binding protein (Chloroplast En	98.59
cd01890		179	LepA LepA subfamily. LepA belongs to the GTPase fa	98.59
cd01861		161	Rab6 Rab6 subfamily. Rab6 is involved in microtubu	98.56
cd01868		165	Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a	98.55
PRK15467		158	ethanolamine utilization protein EutP; Provisional	98.52
cd01850		276	CDC_Septin CDC/Septin. Septins are a conserved fam	98.5
cd04147		198	Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v	98.5
cd01864		165	Rab19 Rab19 subfamily. Rab19 proteins are associat	98.5
cd00154		159	Rab Rab family. Rab GTPases form the largest famil	98.5
cd04136		163	Rap_like Rap-like subfamily. The Rap subfamily con	98.5
cd01893		166	Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr	98.49
cd04159		159	Arl10_like Arl10-like subfamily. Arl9/Arl10 was id	98.48
cd01862		172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	98.47
cd01889		192	SelB_euk SelB subfamily. SelB is an elongation fac	98.47
cd01866		168	Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg	98.46
smart00173		164	RAS Ras subfamily of RAS small GTPases. Similar in	98.46
TIGR00231		161	small_GTP small GTP-binding protein domain. This m	98.44
cd04112		191	Rab26 Rab26 subfamily. First identified in rat pan	98.44
cd01891		194	TypA_BipA TypA (tyrosine phosphorylated protein A)	98.44
cd01865		165	Rab3 Rab3 subfamily. The Rab3 subfamily contains R	98.43
cd01896		233	DRG The developmentally regulated GTP-binding prot	98.43
cd01869		166	Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev	98.41
smart00175		164	RAB Rab subfamily of small GTPases. Rab GTPases ar	98.41
cd04175		164	Rap1 Rap1 subgroup. The Rap1 subgroup is part of t	98.41
cd01867		167	Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp	98.4
cd04139		164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	98.39
cd01863		161	Rab18 Rab18 subfamily. Mammalian Rab18 is implicat	98.39
cd04119		168	RJL RJL (RabJ-Like) subfamily. RJLs are found in m	98.39
TIGR02528		142	EutP ethanolamine utilization protein, EutP. This	98.38
cd04113		161	Rab4 Rab4 subfamily. Rab4 has been implicated in n	98.38
cd04118		193	Rab24 Rab24 subfamily. Rab24 is distinct from othe	98.37
cd04114		169	Rab30 Rab30 subfamily. Rab30 appears to be associa	98.37
cd04177		168	RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the	98.36
cd04145		164	M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf	98.36
cd04152		183	Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i	98.36
cd01886		270	EF-G Elongation factor G (EF-G) subfamily. Translo	98.35
cd00878		158	Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik	98.35
TIGR00491		590	aIF-2 translation initiation factor aIF-2/yIF-2. T	98.35
cd04144		190	Ras2 Ras2 subfamily. The Ras2 subfamily, found exc	98.34
cd04124		161	RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily	98.33
cd04138		162	H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras,	98.33
cd01860		163	Rab5_related Rab5-related subfamily. This subfamil	98.33
cd04157		162	Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub	98.32
cd04127		180	Rab27A Rab27a subfamily. The Rab27a subfamily cons	98.32
cd04106		162	Rab23_lke Rab23-like subfamily. Rab23 is a member	98.32
cd04166		208	CysN_ATPS CysN_ATPS subfamily. CysN, together with	98.32
TIGR00993		763	3a0901s04IAP86 chloroplast protein import componen	98.31
cd04170		268	EF-G_bact Elongation factor G (EF-G) subfamily. Tr	98.31
cd04156		160	ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su	98.3
cd04168		237	TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T	98.3
cd04140		165	ARHI_like ARHI subfamily. ARHI (A Ras homolog memb	98.3
cd00157		171	Rho Rho (Ras homology) family. Members of the Rho	98.3
PTZ00369		189	Ras-like protein; Provisional	98.3
cd01858		157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	98.29
cd04176		163	Rap2 Rap2 subgroup. The Rap2 subgroup is part of t	98.28
TIGR00475		581	selB selenocysteine-specific elongation factor Sel	98.28
cd04123		162	Rab21 Rab21 subfamily. The localization and functi	98.28
cd04146		165	RERG_RasL11_like RERG/RasL11-like subfamily. RERG	98.27
cd04141		172	Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p	98.27
cd01884		195	EF_Tu EF-Tu subfamily. This subfamily includes ort	98.27
cd00882		157	Ras_like_GTPase Ras-like GTPase superfamily. The R	98.27
PRK10512		614	selenocysteinyl-tRNA-specific translation factor;	98.26
cd04154		173	Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are	98.26
smart00174		174	RHO Rho (Ras homology) subfamily of Ras-like small	98.26
cd04101		164	RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove	98.26
cd04110		199	Rab35 Rab35 subfamily. Rab35 is one of several Rab	98.25
cd04151		158	Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t	98.25
cd00879		190	Sar1 Sar1 subfamily. Sar1 is an essential componen	98.25
cd04169		267	RF3 RF3 subfamily. Peptide chain release factor 3	98.25
cd01888		203	eIF2_gamma eIF2-gamma (gamma subunit of initiation	98.24
smart00178		184	SAR Sar1p-like members of the Ras-family of small	98.24
cd04107		201	Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38	98.23
cd01892		169	Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr	98.22
cd04135		174	Tc10 TC10 subfamily. TC10 is a Rho family protein	98.22
cd04111		211	Rab39 Rab39 subfamily. Found in eukaryotes, Rab39	98.22
cd04178		172	Nucleostemin_like Nucleostemin-like. Nucleostemin	98.21
cd04148		221	RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki	98.21
COG1163		365	DRG Predicted GTPase [General function prediction	98.21
cd04125		188	RabA_like RabA-like subfamily. RabA was first iden	98.2
cd04137		180	RheB Rheb (Ras Homolog Enriched in Brain) subfamil	98.2
COG4917		148	EutP Ethanolamine utilization protein [Amino acid	98.2
cd00876		160	Ras Ras family. The Ras family of the Ras superfam	98.2
cd04158		169	ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor	98.2
cd04122		166	Rab14 Rab14 subfamily. Rab14 GTPases are localized	98.2
cd04108		170	Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr	98.2
TIGR00487		587	IF-2 translation initiation factor IF-2. This mode	98.2
cd04116		170	Rab9 Rab9 subfamily. Rab9 is found in late endosom	98.2
cd04160		167	Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote	98.19
cd01870		175	RhoA_like RhoA-like subfamily. The RhoA subfamily	98.18
PRK05306		787	infB translation initiation factor IF-2; Validated	98.17
cd04149		168	Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor	98.17
TIGR00437		591	feoB ferrous iron transporter FeoB. FeoB (773 amin	98.17
PRK04004		586	translation initiation factor IF-2; Validated	98.17
cd01849		155	YlqF_related_GTPase YlqF-related GTPases. These pr	98.16
PLN03110		216	Rab GTPase; Provisional	98.16
cd00877		166	Ran Ran (Ras-related nuclear proteins) /TC4 subfam	98.16
CHL00189		742	infB translation initiation factor 2; Provisional	98.14
cd04120		202	Rab12 Rab12 subfamily. Rab12 was first identified	98.14
cd04109		215	Rab28 Rab28 subfamily. First identified in maize,	98.13
cd04132		187	Rho4_like Rho4-like subfamily. Rho4 is a GTPase th	98.13
KOG2486		320	consensus Predicted GTPase [General function predi	98.12
cd04162		164	Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9	98.12
cd01855		190	YqeH YqeH. YqeH is an essential GTP-binding protei	98.09
cd04143		247	Rhes_like Rhes_like subfamily. This subfamily incl	98.09
COG0536		369	Obg Predicted GTPase [General function prediction	98.08
PLN03108		210	Rab family protein; Provisional	98.08
CHL00071		409	tufA elongation factor Tu	98.08
PLN03118		211	Rab family protein; Provisional	98.06
TIGR01393		595	lepA GTP-binding protein LepA. LepA (GUF1 in Sacca	98.05
cd04153		174	Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a	98.05
cd01857		141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	98.04
cd04117		161	Rab15 Rab15 subfamily. Rab15 colocalizes with the	98.04
cd04130		173	Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive	98.04
PLN03127		447	Elongation factor Tu; Provisional	98.04
cd04115		170	Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u	98.04
cd04167		213	Snu114p Snu114p subfamily. Snu114p is one of sever	98.03
cd04134		189	Rho3 Rho3 subfamily. Rho3 is a member of the Rho f	98.03
PTZ00133		182	ADP-ribosylation factor; Provisional	98.03
TIGR00484		689	EF-G translation elongation factor EF-G. After pep	98.02
KOG1489		366	consensus Predicted GTP-binding protein (ODN super	98.0
cd04161		167	Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (	97.99
PF00735		281	Septin: Septin; InterPro: IPR000038 Septins consti	97.99
cd01885		222	EF2 EF2 (for archaea and eukarya). Translocation r	97.99
PRK12317		425	elongation factor 1-alpha; Reviewed	97.98
cd04126		220	Rab20 Rab20 subfamily. Rab20 is one of several Rab	97.97
PRK00007		693	elongation factor G; Reviewed	97.97
KOG1954		532	consensus Endocytosis/signaling protein EHD1 [Sign	97.95
smart00177		175	ARF ARF-like small GTPases; ARF, ADP-ribosylation	97.95
PRK05433		600	GTP-binding protein LepA; Provisional	97.91
cd04155		173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	97.91
TIGR02836		492	spore_IV_A stage IV sporulation protein A. A compa	97.9
PLN03071		219	GTP-binding nuclear protein Ran; Provisional	97.88
PLN00223		181	ADP-ribosylation factor; Provisional	97.88
PRK12739		691	elongation factor G; Reviewed	97.87
cd04150		159	Arf1_5_like Arf1-Arf5-like subfamily. This subfami	97.86
TIGR03596		276	GTPase_YlqF ribosome biogenesis GTP-binding protei	97.84
cd01899		318	Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg	97.82
TIGR02034		406	CysN sulfate adenylyltransferase, large subunit. H	97.81
cd01874		175	Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas	97.81
cd01882		225	BMS1 Bms1. Bms1 is an essential, evolutionarily co	97.81
cd01900		274	YchF YchF subfamily. YchF is a member of the Obg f	97.8
PRK00049		396	elongation factor Tu; Reviewed	97.8
PRK09563		287	rbgA GTPase YlqF; Reviewed	97.8
KOG0410		410	consensus Predicted GTP binding protein [General f	97.8
PLN03126		478	Elongation factor Tu; Provisional	97.79
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	97.78
TIGR00485		394	EF-Tu translation elongation factor TU. This align	97.78
cd01856		171	YlqF YlqF. Proteins of the YlqF family contain all	97.78
PRK09435		332	membrane ATPase/protein kinase; Provisional	97.77
PRK12736		394	elongation factor Tu; Reviewed	97.77
cd04128		182	Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi	97.77
PTZ00258		390	GTP-binding protein; Provisional	97.76
PRK12735		396	elongation factor Tu; Reviewed	97.75
cd01883		219	EF1_alpha Eukaryotic elongation factor 1 (EF1) alp	97.75
cd04105		203	SR_beta Signal recognition particle receptor, beta	97.75
cd04129		187	Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that	97.74
PRK09601		364	GTP-binding protein YchF; Reviewed	97.74
TIGR03680		406	eif2g_arch translation initiation factor 2 subunit	97.73
KOG1490		620	consensus GTP-binding protein CRFG/NOG1 (ODN super	97.72
PRK05124		474	cysN sulfate adenylyltransferase subunit 1; Provis	97.72
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	97.7
cd04121		189	Rab40 Rab40 subfamily. This subfamily contains Rab	97.7
PRK00741		526	prfC peptide chain release factor 3; Provisional	97.69
cd01871		174	Rac1_like Rac1-like subfamily. The Rac1-like subfa	97.68
TIGR01394		594	TypA_BipA GTP-binding protein TypA/BipA. This bact	97.67
cd01851		224	GBP Guanylate-binding protein (GBP), N-terminal do	97.65
TIGR00490		720	aEF-2 translation elongation factor aEF-2. This mo	97.64
PRK04000		411	translation initiation factor IF-2 subunit gamma;	97.61
COG1100		219	GTPase SAR1 and related small G proteins [General	97.59
COG1161		322	Predicted GTPases [General function prediction onl	97.59
PRK10218		607	GTP-binding protein; Provisional	97.55
cd04174		232	Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb	97.55
PRK13796		365	GTPase YqeH; Provisional	97.55
PTZ00416		836	elongation factor 2; Provisional	97.54
PLN00116		843	translation elongation factor EF-2 subunit; Provis	97.53
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	97.53
PRK07560		731	elongation factor EF-2; Reviewed	97.51
PRK12288		347	GTPase RsgA; Reviewed	97.49
PRK12289		352	GTPase RsgA; Reviewed	97.49
cd04102		202	RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove	97.49
PRK13351		687	elongation factor G; Reviewed	97.48
TIGR03597		360	GTPase_YqeH ribosome biogenesis GTPase YqeH. This	97.45
PF00071		162	Ras: Ras family; InterPro: IPR001806 Small GTPases	97.44
PTZ00327		460	eukaryotic translation initiation factor 2 gamma s	97.44
PF03193		161	DUF258: Protein of unknown function, DUF258; Inter	97.44
cd04133		176	Rop_like Rop subfamily. The Rop (Rho-related prote	97.43
cd04103		158	Centaurin_gamma Centaurin gamma. The centaurins (a	97.43
TIGR00503		527	prfC peptide chain release factor 3. This translat	97.42
cd01859		156	MJ1464 MJ1464. This family represents archaeal GTP	97.41
cd04173		222	Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb	97.4
TIGR00483		426	EF-1_alpha translation elongation factor EF-1 alph	97.36
cd01875		191	RhoG RhoG subfamily. RhoG is a GTPase with high se	97.35
cd04131		178	Rnd Rnd subfamily. The Rnd subfamily contains Rnd1	97.34
KOG2655		366	consensus Septin family protein (P-loop GTPase) [C	97.34
PTZ00132		215	GTP-binding nuclear protein Ran; Provisional	97.31
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	97.31
TIGR00157		245	ribosome small subunit-dependent GTPase A. The Aqu	97.31
PRK09602		396	translation-associated GTPase; Reviewed	97.3
KOG0094		221	consensus GTPase Rab6/YPT6/Ryh1, small G protein s	97.29
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	97.26
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	97.25
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	97.25
COG5019		373	CDC3 Septin family protein [Cell division and chro	97.24
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	97.24
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	97.21
smart00176		200	RAN Ran (Ras-related nuclear proteins) /TC4 subfam	97.21
KOG1486		364	consensus GTP-binding protein DRG2 (ODN superfamil	97.13
PRK00098		298	GTPase RsgA; Reviewed	97.13
KOG1547		336	consensus Septin CDC10 and related P-loop GTPases	97.11
cd04172		182	Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE	97.09
KOG1532		366	consensus GTPase XAB1, interacts with DNA repair p	97.08
COG2229		187	Predicted GTPase [General function prediction only	97.07
PF09439		181	SRPRB: Signal recognition particle receptor beta s	97.07
PTZ00141		446	elongation factor 1- alpha; Provisional	97.06
cd01854		287	YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil	97.04
PRK10416		318	signal recognition particle-docking protein FtsY;	96.93
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	96.91
PF00025		175	Arf: ADP-ribosylation factor family The prints ent	96.91
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	96.85
PRK12740		668	elongation factor G; Reviewed	96.84
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	96.79
cd03114		148	ArgK-like The function of this protein family is u	96.75
cd01873		195	RhoBTB RhoBTB subfamily. Members of the RhoBTB sub	96.73
PLN00023		334	GTP-binding protein; Provisional	96.7
COG5256		428	TEF1 Translation elongation factor EF-1alpha (GTPa	96.7
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	96.7
PLN00043		447	elongation factor 1-alpha; Provisional	96.69
TIGR00073		207	hypB hydrogenase accessory protein HypB. HypB is i	96.69
PRK10867		433	signal recognition particle protein; Provisional	96.68
PRK13768		253	GTPase; Provisional	96.68
COG0532		509	InfB Translation initiation factor 2 (IF-2; GTPase	96.68
COG1162		301	Predicted GTPases [General function prediction onl	96.64
PRK14974		336	cell division protein FtsY; Provisional	96.63
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	96.63
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	96.57
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	96.52
cd03112		158	CobW_like The function of this protein family is u	96.45
COG0480		697	FusA Translation elongation factors (GTPases) [Tra	96.43
KOG0093		193	consensus GTPase Rab3, small G protein superfamily	96.36
PRK00771		437	signal recognition particle protein Srp54; Provisi	96.34
cd03115		173	SRP The signal recognition particle (SRP) mediates	96.34
COG3276		447	SelB Selenocysteine-specific translation elongatio	96.29
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	96.27
TIGR00092		368	GTP-binding protein YchF. This predicted GTP-bindi	96.25
TIGR00064		272	ftsY signal recognition particle-docking protein F	96.15
PF03308		266	ArgK: ArgK protein; InterPro: IPR005129 Bacterial	96.06
KOG0092		200	consensus GTPase Rab5/YPT51 and related small G pr	95.98
KOG1491		391	consensus Predicted GTP-binding protein (ODN super	95.98
TIGR00959		428	ffh signal recognition particle protein. This mode	95.95
COG0012		372	Predicted GTPase, probable translation factor [Tra	95.95
KOG2484		435	consensus GTPase [General function prediction only	95.93
KOG1424		562	consensus Predicted GTP-binding protein MMR1 [Gene	95.84
KOG1145		683	consensus Mitochondrial translation initiation fac	95.83
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	95.82
KOG2485		335	consensus Conserved ATP/GTP binding protein [Gener	95.66
KOG2203		772	consensus GTP-binding protein [General function pr	95.63
KOG0462		650	consensus Elongation factor-type GTP-binding prote	95.58
PF04670		232	Gtr1_RagA: Gtr1/RagA G protein conserved region; I	95.58
KOG0090		238	consensus Signal recognition particle receptor, be	95.51
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	95.42
KOG0395		196	consensus Ras-related GTPase [General function pre	95.36
COG0481		603	LepA Membrane GTPase LepA [Cell envelope biogenesi	95.23
TIGR03348		1169	VI_IcmF type VI secretion protein IcmF. Members of	95.19
KOG1144		1064	consensus Translation initiation factor 5B (eIF-5B	95.19
KOG0078		207	consensus GTP-binding protein SEC4, small G protei	95.16
KOG1143		591	consensus Predicted translation elongation factor	95.13
KOG0461		522	consensus Selenocysteine-specific elongation facto	95.1
PRK14845		1049	translation initiation factor IF-2; Provisional	95.06
PRK01889		356	GTPase RsgA; Reviewed	94.77
KOG1707		625	consensus Predicted Ras related/Rac-GTP binding pr	94.5
KOG0458		603	consensus Elongation factor 1 alpha [Translation,	94.46
KOG0468		971	consensus U5 snRNP-specific protein [Translation,	94.3
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	94.3
COG3172		187	NadR Predicted ATPase/kinase involved in NAD metab	94.19
KOG2423		572	consensus Nucleolar GTPase [General function predi	94.17
COG1101		263	PhnK ABC-type uncharacterized transport system, AT	94.1
COG1217		603	TypA Predicted membrane GTPase involved in stress	93.68
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	93.62
PF13555		62	AAA_29: P-loop containing region of AAA domain	93.41
COG5192		1077	BMS1 GTP-binding protein required for 40S ribosome	93.38
COG3840		231	ThiQ ABC-type thiamine transport system, ATPase co	93.34
PF00005		137	ABC_tran: ABC transporter This structure is on hol	93.28
KOG1487		358	consensus GTP-binding protein DRG1 (ODN superfamil	93.14
KOG0095		213	consensus GTPase Rab30, small G protein superfamil	93.03
COG4107		258	PhnK ABC-type phosphonate transport system, ATPase	93.0
PF13521		163	AAA_28: AAA domain; PDB: 1LW7_A.	92.88
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	92.87
cd00071		137	GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.	92.84
PF03205		140	MobB: Molybdopterin guanine dinucleotide synthesis	92.69
PF05879		742	RHD3: Root hair defective 3 GTP-binding protein (R	92.6
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	92.58
KOG0073		185	consensus GTP-binding ADP-ribosylation factor-like	92.54
KOG4252		246	consensus GTP-binding protein [Signal transduction	92.29
PRK13695		174	putative NTPase; Provisional	92.25
TIGR03263		180	guanyl_kin guanylate kinase. Members of this famil	92.24
COG0541		451	Ffh Signal recognition particle GTPase [Intracellu	92.2
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	92.18
cd03261		235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	92.1
cd03255		218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	92.06
cd03264		211	ABC_drug_resistance_like ABC-type multidrug transp	91.97
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	91.89
COG4108		528	PrfC Peptide chain release factor RF-3 [Translatio	91.89
cd03225		211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	91.88
KOG0098		216	consensus GTPase Rab2, small G protein superfamily	91.72
PRK00300		205	gmk guanylate kinase; Provisional	91.72
KOG0084		205	consensus GTPase Rab1/YPT1, small G protein superf	91.71
TIGR01166		190	cbiO cobalt transport protein ATP-binding subunit.	91.69
cd03265		220	ABC_DrrA DrrA is the ATP-binding protein component	91.66
PRK11629		233	lolD lipoprotein transporter ATP-binding subunit;	91.57
PRK13541		195	cytochrome c biogenesis protein CcmA; Provisional	91.53
COG5257		415	GCD11 Translation initiation factor 2, gamma subun	91.51
cd03224		222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	91.46
cd03258		233	ABC_MetN_methionine_transporter MetN (also known a	91.4
TIGR02673		214	FtsE cell division ATP-binding protein FtsE. This	91.4
cd03215		182	ABC_Carb_Monos_II This family represents domain II	91.37
KOG0075		186	consensus GTP-binding ADP-ribosylation factor-like	91.34
cd03263		220	ABC_subfamily_A The ABCA subfamily mediates the tr	91.28
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	91.26
cd03218		232	ABC_YhbG The ABC transporters belonging to the Yhb	91.26
cd03369		207	ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty	91.24
COG0050		394	TufB GTPases - translation elongation factors [Tra	91.24
cd03217		200	ABC_FeS_Assembly ABC-type transport system involve	91.22
cd03292		214	ABC_FtsE_transporter FtsE is a hydrophilic nucleot	91.21
PRK13540		200	cytochrome c biogenesis protein CcmA; Provisional	91.2
KOG3859		406	consensus Septins (P-loop GTPases) [Cell cycle con	91.19
TIGR01978		243	sufC FeS assembly ATPase SufC. SufC is part of the	91.15
cd03226		205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	91.14
PRK13851		344	type IV secretion system protein VirB11; Provision	91.14
cd03269		210	ABC_putative_ATPase This subfamily is involved in	91.1
cd03256		241	ABC_PhnC_transporter ABC-type phosphate/phosphonat	91.1
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	91.08
cd03266		218	ABC_NatA_sodium_exporter NatA is the ATPase compon	91.05
KOG0463		641	consensus GTP-binding protein GP-1 [General functi	91.01
TIGR03608		206	L_ocin_972_ABC putative bacteriocin export ABC tra	90.97
TIGR00960		216	3a0501s02 Type II (General) Secretory Pathway (IIS	90.97
cd03219		236	ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans	90.95
PRK13651		305	cobalt transporter ATP-binding subunit; Provisiona	90.95
TIGR02315		243	ABC_phnC phosphonate ABC transporter, ATP-binding	90.94
cd03216		163	ABC_Carb_Monos_I This family represents the domain	90.9
PRK14250		241	phosphate ABC transporter ATP-binding protein; Pro	90.9
COG1341		398	Predicted GTPase or GTP-binding protein [General f	90.88
cd03232		192	ABC_PDR_domain2 The pleiotropic drug resistance-li	90.85
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	90.85
COG2895		431	CysN GTPases - Sulfate adenylate transferase subun	90.84
cd03259		213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	90.84
cd03293		220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	90.82
PRK11124		242	artP arginine transporter ATP-binding subunit; Pro	90.8
COG4962		355	CpaF Flp pilus assembly protein, ATPase CpaF [Intr	90.79
PRK13543		214	cytochrome c biogenesis protein CcmA; Provisional	90.78
CHL00131		252	ycf16 sulfate ABC transporter protein; Validated	90.77
cd03254		229	ABCC_Glucan_exporter_like Glucan exporter ATP-bind	90.74
cd03249		238	ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6)	90.7
cd03301		213	ABC_MalK_N The N-terminal ATPase domain of the mal	90.69
PRK15112		267	antimicrobial peptide ABC system ATP-binding prote	90.69
cd03260		227	ABC_PstB_phosphate_transporter Phosphate uptake is	90.68
PRK15177		213	Vi polysaccharide export ATP-binding protein VexC;	90.68
cd03245		220	ABCC_bacteriocin_exporters ABC-type bacteriocin ex	90.66
cd03262		213	ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-	90.66
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	90.62
cd03253		236	ABCC_ATM1_transporter ATM1 is an ABC transporter t	90.55
cd03229		178	ABC_Class3 This class is comprised of all BPD (Bin	90.55
KOG0087		222	consensus GTPase Rab11/YPT3, small G protein super	90.53
TIGR02324		224	CP_lyasePhnL phosphonate C-P lyase system protein	90.52
cd03236		255	ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o	90.5
cd03231		201	ABC_CcmA_heme_exporter CcmA, the ATP-binding compo	90.48
PRK13641		287	cbiO cobalt transporter ATP-binding subunit; Provi	90.43
COG0410		237	LivF ABC-type branched-chain amino acid transport	90.43
PRK13539		207	cytochrome c biogenesis protein CcmA; Provisional	90.39
cd03268		208	ABC_BcrA_bacitracin_resist The BcrA subfamily repr	90.38
cd03297		214	ABC_ModC_molybdenum_transporter ModC is an ABC-typ	90.33
KOG3883		198	consensus Ras family small GTPase [Signal transduc	90.32
PRK13645		289	cbiO cobalt transporter ATP-binding subunit; Provi	90.32
TIGR03740		223	galliderm_ABC gallidermin-class lantibiotic protec	90.28
cd03235		213	ABC_Metallic_Cations ABC component of the metal-ty	90.27
PRK10895		241	lipopolysaccharide ABC transporter ATP-binding pro	90.26
cd03257		228	ABC_NikE_OppD_transporters The ABC transporter sub	90.24
TIGR02211		221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	90.22
TIGR03864		236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	90.2
PRK11248		255	tauB taurine transporter ATP-binding subunit; Prov	90.2
PRK10584		228	putative ABC transporter ATP-binding protein YbbA;	90.18
PRK13635		279	cbiO cobalt transporter ATP-binding subunit; Provi	90.18
cd03246		173	ABCC_Protease_Secretion This family represents the	90.17
PRK10908		222	cell division protein FtsE; Provisional	90.17
PRK13643		288	cbiO cobalt transporter ATP-binding subunit; Provi	90.15
cd03298		211	ABC_ThiQ_thiamine_transporter ABC-type thiamine tr	90.14
TIGR02323		253	CP_lyasePhnK phosphonate C-P lyase system protein	90.12
cd03291		282	ABCC_CFTR1 The CFTR subfamily domain 1. The cystic	90.1
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	90.04
COG1120		258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	90.0
PRK13648		269	cbiO cobalt transporter ATP-binding subunit; Provi	90.0
COG4559		259	ABC-type hemin transport system, ATPase component	90.0
cd03278		197	ABC_SMC_barmotin Barmotin is a tight junction-asso	89.98
PRK13638		271	cbiO cobalt transporter ATP-binding subunit; Provi	89.94
PRK09580		248	sufC cysteine desulfurase ATPase component; Review	89.93
cd03250		204	ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.	89.93
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	89.93
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	89.92
PRK13652		277	cbiO cobalt transporter ATP-binding subunit; Provi	89.83
TIGR03410		230	urea_trans_UrtE urea ABC transporter, ATP-binding	89.81
cd03251		234	ABCC_MsbA MsbA is an essential ABC transporter, cl	89.81
TIGR00968		237	3a0106s01 sulfate ABC transporter, ATP-binding pro	89.81
cd03295		242	ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin	89.79
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	89.78
PRK10247		225	putative ABC transporter ATP-binding protein YbbL;	89.78
TIGR01184		230	ntrCD nitrate transport ATP-binding subunits C and	89.71
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	89.71
cd03233		202	ABC_PDR_domain1 The pleiotropic drug resistance (P	89.69
PRK13538		204	cytochrome c biogenesis protein CcmA; Provisional	89.68
cd03300		232	ABC_PotA_N PotA is an ABC-type transporter and the	89.66
PF02263		260	GBP: Guanylate-binding protein, N-terminal domain;	89.64
PRK13546		264	teichoic acids export protein ATP-binding subunit;	89.64
PRK13633		280	cobalt transporter ATP-binding subunit; Provisiona	89.63
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	89.62
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	89.6
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	89.56
TIGR01189		198	ccmA heme ABC exporter, ATP-binding protein CcmA.	89.48
PRK10253		265	iron-enterobactin transporter ATP-binding protein;	89.42
PRK10575		265	iron-hydroxamate transporter ATP-binding subunit;	89.4
PRK11264		250	putative amino-acid ABC transporter ATP-binding pr	89.4
TIGR03411		242	urea_trans_UrtD urea ABC transporter, ATP-binding	89.39
cd03244		221	ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.	89.39
TIGR03771		223	anch_rpt_ABC anchored repeat-type ABC transporter,	89.38
cd03294		269	ABC_Pro_Gly_Bertaine This family comprises the gly	89.37
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	89.35
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	89.32
PRK10078		186	ribose 1,5-bisphosphokinase; Provisional	89.31
COG3839		338	MalK ABC-type sugar transport systems, ATPase comp	89.3
cd03296		239	ABC_CysA_sulfate_importer Part of the ABC transpor	89.29
cd03220		224	ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo	89.29
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	89.27

>KOG0446 consensus Vacuolar sorting protein VPS1, dynamin, and related proteins [Intracellular trafficking, secretion, and vesicular transport; General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=6.5e-104  Score=919.04  Aligned_cols=621  Identities=40%  Similarity=0.587  Sum_probs=553.5

Q ss_pred             CCccchHHHHHHHHHHHHHhCCCCCCCCCEEEEEccCCCCHHHHHHHHhCCCCCCCCCCccccceEEEEeccCCCc-ccc
Q 003736           20 PLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTD-EEY   98 (799)
Q Consensus        20 ~l~~~l~~~i~kL~d~~~~~g~~~~i~lPqIvVvG~qSsGKSSllnaL~G~~~lP~~~~~~Tr~p~~~~l~~~~~~-~~~   98 (799)
                      .+++.+++++|++||.|..+|.+..+++|+|||||+||+||||+||+|+|++|||||.|+|||||++++|.+.... .+|
T Consensus         2 ~~~~~li~~vn~lqd~~~~l~~~~~i~lP~I~vvG~QSsGKSSvLE~lvG~~flpRg~givTRrPlvlqL~~~~~~~~e~   81 (657)
T KOG0446|consen    2 GLMRLLIPLSNPLQDKLEILGSSSFIPLPQIVVVGGQSSGKSSVLESLVGFVFLPRGVGIVTRRPLILQLSIVAGGDEEE   81 (657)
T ss_pred             chhhhccccchHHHHHHHHhcCCCcccCCceEEecCCCCcchhHHHHhhccccccccccceecccceeecccccCCcccc
Confidence            3678899999999999999997788999999999999999999999999999999999999999999999988653 789


Q ss_pred             cccc-cCCCCcccChhHHHHHHHHhhhhhcCCCCCccccceEEEEecCCccCEEEEeCCCCCCCCe--------------
Q 003736           99 GEFL-HLPGKRFYDFSEIRREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPV--------------  163 (799)
Q Consensus        99 ~~~~-~~~g~~~~d~~ei~~~i~~~~~~~~g~~~~~s~~~i~l~i~~p~~~~LtLVDlPGi~~~~~--------------  163 (799)
                      ++|. |.+++.++||++++++|+.+|++.+|.++|+|+.+|.|+|++|++++||||||||++++|+              
T Consensus        82 ~~f~~h~~~~~~~D~~~vrkeI~~et~~~~g~~kgiS~~pI~L~i~s~~v~~lTLvDlPG~tkvpv~dqp~di~~qI~~m  161 (657)
T KOG0446|consen   82 ASFLTHDKKKRFTDFEEVRKEIRSETDRITGSNKGISPVPITLKIFSALVANLTLVDLPGLTKVPVADQPDDIEEEIKSM  161 (657)
T ss_pred             hhccccccccccCCHHHHHHHHHhhHHHhcCCCCCcCCCCceeeecCCCCchhhhcCCCCCcccccCCCCccHHHHHHHH
Confidence            9999 9999999999999999999999999999999999999999999999999999999999986              


Q ss_pred             --------------EecCCCCCChHHHHHHHHHcCCCCCcEEEEeecCCCCCCchhHHHhhhccccccccceEEEEcCCh
Q 003736          164 --------------VTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQ  229 (799)
Q Consensus       164 --------------V~~a~~dl~~~dal~la~~~dp~g~rtIgVlTK~Dl~~~g~~~~~~l~~~~~~l~lgy~~V~nrsq  229 (799)
                                    |++||+|+++++|+++|+++||.|.|||||+||+|+|++|+++..+|.|..+++++||++|+||+|
T Consensus       162 i~~yi~~~~~iILav~~an~d~ats~alkiarevDp~g~RTigvitK~DlmdkGt~~~~~L~g~~~~l~~g~v~vvnR~q  241 (657)
T KOG0446|consen  162 IEEYIEKPNRIILAVTPANSDIATSPALVVAREVDPGGSRTLEVITKFDFMDKGTNAVTRLVGRPITLKVGYVGVVNRSQ  241 (657)
T ss_pred             HHHhccccchhhhhccchhhhhhcCHHHHHHHhhCCCccchhHHhhhHHhhhcCCcceeeecCCccccccceeeeeccch
Confidence                          999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhhhhHHHHHHHHHhhccCCCcccccccCCChhHHHHHHHHHHHHHHHhhccChHHHHHHHHHHHHHHHHhcCCCCC
Q 003736          230 EDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITE  309 (799)
Q Consensus       230 ~d~~~~~si~ea~~~E~~FF~~~~~~~~l~~~~Gi~~L~~~L~~~L~~~I~~~LP~l~~~i~~~l~~~~~eL~~lg~~~~  309 (799)
                      +++..++++.+++..|..||..||.|..+.+++|+++|.+.|+..|..||+.++|.++..|+.++.+++.+|..||. ..
T Consensus       242 ~di~~~k~~~~al~~e~~~f~~~p~y~~~~~~~g~p~La~~L~~~l~~hi~~~lP~l~~~i~~~~~~~~~el~~~g~-~~  320 (657)
T KOG0446|consen  242 SIIDFKKSILEALNDEVPSFESVPSYPILLTISGVPYLALLLPGYLQSHIRDQLPELKTKINKLLEKYQDELNRIGA-VD  320 (657)
T ss_pred             hhhhhhhhHHHHHHhhhhhhhccccccccccccCcchHHHHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHHHHHhcc-cC
Confidence            99999999999999999999999999999888999999999999999999999999999999999999999999997 33


Q ss_pred             ChhhHHHHHHHHHHHHHHHHHhhhcCCccccccccccccchhhHHhHHHHHHhhhccCCCCCCchHHHHHHHHhhcCCCC
Q 003736          310 SKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKS  389 (799)
Q Consensus       310 ~~~~~~~~Ll~~i~~f~~~~~~~i~G~~~~~~~~~l~gg~ri~~~f~~~F~~~l~~~~~~~~~~~~dI~~~i~~~~G~~~  389 (799)
                      ........++.++..|+..|...++|..+...+.+++||+||+|+|+..|...+.+++|++.+...+|++++.|++|+++
T Consensus       321 ~~~~~~~~ll~~i~~~~~~~~~~v~g~~~~~~~~elsggari~~~F~~~f~~~i~~i~~~~~~~~~~i~~~i~~~~G~~~  400 (657)
T KOG0446|consen  321 VDLANSAALLAIIREDPRGLRTGVIGKLDLVPTKALSGGARINYPFHGGFPGVIKKLPPDRKLLGQNIEKLVSEASGIRP  400 (657)
T ss_pred             CccchhhHHHHHHHHHHHHHHHhhcccccccchhcccchhhhhhhhhhccchhhhcCCcchhhhHHHHHHHHHhccCCCc
Confidence            34456788999999999999999999987654789999999999999999999999999999999999999999999999


Q ss_pred             CCCCCChHHHHHHHHHHHHhhchHHHHHHHHHHHHHHHHHhhhhh-ccccchHHHHHHHHHHHHHHHHhhhhHHHHHHHH
Q 003736          390 ALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVN-ELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHI  468 (799)
Q Consensus       390 ~~fv~~~~Fe~Lvk~qi~~l~~Pal~c~~~V~~el~~i~~~~~~~-~~~rfp~L~~~i~~~v~~~L~~~~~~a~~~I~~l  468 (799)
                      ++|+|+.+||.+|++||+.+++|+++|++.|++++.+++++|... +|.|||.|++++.+++.+++++++.+++++|.++
T Consensus       401 ~lf~p~~afe~lvk~~i~~l~~p~l~~v~~v~~el~~~~~~~~~~~~l~rfp~l~~~~~~~~~~~~~~~~~~t~~~v~~~  480 (657)
T KOG0446|consen  401 SLFVPESSFESLVKGQIQSLRDPSLKCVEEVHRELVRIVADSIRATELKRFPVLYSELVEIASSLIAEGLDETKKAVKNL  480 (657)
T ss_pred             cccCChHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHhhhHHHHHhHHHHHHHHHHHHHHHHHhhhHHHHHHHHH
Confidence            999999999999999999999999999999999999999999876 8999999999999999999999999999999999


Q ss_pred             HHHHhcccCCCCCCCccchH-HHHHHHHhhhhcCCCCCcccCCCCCCCCCCCCcchhhhhHHHHHhhhcccccCCCCCcc
Q 003736          469 IEMEMDYINTSHPNFIGGSK-AVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSERSLKSRAILARQVNGIMADQGVRPT  547 (799)
Q Consensus       469 i~~E~~yInT~hp~f~~~~~-a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  547 (799)
                      |+||.+||||.||||+++.+ |+......  +.+       ..                         ++.. +.     
T Consensus       481 i~~e~~yinT~h~df~~~~~~al~~~~~~--~~~-------~~-------------------------~~~~-~~-----  520 (657)
T KOG0446|consen  481 IDLEQSYLNTDHPDFRSLTDSALSSVTSP--SIA-------AM-------------------------KLIS-AQ-----  520 (657)
T ss_pred             HHHHHHHhcCcChhhhhhHHHHHHHhhcc--ccc-------cc-------------------------cccc-cc-----
Confidence            99999999999999999875 43221110  000       00                         0000 00     


Q ss_pred             hhhcccCCCCCCCCCCCccccccCCCCCCCCCCCCccCCCCCCCCchhhhhhHhhhccCCCCccCCCCCCCchhHHHHHH
Q 003736          548 VEVEKVAPAGNTSGSSWGISSIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIA  627 (799)
Q Consensus       548 ~~~~~~~~~~~~~~~~~g~~~~f~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~l~~~p~~l~~~~~~s~~e~~ei~  627 (799)
                          . ..  ......++....+.+.                          ...+.+...+..+.....+++++..+++
T Consensus       521 ----~-~~--~~~~~~~~~~~~~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~  567 (657)
T KOG0446|consen  521 ----L-LK--EELGECNSALKAIKNA--------------------------VGSIRLDPSDIVLSRALVLKKRECKETE  567 (657)
T ss_pred             ----c-cc--cccccccchhhhhcch--------------------------hhhhhhcccchhhhhhhhcchhhhHHHH
Confidence                0 00  0000000000001000                          0001222333444444567788889999


Q ss_pred             HHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHhc-hhhhhhhcCCCHHHHHHHHHHHHHHHHHHHHH
Q 003736          628 VTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYR-ENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAF  706 (799)
Q Consensus       628 ~ir~lv~SYf~IVrK~i~D~VPKaImhfLVn~~k~~Lq~eLv~~LY~-~~~~~eLL~E~~~ia~kR~~l~~~l~~L~qA~  706 (799)
                      .|+.++.|||+||+|+|+|+|||+|||||||.+++.||++|+++||+ ++.+++||+|+|.++++|+.|++|+++|++|.
T Consensus       568 ~i~~~~~sY~~iv~~~i~d~vpk~i~~~lv~~~k~~l~~~l~~~L~~~~~~~~~ll~E~~~i~~~R~~~~~~l~~L~~a~  647 (657)
T KOG0446|consen  568 EISSCPESYLNIVSDKLVDTVPKALNHELLNEFKDDLPNELDQRLYAGDEQLESLLKEDPRIKRRRELQQKRLLALQKAL  647 (657)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchhHHHHHHccCHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999 99999999999999999999999999999999


Q ss_pred             HHHccccc
Q 003736          707 RTLDELPL  714 (799)
Q Consensus       707 ~iL~ev~~  714 (799)
                      .+|..+..
T Consensus       648 ~ii~~~~~  655 (657)
T KOG0446|consen  648 SILATVAQ  655 (657)
T ss_pred             HHHHHHhc
Confidence            99988765

>PF01031 Dynamin_M: Dynamin central region; InterPro: IPR000375 Dynamin is a microtubule-associated force-producing protein of 100 Kd which is involved in the production of microtubule bundles	Back alignment and domain information

>smart00053 DYNc Dynamin, GTPase	Back alignment and domain information

>KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only]	Back alignment and domain information

>smart00302 GED Dynamin GTPase effector domain	Back alignment and domain information

>PF02212 GED: Dynamin GTPase effector domain; InterPro: IPR003130 Dynamin GTPase effector domain found in proteins related to dynamin	Back alignment and domain information

>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another	Back alignment and domain information

>COG0699 Predicted GTPases (dynamin-related) [General function prediction only]	Back alignment and domain information

>PRK09866 hypothetical protein; Provisional	Back alignment and domain information

>COG0218 Predicted GTPase [General function prediction only]	Back alignment and domain information

>COG0486 ThdF Predicted GTPase [General function prediction only]	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>COG1159 Era GTPase [General function prediction only]	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions	Back alignment and domain information

>TIGR03156 GTP_HflX GTP-binding protein HflX	Back alignment and domain information

>TIGR00436 era GTP-binding protein Era	Back alignment and domain information

>COG2262 HflX GTPases [General function prediction only]	Back alignment and domain information

>PRK00089 era GTPase Era; Reviewed	Back alignment and domain information

>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence	Back alignment and domain information

>PRK11058 GTPase HflX; Provisional	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>PRK00454 engB GTP-binding protein YsxC; Reviewed	Back alignment and domain information

>cd01895 EngA2 EngA2 subfamily	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>COG1084 Predicted GTPase [General function prediction only]	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse	Back alignment and domain information

>cd04104 p47_IIGP_like p47 (47-kDa) family	Back alignment and domain information

>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>PRK12298 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>COG3596 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK12299 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd01876 YihA_EngB The YihA (EngB) subfamily	Back alignment and domain information

>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1)	Back alignment and domain information

>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed	Back alignment and domain information

>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE	Back alignment and domain information

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB	Back alignment and domain information

>cd01898 Obg Obg subfamily	Back alignment and domain information

>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily	Back alignment and domain information

>PRK15494 era GTPase Era; Provisional	Back alignment and domain information

>PRK12296 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd00880 Era_like Era (E	Back alignment and domain information

>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms]	Back alignment and domain information

>PRK12297 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>TIGR02729 Obg_CgtA Obg family GTPase CgtA	Back alignment and domain information

>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes	Back alignment and domain information

>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd00881 GTP_translation_factor GTP translation factor family	Back alignment and domain information

>PRK09554 feoB ferrous iron transport protein B; Reviewed	Back alignment and domain information

>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria	Back alignment and domain information

>cd01894 EngA1 EngA1 subfamily	Back alignment and domain information

>PRK04213 GTP-binding protein; Provisional	Back alignment and domain information

>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts)	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>cd04171 SelB SelB subfamily	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily	Back alignment and domain information

>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1	Back alignment and domain information

>cd04142 RRP22 RRP22 subfamily	Back alignment and domain information

>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site	Back alignment and domain information

>cd04165 GTPBP1_like GTPBP1-like	Back alignment and domain information

>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase)	Back alignment and domain information

>cd01890 LepA LepA subfamily	Back alignment and domain information

>cd01861 Rab6 Rab6 subfamily	Back alignment and domain information

>cd01868 Rab11_like Rab11-like	Back alignment and domain information

>PRK15467 ethanolamine utilization protein EutP; Provisional	Back alignment and domain information

>cd01850 CDC_Septin CDC/Septin	Back alignment and domain information

>cd04147 Ras_dva Ras-dva subfamily	Back alignment and domain information

>cd01864 Rab19 Rab19 subfamily	Back alignment and domain information

>cd00154 Rab Rab family	Back alignment and domain information

>cd04136 Rap_like Rap-like subfamily	Back alignment and domain information

>cd01893 Miro1 Miro1 subfamily	Back alignment and domain information

>cd04159 Arl10_like Arl10-like subfamily	Back alignment and domain information

>cd01862 Rab7 Rab7 subfamily	Back alignment and domain information

>cd01889 SelB_euk SelB subfamily	Back alignment and domain information

>cd01866 Rab2 Rab2 subfamily	Back alignment and domain information

>smart00173 RAS Ras subfamily of RAS small GTPases	Back alignment and domain information

>TIGR00231 small_GTP small GTP-binding protein domain	Back alignment and domain information

>cd04112 Rab26 Rab26 subfamily	Back alignment and domain information

>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily	Back alignment and domain information

>cd01865 Rab3 Rab3 subfamily	Back alignment and domain information

>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins	Back alignment and domain information

>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily	Back alignment and domain information

>smart00175 RAB Rab subfamily of small GTPases	Back alignment and domain information

>cd04175 Rap1 Rap1 subgroup	Back alignment and domain information

>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2	Back alignment and domain information

>cd04139 RalA_RalB RalA/RalB subfamily	Back alignment and domain information

>cd01863 Rab18 Rab18 subfamily	Back alignment and domain information

>cd04119 RJL RJL (RabJ-Like) subfamily	Back alignment and domain information

>TIGR02528 EutP ethanolamine utilization protein, EutP	Back alignment and domain information

>cd04113 Rab4 Rab4 subfamily	Back alignment and domain information

>cd04118 Rab24 Rab24 subfamily	Back alignment and domain information

>cd04114 Rab30 Rab30 subfamily	Back alignment and domain information

>cd04177 RSR1 RSR1 subgroup	Back alignment and domain information

>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily	Back alignment and domain information

>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily	Back alignment and domain information

>cd01886 EF-G Elongation factor G (EF-G) subfamily	Back alignment and domain information

>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases	Back alignment and domain information

>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2	Back alignment and domain information

>cd04144 Ras2 Ras2 subfamily	Back alignment and domain information

>cd04124 RabL2 RabL2 subfamily	Back alignment and domain information

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily	Back alignment and domain information

>cd01860 Rab5_related Rab5-related subfamily	Back alignment and domain information

>cd04157 Arl6 Arl6 subfamily	Back alignment and domain information

>cd04127 Rab27A Rab27a subfamily	Back alignment and domain information

>cd04106 Rab23_lke Rab23-like subfamily	Back alignment and domain information

>cd04166 CysN_ATPS CysN_ATPS subfamily	Back alignment and domain information

>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains	Back alignment and domain information

>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily	Back alignment and domain information

>cd04156 ARLTS1 ARLTS1 subfamily	Back alignment and domain information

>cd04168 TetM_like Tet(M)-like subfamily	Back alignment and domain information

>cd04140 ARHI_like ARHI subfamily	Back alignment and domain information

>cd00157 Rho Rho (Ras homology) family	Back alignment and domain information

>PTZ00369 Ras-like protein; Provisional	Back alignment and domain information

>cd01858 NGP_1 NGP-1	Back alignment and domain information

>cd04176 Rap2 Rap2 subgroup	Back alignment and domain information

>TIGR00475 selB selenocysteine-specific elongation factor SelB	Back alignment and domain information

>cd04123 Rab21 Rab21 subfamily	Back alignment and domain information

>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily	Back alignment and domain information

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily	Back alignment and domain information

>cd01884 EF_Tu EF-Tu subfamily	Back alignment and domain information

>cd00882 Ras_like_GTPase Ras-like GTPase superfamily	Back alignment and domain information

>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional	Back alignment and domain information

>cd04154 Arl2 Arl2 subfamily	Back alignment and domain information

>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases	Back alignment and domain information

>cd04101 RabL4 RabL4 (Rab-like4) subfamily	Back alignment and domain information

>cd04110 Rab35 Rab35 subfamily	Back alignment and domain information

>cd04151 Arl1 Arl1 subfamily	Back alignment and domain information

>cd00879 Sar1 Sar1 subfamily	Back alignment and domain information

>cd04169 RF3 RF3 subfamily	Back alignment and domain information

>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2)	Back alignment and domain information

>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases	Back alignment and domain information

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily	Back alignment and domain information

>cd01892 Miro2 Miro2 subfamily	Back alignment and domain information

>cd04135 Tc10 TC10 subfamily	Back alignment and domain information

>cd04111 Rab39 Rab39 subfamily	Back alignment and domain information

>cd04178 Nucleostemin_like Nucleostemin-like	Back alignment and domain information

>cd04148 RGK RGK subfamily	Back alignment and domain information

>COG1163 DRG Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd04125 RabA_like RabA-like subfamily	Back alignment and domain information

>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily	Back alignment and domain information

>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism]	Back alignment and domain information

>cd00876 Ras Ras family	Back alignment and domain information

>cd04158 ARD1 ARD1 subfamily	Back alignment and domain information

>cd04122 Rab14 Rab14 subfamily	Back alignment and domain information

>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily	Back alignment and domain information

>TIGR00487 IF-2 translation initiation factor IF-2	Back alignment and domain information

>cd04116 Rab9 Rab9 subfamily	Back alignment and domain information

>cd04160 Arfrp1 Arfrp1 subfamily	Back alignment and domain information

>cd01870 RhoA_like RhoA-like subfamily	Back alignment and domain information

>PRK05306 infB translation initiation factor IF-2; Validated	Back alignment and domain information

>cd04149 Arf6 Arf6 subfamily	Back alignment and domain information

>TIGR00437 feoB ferrous iron transporter FeoB	Back alignment and domain information

>PRK04004 translation initiation factor IF-2; Validated	Back alignment and domain information

>cd01849 YlqF_related_GTPase YlqF-related GTPases	Back alignment and domain information

>PLN03110 Rab GTPase; Provisional	Back alignment and domain information

>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>CHL00189 infB translation initiation factor 2; Provisional	Back alignment and domain information

>cd04120 Rab12 Rab12 subfamily	Back alignment and domain information

>cd04109 Rab28 Rab28 subfamily	Back alignment and domain information

>cd04132 Rho4_like Rho4-like subfamily	Back alignment and domain information

>KOG2486 consensus Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily	Back alignment and domain information

>cd01855 YqeH YqeH	Back alignment and domain information

>cd04143 Rhes_like Rhes_like subfamily	Back alignment and domain information

>COG0536 Obg Predicted GTPase [General function prediction only]	Back alignment and domain information

>PLN03108 Rab family protein; Provisional	Back alignment and domain information

>CHL00071 tufA elongation factor Tu	Back alignment and domain information

>PLN03118 Rab family protein; Provisional	Back alignment and domain information

>TIGR01393 lepA GTP-binding protein LepA	Back alignment and domain information

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily	Back alignment and domain information

>cd01857 HSR1_MMR1 HSR1/MMR1	Back alignment and domain information

>cd04117 Rab15 Rab15 subfamily	Back alignment and domain information

>cd04130 Wrch_1 Wrch-1 subfamily	Back alignment and domain information

>PLN03127 Elongation factor Tu; Provisional	Back alignment and domain information

>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily	Back alignment and domain information

>cd04167 Snu114p Snu114p subfamily	Back alignment and domain information

>cd04134 Rho3 Rho3 subfamily	Back alignment and domain information

>PTZ00133 ADP-ribosylation factor; Provisional	Back alignment and domain information

>TIGR00484 EF-G translation elongation factor EF-G	Back alignment and domain information

>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only]	Back alignment and domain information

>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily	Back alignment and domain information

>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []	Back alignment and domain information

>cd01885 EF2 EF2 (for archaea and eukarya)	Back alignment and domain information

>PRK12317 elongation factor 1-alpha; Reviewed	Back alignment and domain information

>cd04126 Rab20 Rab20 subfamily	Back alignment and domain information

>PRK00007 elongation factor G; Reviewed	Back alignment and domain information

>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor	Back alignment and domain information

>PRK05433 GTP-binding protein LepA; Provisional	Back alignment and domain information

>cd04155 Arl3 Arl3 subfamily	Back alignment and domain information

>TIGR02836 spore_IV_A stage IV sporulation protein A	Back alignment and domain information

>PLN03071 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>PLN00223 ADP-ribosylation factor; Provisional	Back alignment and domain information

>PRK12739 elongation factor G; Reviewed	Back alignment and domain information

>cd04150 Arf1_5_like Arf1-Arf5-like subfamily	Back alignment and domain information

>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF	Back alignment and domain information

>cd01899 Ygr210 Ygr210 subfamily	Back alignment and domain information

>TIGR02034 CysN sulfate adenylyltransferase, large subunit	Back alignment and domain information

>cd01874 Cdc42 Cdc42 subfamily	Back alignment and domain information

>cd01882 BMS1 Bms1	Back alignment and domain information

>cd01900 YchF YchF subfamily	Back alignment and domain information

>PRK00049 elongation factor Tu; Reviewed	Back alignment and domain information

>PRK09563 rbgA GTPase YlqF; Reviewed	Back alignment and domain information

>KOG0410 consensus Predicted GTP binding protein [General function prediction only]	Back alignment and domain information

>PLN03126 Elongation factor Tu; Provisional	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>TIGR00485 EF-Tu translation elongation factor TU	Back alignment and domain information

>cd01856 YlqF YlqF	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>PRK12736 elongation factor Tu; Reviewed	Back alignment and domain information

>cd04128 Spg1 Spg1p	Back alignment and domain information

>PTZ00258 GTP-binding protein; Provisional	Back alignment and domain information

>PRK12735 elongation factor Tu; Reviewed	Back alignment and domain information

>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily	Back alignment and domain information

>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta)	Back alignment and domain information

>cd04129 Rho2 Rho2 subfamily	Back alignment and domain information

>PRK09601 GTP-binding protein YchF; Reviewed	Back alignment and domain information

>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma	Back alignment and domain information

>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only]	Back alignment and domain information

>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>cd04121 Rab40 Rab40 subfamily	Back alignment and domain information

>PRK00741 prfC peptide chain release factor 3; Provisional	Back alignment and domain information

>cd01871 Rac1_like Rac1-like subfamily	Back alignment and domain information

>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA	Back alignment and domain information

>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain	Back alignment and domain information

>TIGR00490 aEF-2 translation elongation factor aEF-2	Back alignment and domain information

>PRK04000 translation initiation factor IF-2 subunit gamma; Validated	Back alignment and domain information

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>COG1161 Predicted GTPases [General function prediction only]	Back alignment and domain information

>PRK10218 GTP-binding protein; Provisional	Back alignment and domain information

>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily	Back alignment and domain information

>PRK13796 GTPase YqeH; Provisional	Back alignment and domain information

>PTZ00416 elongation factor 2; Provisional	Back alignment and domain information

>PLN00116 translation elongation factor EF-2 subunit; Provisional	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>PRK07560 elongation factor EF-2; Reviewed	Back alignment and domain information

>PRK12288 GTPase RsgA; Reviewed	Back alignment and domain information

>PRK12289 GTPase RsgA; Reviewed	Back alignment and domain information

>cd04102 RabL3 RabL3 (Rab-like3) subfamily	Back alignment and domain information

>PRK13351 elongation factor G; Reviewed	Back alignment and domain information

>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH	Back alignment and domain information

>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional	Back alignment and domain information

>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis	Back alignment and domain information

>cd04133 Rop_like Rop subfamily	Back alignment and domain information

>cd04103 Centaurin_gamma Centaurin gamma	Back alignment and domain information

>TIGR00503 prfC peptide chain release factor 3	Back alignment and domain information

>cd01859 MJ1464 MJ1464	Back alignment and domain information

>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily	Back alignment and domain information

>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha	Back alignment and domain information

>cd01875 RhoG RhoG subfamily	Back alignment and domain information

>cd04131 Rnd Rnd subfamily	Back alignment and domain information

>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PTZ00132 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR00157 ribosome small subunit-dependent GTPase A	Back alignment and domain information

>PRK09602 translation-associated GTPase; Reviewed	Back alignment and domain information

>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton]	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>PRK00098 GTPase RsgA; Reviewed	Back alignment and domain information

>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily	Back alignment and domain information

>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]	Back alignment and domain information

>COG2229 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PTZ00141 elongation factor 1- alpha; Provisional	Back alignment and domain information

>cd01854 YjeQ_engC YjeQ/EngC	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK12740 elongation factor G; Reviewed	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd03114 ArgK-like The function of this protein family is unkown	Back alignment and domain information

>cd01873 RhoBTB RhoBTB subfamily	Back alignment and domain information

>PLN00023 GTP-binding protein; Provisional	Back alignment and domain information

>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PLN00043 elongation factor 1-alpha; Provisional	Back alignment and domain information

>TIGR00073 hypB hydrogenase accessory protein HypB	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>PRK13768 GTPase; Provisional	Back alignment and domain information

>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1162 Predicted GTPases [General function prediction only]	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd03112 CobW_like The function of this protein family is unkown	Back alignment and domain information

>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>TIGR00092 GTP-binding protein YchF	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components	Back alignment and domain information

>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only]	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG2484 consensus GTPase [General function prediction only]	Back alignment and domain information

>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only]	Back alignment and domain information

>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only]	Back alignment and domain information

>KOG2203 consensus GTP-binding protein [General function prediction only]	Back alignment and domain information

>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1	Back alignment and domain information

>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>KOG0395 consensus Ras-related GTPase [General function prediction only]	Back alignment and domain information

>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR03348 VI_IcmF type VI secretion protein IcmF	Back alignment and domain information

>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK14845 translation initiation factor IF-2; Provisional	Back alignment and domain information

>PRK01889 GTPase RsgA; Reviewed	Back alignment and domain information

>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms]	Back alignment and domain information

>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism]	Back alignment and domain information

>KOG2423 consensus Nucleolar GTPase [General function prediction only]	Back alignment and domain information

>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems	Back alignment and domain information

>KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF13521 AAA_28: AAA domain; PDB: 1LW7_A	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2	Back alignment and domain information

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A	Back alignment and domain information

>PF05879 RHD3: Root hair defective 3 GTP-binding protein (RHD3); InterPro: IPR008803 This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]	Back alignment and domain information

>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms]	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>TIGR03263 guanyl_kin guanylate kinase	Back alignment and domain information

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)	Back alignment and domain information

>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK00300 gmk guanylate kinase; Provisional	Back alignment and domain information

>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit	Back alignment and domain information

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin	Back alignment and domain information

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids	Back alignment and domain information

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport	Back alignment and domain information

>TIGR02673 FtsE cell division ATP-binding protein FtsE	Back alignment and domain information

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only]	Back alignment and domain information

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids	Back alignment and domain information

>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1)	Back alignment and domain information

>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component	Back alignment and domain information

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane	Back alignment and domain information

>PRK13540 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR01978 sufC FeS assembly ATPase SufC	Back alignment and domain information

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity	Back alignment and domain information

>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake	Back alignment and domain information

>KOG0463 consensus GTP-binding protein GP-1 [General function prediction only]	Back alignment and domain information

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group	Back alignment and domain information

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein	Back alignment and domain information

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine	Back alignment and domain information

>PRK13651 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only]	Back alignment and domain information

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup	Back alignment and domain information

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively	Back alignment and domain information

>PRK11124 artP arginine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>CHL00131 ycf16 sulfate ABC transporter protein; Validated	Back alignment and domain information

>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein	Back alignment and domain information

>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1	Back alignment and domain information

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK	Back alignment and domain information

>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional	Back alignment and domain information

>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient	Back alignment and domain information

>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional	Back alignment and domain information

>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters	Back alignment and domain information

>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria	Back alignment and domain information

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL	Back alignment and domain information

>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor	Back alignment and domain information

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter	Back alignment and domain information

>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13539 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance	Back alignment and domain information

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB	Back alignment and domain information

>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms]	Back alignment and domain information

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit	Back alignment and domain information

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters	Back alignment and domain information

>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)	Back alignment and domain information

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein	Back alignment and domain information

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional	Back alignment and domain information

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain	Back alignment and domain information

>PRK10908 cell division protein FtsE; Provisional	Back alignment and domain information

>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP	Back alignment and domain information

>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK	Back alignment and domain information

>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function	Back alignment and domain information

>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed	Back alignment and domain information

>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE	Back alignment and domain information

>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins	Back alignment and domain information

>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional	Back alignment and domain information

>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>PRK13538 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D	Back alignment and domain information

>PF02263 GBP: Guanylate-binding protein, N-terminal domain; InterPro: IPR015894 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma	Back alignment and domain information

>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13633 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA	Back alignment and domain information

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional	Back alignment and domain information

>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD	Back alignment and domain information

>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C	Back alignment and domain information

>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit	Back alignment and domain information

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>PRK10078 ribose 1,5-bisphosphokinase; Provisional	Back alignment and domain information

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import	Back alignment and domain information

>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

Homologous Structure Templates