Citrus Sinensis ID: 003804

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790----
MSSYCFTTISVCLGPDANSTFAGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALKSYRGERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVDGEEAYQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATRKWTSRNTGSPTCKRGFVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLPASSALLEMMIFHLPSPATAQKYRVENLYEGPLDDAYANAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGKVATGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPKYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRAATSGQAFPQCVFDHWDMMSSDPLEPGSQASQLVLDIRKRKGLKEQMTPLSEYEDKL
ccccccccccEEEEEEEccccccHHHHHHHHHHHcccccHHHcccccccccHHHHHHHcccEEEcEEEEEEEEcHHHHcccccccccccEEEEEEccccccccHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHccccEEEEEEcHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcccccEEEccccccEEEcHHHHHHHHHHHccccHHHHHHHHcccccccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHccccccHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHccccccEEEEEcccEEccccccEEEEEEEEEcccccccEEEEEccccccccccccEEEEEEEEEEEccccEEEEcccccccEEEEEcccccccccEEEccccccccccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHccccEEEEEcccccEEEEcccccHHHHHHHHHHHHHccccEEEEcccEEEEEEEEEcccccEEEEccccccccEEEEEEEcccccccccccccccccccccccHHHcHHHHHHHHHHHHcccccccccccEEEEEEEEEEcccccccccccccHHHHHHHHHHHHccccEEEccEEEEEEEEcccHHHHHHHHHccccEEEEEEEEEccccEEEEEEEEcccccccHHHHHHHHcccccccccccccEEEccccccccccHHHHHHHHHHHcccccccccccccccccc
ccHHHHccEEEEEEEEcccccccccccHHHHHHHHcHHHHHHccccccHcHHHHHHHccEEEEEHHHEEEEccccccccccccccccccEEEEEEcccccccEEEEHHHHHEEcccEEEEEEcccccccccHHHHHHHHHcccccEEEEEHHHHHHHHHcccHHHHHHHHHHHHHHcccEEEEEccccccccEEEccEccccccccccEHHHHHHHHHHHHHHHccccHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHccccccccccEEEccccccccccccHEEccccccccHHHHHEEEcccccccEEEEEEEEEEEEEEcccEEEEcccccccccHHHHHHHHHHHHHHHHHcccccHHccccccEEEEEEccccccccccccccccEEEEEEEEEEcccccEEEEEEccccHcHHHHHHHHHHHHHHccccEEEEEcccccEEEEcccHHHHHHHHHHHHHHcccEEEEEccccEEEEEEEEcccccEEEEccccccccEEEEEEEEccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHccccEEccEEEEEEEccHHHccccEEcHccccccEccccccccccEEEEEEEEEHHHHHcccHHHHHcccccccEEEEEccHHHccccccccccHHHHHHHHHHHHcccccccccHHHHHHcc
mssycfttisvclgpdanstfagkstLTDSLVAAAGIIAQevagdvrmtdtrqdeaergiTIKSTGISLYYEMTDAALKSYrgerqgneYLINlidspghvdfsseVTAALRITDGALVVVDCIEGVCVQTETVLRQALgerirpvltvNKMDRCFLELQVDGEEAYQTFQKVIENANVIMAtyedpllgdvqvypekgtvAFSAGLHGWAFTLTNFAKMYAskfgvdesKMMERlwgenffdpatrkwtsrntgsptckrgfvQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLPASSALLEMMIFhlpspataQKYRVEnlyegplddayanairncdpegplMLYVSkmipasdkgrffafGRVFSGKVATGLKvrimgpnyvpgekkdlYVKSVQRTVIWMgkkqetvedvpcgntvamvGLDQYITknatltnekevdahpiramkfsvsPVVRVAVQCKVASDLPKLVEGLKRlaksdpmvvcsMEESGEHIIAGAGELHLEICLKDLqddfmggaeiiksdpvvsfRETVLEKSCRTvmskspnkhnrlymearplEEGLaeaiddgrigprddpkylneIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHAdaihrgggqvipTARRVIYASqltakprllepvylveiqapeqaLGGIYSVLnqkrghvfeemqrpgtplynikaylpvvesfgfsstlraatsgqafpqcvfdhwdmmssdplepgsqaSQLVLDIRKRKglkeqmtplseyedkl
MSSYCFTTISVCLGPDANSTFAGKSTLTDSLVAAAGIIAqevagdvrmtdtrqdeaergitikstgisLYYEMTDAALKSYRGERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLrqalgerirpvltvnkMDRCFLELQVDGEEAYQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENffdpatrkwtsrntgsptckrGFVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLPASSALLEMMIFHLPSPATAQKYRVENLYEGPLDDAYANAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSgkvatglkvrimgpnyvpgekkdlyVKSVQRTVIWmgkkqetvedvpcGNTVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCkvasdlpklVEGLKRLAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAeiiksdpvvsfRETVLEKscrtvmskspnkhnrlymEARPLEEGLaeaiddgrigprDDPKYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHrgggqviptARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRAATSGQAFPQCVFDHWDMMSSDPLEPGSQASQLVLDIRKRkglkeqmtplseyedkl
MSSYCFTTISVCLGPDANSTFAGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALKSYRGERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVDGEEAYQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATRKWTSRNTGSPTCKRGFVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLPASSALLEMMIFHLPSPATAQKYRVENLYEGPLDDAYANAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGKVATGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPKYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRAATSGQAFPQCVFDHWDMMSSDPLEPGSQASQLVLDIRKRKGLKEQMTPLSEYEDKL
***YCFTTISVCLGPDANSTFAGKSTLTDSLVAAAGIIAQEVAGDVRMT********RGITIKSTGISLYYEMTDAALKSYRGERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVDGEEAYQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATRKWTSRNTGSPTCKRGFVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMK****ELMGKALMKRVMQTWLPASSALLEMMIFHLPSPATAQKYRVENLYEGPLDDAYANAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGKVATGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSC*****************************************YLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRAATSGQAFPQCVFDHWDM***************************************
*****FT**SVCLGPDANSTFAGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALK**RGERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVDGEEAYQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATR***************FVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEE**LMGKALMKRVMQTWLPASSALLEMMIFHLPSPATAQKYRVENLYEGPLDDAYA******DPEGPLMLYVSKMIPASDKGRFFAFGRVFSGKVATGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPKYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRAATSGQAFPQCVFDHWDMMSSDPLEPGSQASQLVLDIRKRKGLKEQMTPLSEYEDKL
MSSYCFTTISVCLGPDANSTFAGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALKSYRGERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVDGEEAYQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATRKWTSRNTGSPTCKRGFVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLPASSALLEMMIFHLPSPATAQKYRVENLYEGPLDDAYANAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGKVATGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPKYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRAATSGQAFPQCVFDHWDMMSSDPLEPGSQASQLVLDIRKRKGLKEQMTPLSEYEDKL
*SSYCFTTISVCLGPDANSTFAGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALKSYRGERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVDGEEAYQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATRKWTSRNTGSPTCKRGFVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLPASSALLEMMIFHLPSPATAQKYRVENLYEGPLDDAYANAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGKVATGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPKYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRAATSGQAFPQCVFDHWDMMSSDPLEPGSQASQLVLDIRKRKGLKEQMTPLSEYEDKL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSYCFTTISVCLGPDANSTFAGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALKSYRGERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVDGEEAYQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATRKWTSRNTGSPTCKRGFVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLPASSALLEMMIFHLPSPATAQKYRVENLYEGPLDDAYANAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGKVATGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPKYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRAATSGQAFPQCVFDHWDMMSSDPLEPGSQASQLVLDIRKRKGLKEQMTPLSEYEDKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query794 2.2.26 [Sep-21-2011]
O23755843 Elongation factor 2 OS=Be N/A no 0.972 0.915 0.876 0.0
P28996845 Elongation factor 2 OS=Pa N/A no 0.972 0.913 0.761 0.0
O14460842 Elongation factor 2 OS=Sc yes no 0.968 0.913 0.612 0.0
P29691852 Elongation factor 2 OS=Ca yes no 0.965 0.900 0.605 0.0
Q23716832 Elongation factor 2 OS=Cr yes no 0.958 0.914 0.606 0.0
Q96X45844 Elongation factor 2 OS=Ne N/A no 0.968 0.911 0.603 0.0
P13060844 Elongation factor 2 OS=Dr yes no 0.965 0.908 0.600 0.0
P32324842 Elongation factor 2 OS=Sa yes no 0.967 0.912 0.594 0.0
Q874B9842 Elongation factor 2 OS=Ko yes no 0.967 0.912 0.589 0.0
Q90705858 Elongation factor 2 OS=Ga yes no 0.968 0.896 0.594 0.0
>sp|O23755|EF2_BETVU Elongation factor 2 OS=Beta vulgaris PE=2 SV=1 Back     alignment and function desciption
 Score = 1480 bits (3832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 713/813 (87%), Positives = 747/813 (91%), Gaps = 41/813 (5%)

Query: 23  GKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALKSYR 82
           GKSTLTDSLVAAAGIIAQEVAGDVRMTDTR DEAERGITIKSTGISLYY+MTD AL+SY+
Sbjct: 31  GKSTLTDSLVAAAGIIAQEVAGDVRMTDTRADEAERGITIKSTGISLYYQMTDEALQSYK 90

Query: 83  GERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGER 142
           GER+GN+YLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGER
Sbjct: 91  GERKGNDYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGER 150

Query: 143 IRPVLTVNKMDRCFLELQVDGEEAYQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVA 202
           IRPVLTVNKMDRCFLELQVDGEEAY TFQKVIENANVIMATYEDPLLGDVQVYPEKGTVA
Sbjct: 151 IRPVLTVNKMDRCFLELQVDGEEAYTTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVA 210

Query: 203 FSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATRKWTSRNTGSPTCKRG 262
           FSAGLHGWAFTL+NFAKMYASKFGVDESKMMERLWGENFFDPAT+KWT++N+G+ +CKRG
Sbjct: 211 FSAGLHGWAFTLSNFAKMYASKFGVDESKMMERLWGENFFDPATKKWTTKNSGNASCKRG 270

Query: 263 FVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLPASS 322
           FVQFCYEPIKQII  CMND+KDKL   + KLG+ MK+EEK+LMG+ LMKRVMQTWLPASS
Sbjct: 271 FVQFCYEPIKQIIAACMNDQKDKLLAHVTKLGIQMKTEEKDLMGRPLMKRVMQTWLPASS 330

Query: 323 ALLEMMIFHLPSPATAQKYRVENLYEGPLDDAYANAIRNCDPEGPLMLYVSKMIPASDKG 382
           ALLEMMI HLPSPATAQ+YRVENLYEGP+DD YA AIRNCDPEGPLMLYVSKMIPASDKG
Sbjct: 331 ALLEMMIHHLPSPATAQRYRVENLYEGPMDDVYATAIRNCDPEGPLMLYVSKMIPASDKG 390

Query: 383 RFFAFGRVFSGKVATGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGN 442
           RFFAFGRVF+GKV+TG+KVRIMGPNYVPGEKKDLYVK+VQRTVIWMGKKQETVEDVPCGN
Sbjct: 391 RFFAFGRVFAGKVSTGMKVRIMGPNYVPGEKKDLYVKNVQRTVIWMGKKQETVEDVPCGN 450

Query: 443 TVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKR 502
           TVA+VGLDQYITKNATLTNEKE DAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKR
Sbjct: 451 TVALVGLDQYITKNATLTNEKESDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKR 510

Query: 503 LAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLE 562
           LAKSDPMVVCS+EESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVL+
Sbjct: 511 LAKSDPMVVCSIEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLD 570

Query: 563 KSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPK---------------- 606
           +S RTVMSKSPNKHNRLYMEARP+EEGLAEAID+GRIGPRDDPK                
Sbjct: 571 RSVRTVMSKSPNKHNRLYMEARPMEEGLAEAIDEGRIGPRDDPKNRSKILAEEYGWDKDL 630

Query: 607 -------------------------YLNEIKDSVVAGFQWASKEGALAEENMRGICFEVC 641
                                    YLNEIKDSVVAGFQWASKEGALAEENMRGICFEVC
Sbjct: 631 AKKIWCFGPETTGPNMVVDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVC 690

Query: 642 DVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQ 701
           DVVLH DAIHRGGGQ+IPTARRV YASQLTAKPRLLEPVYLVEIQAPE ALGGIYSVLNQ
Sbjct: 691 DVVLHTDAIHRGGGQIIPTARRVFYASQLTAKPRLLEPVYLVEIQAPENALGGIYSVLNQ 750

Query: 702 KRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRAATSGQAFPQCVFDHWDMMSSDPL 761
           KRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRA+TSGQAFPQCVFDHW+MM SDPL
Sbjct: 751 KRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRASTSGQAFPQCVFDHWEMMPSDPL 810

Query: 762 EPGSQASQLVLDIRKRKGLKEQMTPLSEYEDKL 794
           E GSQAS LV  IRKRKGLKEQMTPLSE+EDKL
Sbjct: 811 EAGSQASTLVSVIRKRKGLKEQMTPLSEFEDKL 843
Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome.
Beta vulgaris (taxid: 161934)
>sp|P28996|EF2_PARKE Elongation factor 2 OS=Parachlorella kessleri PE=2 SV=1 Back     alignment and function description
>sp|O14460|EF2_SCHPO Elongation factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eft201 PE=1 SV=2 Back     alignment and function description
>sp|P29691|EF2_CAEEL Elongation factor 2 OS=Caenorhabditis elegans GN=eef-2 PE=1 SV=4 Back     alignment and function description
>sp|Q23716|EF2_CRYPV Elongation factor 2 OS=Cryptosporidium parvum PE=3 SV=1 Back     alignment and function description
>sp|Q96X45|EF2_NEUCR Elongation factor 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-3 PE=3 SV=3 Back     alignment and function description
>sp|P13060|EF2_DROME Elongation factor 2 OS=Drosophila melanogaster GN=Ef2b PE=2 SV=4 Back     alignment and function description
>sp|P32324|EF2_YEAST Elongation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFT1 PE=1 SV=1 Back     alignment and function description
>sp|Q874B9|EF2_PICPA Elongation factor 2 OS=Komagataella pastoris GN=EFT1 PE=3 SV=1 Back     alignment and function description
>sp|Q90705|EF2_CHICK Elongation factor 2 OS=Gallus gallus GN=EEF2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query794
255565836843 eukaryotic translation elongation factor 0.972 0.915 0.908 0.0
356525774843 PREDICTED: elongation factor 2-like [Gly 0.972 0.915 0.905 0.0
356556977843 PREDICTED: elongation factor 2-like [Gly 0.972 0.915 0.905 0.0
255544686843 eukaryotic translation elongation factor 0.972 0.915 0.910 0.0
225462164843 PREDICTED: elongation factor 2-like isof 0.972 0.915 0.906 0.0
449450860843 PREDICTED: elongation factor 2-like [Cuc 0.972 0.915 0.904 0.0
388540218843 translation elongation factor 2 [Prunus 0.972 0.915 0.906 0.0
224081451843 predicted protein [Populus trichocarpa] 0.972 0.915 0.901 0.0
357966933843 elongation factor [Ziziphus jujuba] 0.972 0.915 0.904 0.0
357451779843 Elongation factor EF-2 [Medicago truncat 0.972 0.915 0.889 0.0
>gi|255565836|ref|XP_002523907.1| eukaryotic translation elongation factor, putative [Ricinus communis] gi|223536837|gb|EEF38476.1| eukaryotic translation elongation factor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1534 bits (3972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 739/813 (90%), Positives = 761/813 (93%), Gaps = 41/813 (5%)

Query: 23  GKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALKSYR 82
           GKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTD ALKS++
Sbjct: 31  GKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDEALKSFK 90

Query: 83  GERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGER 142
           GERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGER
Sbjct: 91  GERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGER 150

Query: 143 IRPVLTVNKMDRCFLELQVDGEEAYQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVA 202
           IRPVLTVNKMDRCFLELQVDGEEAYQTF +VIENANVIMATYEDPLLGD QVYPEKGTVA
Sbjct: 151 IRPVLTVNKMDRCFLELQVDGEEAYQTFSRVIENANVIMATYEDPLLGDCQVYPEKGTVA 210

Query: 203 FSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATRKWTSRNTGSPTCKRG 262
           FSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPAT+KWTS+NTGSPTCKRG
Sbjct: 211 FSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATKKWTSKNTGSPTCKRG 270

Query: 263 FVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLPASS 322
           FVQFCYEPIKQIIN CMND+KDKLWPMLQKLGVTMKS+EKELMGKALMKRVMQTWLPASS
Sbjct: 271 FVQFCYEPIKQIINTCMNDQKDKLWPMLQKLGVTMKSDEKELMGKALMKRVMQTWLPASS 330

Query: 323 ALLEMMIFHLPSPATAQKYRVENLYEGPLDDAYANAIRNCDPEGPLMLYVSKMIPASDKG 382
           ALLEMMIFHLPSPA AQ+YRVENLYEGPLDD YA AIRNCDPEGPLMLYVSKMIPASDKG
Sbjct: 331 ALLEMMIFHLPSPAKAQRYRVENLYEGPLDDPYATAIRNCDPEGPLMLYVSKMIPASDKG 390

Query: 383 RFFAFGRVFSGKVATGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGN 442
           RFFAFGRVF+GKV+TGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGN
Sbjct: 391 RFFAFGRVFAGKVSTGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGN 450

Query: 443 TVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKR 502
           TVA+VGLDQ+ITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKR
Sbjct: 451 TVALVGLDQFITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKR 510

Query: 503 LAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLE 562
           LAKSDPMVVC++EESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLE
Sbjct: 511 LAKSDPMVVCTIEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLE 570

Query: 563 KSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPK---------------- 606
           KSCR VMSKSPNKHNRLYMEARP+EEGLAEAID+GRIGPRDDPK                
Sbjct: 571 KSCRVVMSKSPNKHNRLYMEARPMEEGLAEAIDEGRIGPRDDPKARAKILSEEFGWDKDL 630

Query: 607 -------------------------YLNEIKDSVVAGFQWASKEGALAEENMRGICFEVC 641
                                    YLNEIKDSVVAGFQWASKEGALAEENMRGICFEVC
Sbjct: 631 AKKIWCFGPETTGPNMVVDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVC 690

Query: 642 DVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQ 701
           DVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQ
Sbjct: 691 DVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQ 750

Query: 702 KRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRAATSGQAFPQCVFDHWDMMSSDPL 761
           KRGHVFEE+QRPGTPLYNIKAYLPV+ESFGFS TLRAATSGQAFPQCVFDHWDMMSSDP+
Sbjct: 751 KRGHVFEELQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPM 810

Query: 762 EPGSQASQLVLDIRKRKGLKEQMTPLSEYEDKL 794
           EPGSQA+ LV +IRKRKGLKEQMTPLSE+EDKL
Sbjct: 811 EPGSQAANLVTEIRKRKGLKEQMTPLSEFEDKL 843

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356525774|ref|XP_003531498.1| PREDICTED: elongation factor 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356556977|ref|XP_003546795.1| PREDICTED: elongation factor 2-like [Glycine max] Back     alignment and taxonomy information
>gi|255544686|ref|XP_002513404.1| eukaryotic translation elongation factor, putative [Ricinus communis] gi|223547312|gb|EEF48807.1| eukaryotic translation elongation factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225462164|ref|XP_002266780.1| PREDICTED: elongation factor 2-like isoform 1 [Vitis vinifera] gi|359494453|ref|XP_003634783.1| PREDICTED: elongation factor 2-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449450860|ref|XP_004143180.1| PREDICTED: elongation factor 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388540218|gb|AFK64817.1| translation elongation factor 2 [Prunus persica] Back     alignment and taxonomy information
>gi|224081451|ref|XP_002306416.1| predicted protein [Populus trichocarpa] gi|222855865|gb|EEE93412.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357966933|gb|AET97562.1| elongation factor [Ziziphus jujuba] Back     alignment and taxonomy information
>gi|357451779|ref|XP_003596166.1| Elongation factor EF-2 [Medicago truncatula] gi|355485214|gb|AES66417.1| Elongation factor EF-2 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query794
TAIR|locus:2205235843 LOS1 "AT1G56070" [Arabidopsis 0.741 0.698 0.925 0.0
TAIR|locus:2829525820 AT3G12915 [Arabidopsis thalian 0.739 0.715 0.896 0.0
POMBASE|SPAC513.01c842 eft201 "translation elongation 0.731 0.690 0.626 1.3e-268
POMBASE|SPCP31B10.07842 eft202 "translation elongation 0.731 0.690 0.626 1.3e-268
WB|WBGene00001167852 eef-2 [Caenorhabditis elegans 0.729 0.679 0.615 1.7e-266
FB|FBgn0000559844 Ef2b "Elongation factor 2b" [D 0.738 0.694 0.608 2.5e-265
GENEDB_PFALCIPARUM|PF14_0486832 PF14_0486 "elongation factor 2 0.736 0.703 0.639 5.9e-264
UNIPROTKB|Q8IKW5832 PF14_0486 "Elongation factor 2 0.736 0.703 0.639 5.9e-264
UNIPROTKB|Q1HPK6844 tef2 "Translation elongation f 0.734 0.690 0.610 4.1e-263
SGD|S000005659842 EFT1 "Elongation factor 2 (EF- 0.730 0.688 0.618 2e-261
TAIR|locus:2205235 LOS1 "AT1G56070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2858 (1011.1 bits), Expect = 0., Sum P(2) = 0.
 Identities = 545/589 (92%), Positives = 569/589 (96%)

Query:    23 GKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALKSYR 82
             GKSTLTDSLVAAAGIIAQEVAGDVRMTDTR DEAERGITIKSTGISLYYEMTD +LKS+ 
Sbjct:    31 GKSTLTDSLVAAAGIIAQEVAGDVRMTDTRADEAERGITIKSTGISLYYEMTDESLKSFT 90

Query:    83 GERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGER 142
             G R GNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGER
Sbjct:    91 GARDGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGER 150

Query:   143 IRPVLTVNKMDRCFLELQVDGEEAYQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVA 202
             IRPVLTVNKMDRCFLELQVDGEEAYQTF +VIENANVIMATYEDPLLGDVQVYPEKGTVA
Sbjct:   151 IRPVLTVNKMDRCFLELQVDGEEAYQTFSRVIENANVIMATYEDPLLGDVQVYPEKGTVA 210

Query:   203 FSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATRKWTSRNTGSPTCKRG 262
             FSAGLHGWAFTLTNFAKMYASKFGV ESKMMERLWGENFFDPATRKW+ +NTGSPTCKRG
Sbjct:   211 FSAGLHGWAFTLTNFAKMYASKFGVVESKMMERLWGENFFDPATRKWSGKNTGSPTCKRG 270

Query:   263 FVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLPASS 322
             FVQFCYEPIKQII  CMND+KDKLWPML KLGV+MK++EKELMGK LMKRVMQTWLPAS+
Sbjct:   271 FVQFCYEPIKQIIATCMNDQKDKLWPMLAKLGVSMKNDEKELMGKPLMKRVMQTWLPAST 330

Query:   323 ALLEMMIFHLPSPATAQKYRVENLYEGPLDDAYANAIRNCDPEGPLMLYVSKMIPASDKG 382
             ALLEMMIFHLPSP TAQ+YRVENLYEGPLDD YANAIRNCDP GPLMLYVSKMIPASDKG
Sbjct:   331 ALLEMMIFHLPSPHTAQRYRVENLYEGPLDDQYANAIRNCDPNGPLMLYVSKMIPASDKG 390

Query:   383 RFFAFGRVFSGKVATGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGN 442
             RFFAFGRVF+GKV+TG+KVRIMGPNY+PGEKKDLY KSVQRTVIWMGK+QETVEDVPCGN
Sbjct:   391 RFFAFGRVFAGKVSTGMKVRIMGPNYIPGEKKDLYTKSVQRTVIWMGKRQETVEDVPCGN 450

Query:   443 TVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKR 502
             TVAMVGLDQ+ITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKR
Sbjct:   451 TVAMVGLDQFITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKR 510

Query:   503 LAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLE 562
             LAKSDPMVVC+MEESGEHI+AGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETV +
Sbjct:   511 LAKSDPMVVCTMEESGEHIVAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVCD 570

Query:   563 KSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPKYLNEI 611
             +S RTVMSKSPNKHNRLYMEARP+EEGLAEAIDDGRIGPRDDPK  ++I
Sbjct:   571 RSTRTVMSKSPNKHNRLYMEARPMEEGLAEAIDDGRIGPRDDPKIRSKI 619
GO:0003746 "translation elongation factor activity" evidence=ISS
GO:0003924 "GTPase activity" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008135 "translation factor activity, nucleic acid binding" evidence=ISS
GO:0009409 "response to cold" evidence=IMP
GO:0005730 "nucleolus" evidence=IDA
GO:0005507 "copper ion binding" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
TAIR|locus:2829525 AT3G12915 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPAC513.01c eft201 "translation elongation factor 2 (EF-2) Eft2,A" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
POMBASE|SPCP31B10.07 eft202 "translation elongation factor 2 (EF-2) Eft2,B" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
WB|WBGene00001167 eef-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0000559 Ef2b "Elongation factor 2b" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF14_0486 PF14_0486 "elongation factor 2" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IKW5 PF14_0486 "Elongation factor 2" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|Q1HPK6 tef2 "Translation elongation factor 2" [Bombyx mori (taxid:7091)] Back     alignment and assigned GO terms
SGD|S000005659 EFT1 "Elongation factor 2 (EF-2), also encoded by EFT2" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q58448EF2_METJANo assigned EC number0.34400.81360.8898yesno
P09445EF2_CRIGRNo assigned EC number0.59610.96720.8951yesno
A5ULM6EF2_METS3No assigned EC number0.32960.82610.8986yesno
Q875S0EF2_LACK1No assigned EC number0.59190.96720.9121N/Ano
Q975H5EF2_SULTONo assigned EC number0.32920.83620.9009yesno
A8ACA7EF2_IGNH4No assigned EC number0.33290.82490.8851yesno
Q874B9EF2_PICPANo assigned EC number0.58940.96720.9121yesno
P28996EF2_PARKENo assigned EC number0.76190.97220.9136N/Ano
Q06193EF2_ENTHINo assigned EC number0.55700.96590.9130N/Ano
Q5R8Z3EF2_PONABNo assigned EC number0.59610.96720.8951yesno
Q6FYA7EF2_CANGANo assigned EC number0.58330.96720.9121yesno
Q90705EF2_CHICKNo assigned EC number0.59440.96850.8962yesno
O14460EF2_SCHPONo assigned EC number0.61220.96850.9133yesno
Q3SYU2EF2_BOVINNo assigned EC number0.59730.96720.8951yesno
Q6BJ25EF2_DEBHANo assigned EC number0.58150.96850.9133yesno
Q8SQT7EF2_ENCCUNo assigned EC number0.40840.95960.8964yesno
P13060EF2_DROMENo assigned EC number0.60070.96590.9087yesno
A5DI11EF2_PICGUNo assigned EC number0.59060.96720.9121N/Ano
P13639EF2_HUMANNo assigned EC number0.59610.96720.8951yesno
P29691EF2_CAEELNo assigned EC number0.60580.96590.9002yesno
P23112EF2_SULACNo assigned EC number0.32270.82360.8873yesno
Q875Z2EF2_NAUCCNo assigned EC number0.58650.96850.9133yesno
C4YJQ8EF2_CANAWNo assigned EC number0.58210.96720.9121N/Ano
Q96X45EF2_NEUCRNo assigned EC number0.60340.96850.9111N/Ano
A4WMR8EF2_PYRARNo assigned EC number0.33290.83120.8918yesno
Q6CPQ9EF2_KLULANo assigned EC number0.57910.96850.9133yesno
Q754C8EF2_ASHGONo assigned EC number0.57910.96850.9133yesno
Q1HPK6EF2_BOMMONo assigned EC number0.59580.96590.9087N/Ano
Q17152EF2_BLAHONo assigned EC number0.54400.96850.8869N/Ano
P58252EF2_MOUSENo assigned EC number0.59610.96720.8951yesno
A7I4X4EF2_METB6No assigned EC number0.34280.82990.9015yesno
P05197EF2_RATNo assigned EC number0.59730.96720.8951yesno
A0SXL6EF2_CALJANo assigned EC number0.59730.96720.8951yesno
P15112EF2_DICDINo assigned EC number0.58080.96340.9117yesno
O27131EF2_METTHNo assigned EC number0.32410.81230.8835yesno
P32324EF2_YEASTNo assigned EC number0.59430.96720.9121yesno
Q5A0M4EF2_CANALNo assigned EC number0.58210.96720.9121N/Ano
O23755EF2_BETVUNo assigned EC number0.87690.97220.9157N/Ano
O28385EF2_ARCFUNo assigned EC number0.33620.81480.8887yesno
Q23716EF2_CRYPVNo assigned EC number0.60630.95840.9146yesno
A3DMV6EF2_STAMFNo assigned EC number0.33620.82610.8913yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00050364
translation elongation factor EF-2 subunit (844 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.II.2147.1
hypothetical protein; Required for the methylation step in diphthamide biosynthesis (By similar [...] (274 aa)
  • • • 0.768
eugene3.01500038
aminoacyl-tRNA ligase (EC-6.1.1.4) (1068 aa)
  •   • 0.668
estExt_fgenesh4_pm.C_LG_VIII0253
RecName- Full=60S acidic ribosomal protein P0; (323 aa)
  •• •• 0.657
eugene3.00860050
aminoacyl-tRNA ligase (EC-6.1.1.4) (1087 aa)
  •   • 0.648
estExt_fgenesh4_pg.C_LG_X1707
RecName- Full=60S acidic ribosomal protein P0; (321 aa)
  •• •• 0.639
gw1.IV.3113.1
hypothetical protein (690 aa)
• •   • 0.612
estExt_Genewise1_v1.C_LG_IV3101
hypothetical protein (421 aa)
• •   • 0.564
gw1.122.137.1
annotation not avaliable (183 aa)
  ••  • 0.545
estExt_Genewise1_v1.C_LG_XV1096
hypothetical protein (191 aa)
  ••  • 0.508
estExt_fgenesh4_kg.C_LG_IV0028
RecName- Full=Ribosomal protein L19; (211 aa)
  ••  • 0.507

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query794
PLN00116843 PLN00116, PLN00116, translation elongation factor 0.0
PTZ00416836 PTZ00416, PTZ00416, elongation factor 2; Provision 0.0
PRK07560731 PRK07560, PRK07560, elongation factor EF-2; Review 0.0
COG0480697 COG0480, FusA, Translation elongation factors (GTP 0.0
TIGR00490720 TIGR00490, aEF-2, translation elongation factor aE 1e-152
cd01885218 cd01885, EF2, Elongation Factor 2 (EF2) in archaea 1e-109
cd01681177 cd01681, aeEF2_snRNP_like_IV, This family represen 1e-67
cd04167213 cd04167, Snu114p, Snu114p, a spliceosome protein, 4e-51
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 1e-47
cd0409680 cd04096, eEF2_snRNP_like_C, eEF2_snRNP_like_C: thi 8e-47
cd01683178 cd01683, EF2_IV_snRNP, EF-2_domain IV_snRNP domain 6e-43
PRK12740668 PRK12740, PRK12740, elongation factor G; Reviewed 5e-40
cd00881183 cd00881, GTP_translation_factor, GTP translation f 7e-40
cd0370093 cd03700, eEF2_snRNP_like_II, EF2_snRNP_like_II: th 5e-39
PRK13351687 PRK13351, PRK13351, elongation factor G; Reviewed 1e-38
PRK12739691 PRK12739, PRK12739, elongation factor G; Reviewed 1e-34
TIGR00484689 TIGR00484, EF-G, translation elongation factor EF- 2e-33
cd0409880 cd04098, eEF2_C_snRNP, eEF2_C_snRNP: This family i 2e-31
cd01890179 cd01890, LepA, LepA also known as Elongation Facto 4e-29
cd0151479 cd01514, Elongation_Factor_C, Elongation factor G 4e-29
PRK00007693 PRK00007, PRK00007, elongation factor G; Reviewed 1e-27
cd01891194 cd01891, TypA_BipA, Tyrosine phosphorylated protei 3e-27
cd01886270 cd01886, EF-G, Elongation factor G (EF-G) family i 3e-26
cd04168237 cd04168, TetM_like, Tet(M)-like family includes Te 5e-25
PRK12740668 PRK12740, PRK12740, elongation factor G; Reviewed 1e-24
PRK13351687 PRK13351, PRK13351, elongation factor G; Reviewed 3e-24
pfam0067989 pfam00679, EFG_C, Elongation factor G C-terminus 3e-24
TIGR01394594 TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip 1e-23
pfam03764120 pfam03764, EFG_IV, Elongation factor G, domain IV 1e-22
COG1217603 COG1217, TypA, Predicted membrane GTPase involved 4e-22
TIGR01393595 TIGR01393, lepA, GTP-binding protein LepA 5e-21
PRK05433600 PRK05433, PRK05433, GTP-binding protein LepA; Prov 9e-21
cd0409094 cd04090, eEF2_II_snRNP, Loc2 eEF2_C_snRNP, cd01514 9e-21
COG0481603 COG0481, LepA, Membrane GTPase LepA [Cell envelope 2e-20
cd04170268 cd04170, EF-G_bact, Elongation factor G (EF-G) fam 4e-20
TIGR00484689 TIGR00484, EF-G, translation elongation factor EF- 5e-20
smart0083885 smart00838, EFG_C, Elongation factor G C-terminus 5e-20
PRK12739691 PRK12739, PRK12739, elongation factor G; Reviewed 8e-20
PRK00007693 PRK00007, PRK00007, elongation factor G; Reviewed 6e-18
PRK10218607 PRK10218, PRK10218, GTP-binding protein; Provision 1e-16
smart00889120 smart00889, EFG_IV, Elongation factor G, domain IV 3e-16
cd04169268 cd04169, RF3, Release Factor 3 (RF3) protein invol 1e-15
COG4108528 COG4108, PrfC, Peptide chain release factor RF-3 [ 4e-14
cd0371378 cd03713, EFG_mtEFG_C, EFG_mtEFG_C: domains similar 6e-14
cd01680116 cd01680, EFG_like_IV, Elongation Factor G-like dom 2e-12
PRK00741526 PRK00741, prfC, peptide chain release factor 3; Pr 1e-10
TIGR00503527 TIGR00503, prfC, peptide chain release factor 3 4e-10
COG3276447 COG3276, SelB, Selenocysteine-specific translation 9e-09
TIGR00475581 TIGR00475, selB, selenocysteine-specific elongatio 2e-08
pfam0314470 pfam03144, GTP_EFTU_D2, Elongation factor Tu domai 2e-07
cd01889192 cd01889, SelB_euk, SelB, the dedicated elongation 7e-07
cd0409778 cd04097, mtEFG1_C, mtEFG1_C: C-terminus of mitocho 1e-06
cd0371178 cd03711, Tet_C, Tet_C: C-terminus of ribosomal pro 1e-06
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 1e-06
TIGR00483426 TIGR00483, EF-1_alpha, translation elongation fact 1e-06
cd04171170 cd04171, SelB, SelB, the dedicated elongation fact 2e-06
cd0134283 cd01342, Translation_Factor_II_like, Translation_F 3e-06
cd04166209 cd04166, CysN_ATPS, CysN, together with protein Cy 1e-05
cd01884195 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-b 4e-05
PRK12317425 PRK12317, PRK12317, elongation factor 1-alpha; Rev 7e-05
cd0408883 cd04088, EFG_mtEFG_II, EFG_mtEFG_II: this subfamil 9e-05
cd01887169 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ euk 1e-04
TIGR01394594 TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip 2e-04
COG1217603 COG1217, TypA, Predicted membrane GTPase involved 2e-04
COG5256428 COG5256, TEF1, Translation elongation factor EF-1a 2e-04
COG0050394 COG0050, TufB, GTPases - translation elongation fa 2e-04
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 3e-04
TIGR03680406 TIGR03680, eif2g_arch, translation initiation fact 4e-04
PLN03126478 PLN03126, PLN03126, Elongation factor Tu; Provisio 7e-04
TIGR00487587 TIGR00487, IF-2, translation initiation factor IF- 7e-04
cd01883219 cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1 0.001
CHL00189742 CHL00189, infB, translation initiation factor 2; P 0.002
PRK10218607 PRK10218, PRK10218, GTP-binding protein; Provision 0.003
>gnl|CDD|177730 PLN00116, PLN00116, translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information 
 Score = 1731 bits (4485), Expect = 0.0
 Identities = 729/813 (89%), Positives = 752/813 (92%), Gaps = 41/813 (5%)

Query: 23  GKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALKSYR 82
           GKSTLTDSLVAAAGIIAQEVAGDVRMTDTR DEAERGITIKSTGISLYYEMTD +LK ++
Sbjct: 31  GKSTLTDSLVAAAGIIAQEVAGDVRMTDTRADEAERGITIKSTGISLYYEMTDESLKDFK 90

Query: 83  GERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGER 142
           GER GNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGER
Sbjct: 91  GERDGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGER 150

Query: 143 IRPVLTVNKMDRCFLELQVDGEEAYQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVA 202
           IRPVLTVNKMDRCFLELQVDGEEAYQTF +VIENANVIMATYEDPLLGDVQVYPEKGTVA
Sbjct: 151 IRPVLTVNKMDRCFLELQVDGEEAYQTFSRVIENANVIMATYEDPLLGDVQVYPEKGTVA 210

Query: 203 FSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATRKWTSRNTGSPTCKRG 262
           FSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPAT+KWT++NTGSPTCKRG
Sbjct: 211 FSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATKKWTTKNTGSPTCKRG 270

Query: 263 FVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLPASS 322
           FVQFCYEPIKQIIN CMND+KDKLWPML+KLGVT+KS+EKELMGKALMKRVMQTWLPAS 
Sbjct: 271 FVQFCYEPIKQIINTCMNDQKDKLWPMLEKLGVTLKSDEKELMGKALMKRVMQTWLPASD 330

Query: 323 ALLEMMIFHLPSPATAQKYRVENLYEGPLDDAYANAIRNCDPEGPLMLYVSKMIPASDKG 382
           ALLEM+IFHLPSPA AQ+YRVENLYEGPLDD YA AIRNCDP GPLMLYVSKMIPASDKG
Sbjct: 331 ALLEMIIFHLPSPAKAQRYRVENLYEGPLDDKYATAIRNCDPNGPLMLYVSKMIPASDKG 390

Query: 383 RFFAFGRVFSGKVATGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGN 442
           RFFAFGRVFSG VATG+KVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQE+VEDVPCGN
Sbjct: 391 RFFAFGRVFSGTVATGMKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQESVEDVPCGN 450

Query: 443 TVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKR 502
           TVAMVGLDQ+ITKNATLTNEKEVDAHPI+AMKFSVSPVVRVAVQCK ASDLPKLVEGLKR
Sbjct: 451 TVAMVGLDQFITKNATLTNEKEVDAHPIKAMKFSVSPVVRVAVQCKNASDLPKLVEGLKR 510

Query: 503 LAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLE 562
           LAKSDPMV C++EESGEHIIAGAGELHLEICLKDLQDDFMGGAEI  SDPVVSFRETVLE
Sbjct: 511 LAKSDPMVQCTIEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIKVSDPVVSFRETVLE 570

Query: 563 KSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPK---------------- 606
           KSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPK                
Sbjct: 571 KSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPKIRSKILAEEFGWDKDL 630

Query: 607 -------------------------YLNEIKDSVVAGFQWASKEGALAEENMRGICFEVC 641
                                    YLNEIKDSVVAGFQWA+KEGALAEENMRGICFEVC
Sbjct: 631 AKKIWCFGPETTGPNMVVDMCKGVQYLNEIKDSVVAGFQWATKEGALAEENMRGICFEVC 690

Query: 642 DVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQ 701
           DVVLHADAIHRGGGQ+IPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQ
Sbjct: 691 DVVLHADAIHRGGGQIIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQ 750

Query: 702 KRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRAATSGQAFPQCVFDHWDMMSSDPL 761
           KRGHVFEEMQRPGTPLYNIKAYLPV+ESFGFS TLRAATSGQAFPQCVFDHWDMMSSDPL
Sbjct: 751 KRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPL 810

Query: 762 EPGSQASQLVLDIRKRKGLKEQMTPLSEYEDKL 794
           E GSQA+QLV DIRKRKGLKEQM PLSEYEDKL
Sbjct: 811 EAGSQAAQLVADIRKRKGLKEQMPPLSEYEDKL 843

Length = 843
>gnl|CDD|240409 PTZ00416, PTZ00416, elongation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed Back     alignment and domain information
>gnl|CDD|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129581 TIGR00490, aEF-2, translation elongation factor aEF-2 Back     alignment and domain information
>gnl|CDD|206672 cd01885, EF2, Elongation Factor 2 (EF2) in archaea and eukarya Back     alignment and domain information
>gnl|CDD|238839 cd01681, aeEF2_snRNP_like_IV, This family represents domain IV of archaeal and eukaryotic elongation factor 2 (aeEF-2) and of an evolutionarily conserved U5 snRNP-specific protein Back     alignment and domain information
>gnl|CDD|206730 cd04167, Snu114p, Snu114p, a spliceosome protein, is a GTPase Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|239763 cd04096, eEF2_snRNP_like_C, eEF2_snRNP_like_C: this family represents a C-terminal domain of eukaryotic elongation factor 2 (eEF-2) and a homologous domain of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>gnl|CDD|238840 cd01683, EF2_IV_snRNP, EF-2_domain IV_snRNP domain is a part of 116kD U5-specific protein of the U5 small nucleoprotein (snRNP) particle, essential component of the spliceosome Back     alignment and domain information
>gnl|CDD|237186 PRK12740, PRK12740, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|239671 cd03700, eEF2_snRNP_like_II, EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>gnl|CDD|237358 PRK13351, PRK13351, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|237185 PRK12739, PRK12739, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G Back     alignment and domain information
>gnl|CDD|239765 cd04098, eEF2_C_snRNP, eEF2_C_snRNP: This family includes a C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>gnl|CDD|206677 cd01890, LepA, LepA also known as Elongation Factor 4 (EF4) Back     alignment and domain information
>gnl|CDD|238772 cd01514, Elongation_Factor_C, Elongation factor G C-terminus Back     alignment and domain information
>gnl|CDD|234569 PRK00007, PRK00007, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|206678 cd01891, TypA_BipA, Tyrosine phosphorylated protein A (TypA)/BipA family belongs to ribosome-binding GTPases Back     alignment and domain information
>gnl|CDD|206673 cd01886, EF-G, Elongation factor G (EF-G) family involved in both the elongation and ribosome recycling phases of protein synthesis Back     alignment and domain information
>gnl|CDD|206731 cd04168, TetM_like, Tet(M)-like family includes Tet(M), Tet(O), Tet(W), and OtrA, containing tetracycline resistant proteins Back     alignment and domain information
>gnl|CDD|237186 PRK12740, PRK12740, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|237358 PRK13351, PRK13351, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|201388 pfam00679, EFG_C, Elongation factor G C-terminus Back     alignment and domain information
>gnl|CDD|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA Back     alignment and domain information
>gnl|CDD|202760 pfam03764, EFG_IV, Elongation factor G, domain IV Back     alignment and domain information
>gnl|CDD|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA Back     alignment and domain information
>gnl|CDD|235462 PRK05433, PRK05433, GTP-binding protein LepA; Provisional Back     alignment and domain information
>gnl|CDD|239757 cd04090, eEF2_II_snRNP, Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>gnl|CDD|223557 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|206733 cd04170, EF-G_bact, Elongation factor G (EF-G) family Back     alignment and domain information
>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G Back     alignment and domain information
>gnl|CDD|197906 smart00838, EFG_C, Elongation factor G C-terminus Back     alignment and domain information
>gnl|CDD|237185 PRK12739, PRK12739, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|234569 PRK00007, PRK00007, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|104396 PRK10218, PRK10218, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|214887 smart00889, EFG_IV, Elongation factor G, domain IV Back     alignment and domain information
>gnl|CDD|206732 cd04169, RF3, Release Factor 3 (RF3) protein involved in the terminal step of translocation in bacteria Back     alignment and domain information
>gnl|CDD|226593 COG4108, PrfC, Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|239683 cd03713, EFG_mtEFG_C, EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G Back     alignment and domain information
>gnl|CDD|238838 cd01680, EFG_like_IV, Elongation Factor G-like domain IV Back     alignment and domain information
>gnl|CDD|179105 PRK00741, prfC, peptide chain release factor 3; Provisional Back     alignment and domain information
>gnl|CDD|129594 TIGR00503, prfC, peptide chain release factor 3 Back     alignment and domain information
>gnl|CDD|225815 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB Back     alignment and domain information
>gnl|CDD|217388 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 Back     alignment and domain information
>gnl|CDD|206676 cd01889, SelB_euk, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|239764 cd04097, mtEFG1_C, mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>gnl|CDD|239682 cd03711, Tet_C, Tet_C: C-terminus of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|129574 TIGR00483, EF-1_alpha, translation elongation factor EF-1 alpha Back     alignment and domain information
>gnl|CDD|206734 cd04171, SelB, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|238652 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>gnl|CDD|206729 cd04166, CysN_ATPS, CysN, together with protein CysD, forms the ATP sulfurylase (ATPS) complex Back     alignment and domain information
>gnl|CDD|206671 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-binding proteins Back     alignment and domain information
>gnl|CDD|237055 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed Back     alignment and domain information
>gnl|CDD|239755 cd04088, EFG_mtEFG_II, EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes Back     alignment and domain information
>gnl|CDD|206674 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ eukaryotic Initiation Factor 5B (eIF5B) family Back     alignment and domain information
>gnl|CDD|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA Back     alignment and domain information
>gnl|CDD|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|223128 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|211860 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma Back     alignment and domain information
>gnl|CDD|215592 PLN03126, PLN03126, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|232995 TIGR00487, IF-2, translation initiation factor IF-2 Back     alignment and domain information
>gnl|CDD|206670 cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1-alpha) protein family Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|104396 PRK10218, PRK10218, GTP-binding protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 794
KOG0469842 consensus Elongation factor 2 [Translation, riboso 100.0
PLN00116843 translation elongation factor EF-2 subunit; Provis 100.0
PTZ00416836 elongation factor 2; Provisional 100.0
COG0480697 FusA Translation elongation factors (GTPases) [Tra 100.0
KOG0468971 consensus U5 snRNP-specific protein [Translation, 100.0
KOG0465721 consensus Mitochondrial elongation factor [Transla 100.0
PRK07560731 elongation factor EF-2; Reviewed 100.0
KOG0467887 consensus Translation elongation factor 2/ribosome 100.0
TIGR00490720 aEF-2 translation elongation factor aEF-2. This mo 100.0
PRK12739691 elongation factor G; Reviewed 100.0
PRK00007693 elongation factor G; Reviewed 100.0
TIGR00484689 EF-G translation elongation factor EF-G. After pep 100.0
PRK13351687 elongation factor G; Reviewed 100.0
PRK12740668 elongation factor G; Reviewed 100.0
KOG0464753 consensus Elongation factor G [Translation, riboso 100.0
TIGR01394594 TypA_BipA GTP-binding protein TypA/BipA. This bact 100.0
PRK10218607 GTP-binding protein; Provisional 100.0
PRK05433600 GTP-binding protein LepA; Provisional 100.0
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 100.0
COG1217603 TypA Predicted membrane GTPase involved in stress 100.0
KOG0462650 consensus Elongation factor-type GTP-binding prote 100.0
PRK00741526 prfC peptide chain release factor 3; Provisional 100.0
TIGR00503527 prfC peptide chain release factor 3. This translat 100.0
COG0481603 LepA Membrane GTPase LepA [Cell envelope biogenesi 100.0
COG4108528 PrfC Peptide chain release factor RF-3 [Translatio 100.0
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 100.0
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 100.0
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 100.0
CHL00071409 tufA elongation factor Tu 100.0
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 100.0
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 100.0
PRK12736394 elongation factor Tu; Reviewed 100.0
PLN00043447 elongation factor 1-alpha; Provisional 100.0
PRK12735396 elongation factor Tu; Reviewed 99.98
PLN03126478 Elongation factor Tu; Provisional 99.98
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.98
PTZ00141446 elongation factor 1- alpha; Provisional 99.98
TIGR00485394 EF-Tu translation elongation factor TU. This align 99.97
KOG0460449 consensus Mitochondrial translation elongation fac 99.97
PRK00049396 elongation factor Tu; Reviewed 99.97
PRK05306787 infB translation initiation factor IF-2; Validated 99.97
PLN03127447 Elongation factor Tu; Provisional 99.97
COG0050394 TufB GTPases - translation elongation factors [Tra 99.97
PRK12317425 elongation factor 1-alpha; Reviewed 99.97
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 99.97
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.96
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 99.96
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 99.96
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 99.96
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 99.96
KOG0458603 consensus Elongation factor 1 alpha [Translation, 99.95
CHL00189742 infB translation initiation factor 2; Provisional 99.95
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 99.95
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.94
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 99.94
cd01683178 EF2_IV_snRNP EF-2_domain IV_snRNP domain is a part 99.94
PRK04000411 translation initiation factor IF-2 subunit gamma; 99.93
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.93
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 99.93
COG5257415 GCD11 Translation initiation factor 2, gamma subun 99.92
TIGR00475581 selB selenocysteine-specific elongation factor Sel 99.91
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 99.91
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.9
KOG1145683 consensus Mitochondrial translation initiation fac 99.9
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 99.9
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.89
COG3276447 SelB Selenocysteine-specific translation elongatio 99.89
COG5258527 GTPBP1 GTPase [General function prediction only] 99.88
cd01681177 aeEF2_snRNP_like_IV This family represents domain 99.87
cd0409880 eEF2_C_snRNP eEF2_C_snRNP: This family includes a 99.87
PRK04004586 translation initiation factor IF-2; Validated 99.86
KOG0459501 consensus Polypeptide release factor 3 [Translatio 99.86
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.83
smart0083885 EFG_C Elongation factor G C-terminus. This domain 99.83
PF0067989 EFG_C: Elongation factor G C-terminus; InterPro: I 99.83
KOG0461522 consensus Selenocysteine-specific elongation facto 99.82
cd0409680 eEF2_snRNP_like_C eEF2_snRNP_like_C: this family r 99.82
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.81
cd0409778 mtEFG1_C mtEFG1_C: C-terminus of mitochondrial Elo 99.81
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.81
PF1449275 EFG_II: Elongation Factor G, domain II; PDB: 1WDT_ 99.8
cd0371178 Tet_C Tet_C: C-terminus of ribosomal protection pr 99.8
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.8
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.8
cd0371378 EFG_mtEFG_C EFG_mtEFG_C: domains similar to the C- 99.79
cd0371079 BipA_TypA_C BipA_TypA_C: a C-terminal portion of B 99.78
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.78
cd0151479 Elongation_Factor_C Elongation factor G C-terminus 99.77
cd0370980 lepA_C lepA_C: This family represents the C-termin 99.76
cd00881189 GTP_translation_factor GTP translation factor fami 99.73
PF03764120 EFG_IV: Elongation factor G, domain IV; InterPro: 99.72
cd0409094 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C termina 99.7
KOG0463641 consensus GTP-binding protein GP-1 [General functi 99.69
PRK148451049 translation initiation factor IF-2; Provisional 99.68
cd01684115 Tet_like_IV EF-G_domain IV_RPP domain is a part of 99.68
cd0369085 Tet_II Tet_II: This subfamily represents domain II 99.66
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.66
cd0409283 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondri 99.6
cd01680116 EFG_like_IV Elongation Factor G-like domain IV. Th 99.59
cd0370093 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfami 99.57
cd0368985 RF3_II RF3_II: this subfamily represents the domai 99.57
cd0408883 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represen 99.56
COG1160444 Predicted GTPases [General function prediction onl 99.56
PRK00093435 GTP-binding protein Der; Reviewed 99.55
KOG1143591 consensus Predicted translation elongation factor 99.55
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.55
cd0409181 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondri 99.54
cd01434116 EFG_mtEFG1_IV EFG_mtEFG1_IV: domains similar to do 99.53
cd01693120 mtEFG2_like_IV mtEF-G2 domain IV. This subfamily i 99.53
KOG11441064 consensus Translation initiation factor 5B (eIF-5B 99.53
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.52
cd0369186 BipA_TypA_II BipA_TypA_II: domain II of BipA (also 99.49
COG1159298 Era GTPase [General function prediction only] 99.49
KOG0466466 consensus Translation initiation factor 2, gamma s 99.48
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.47
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.45
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.45
cd0369986 lepA_II lepA_II: This subfamily represents the dom 99.43
PRK03003472 GTP-binding protein Der; Reviewed 99.43
PRK09554772 feoB ferrous iron transport protein B; Reviewed 99.41
PRK15494339 era GTPase Era; Provisional 99.41
COG1160444 Predicted GTPases [General function prediction onl 99.41
COG2229187 Predicted GTPase [General function prediction only 99.4
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.39
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.38
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.37
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.35
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.35
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.34
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.33
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.33
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.33
PRK00093435 GTP-binding protein Der; Reviewed 99.32
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.32
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.32
PRK03003472 GTP-binding protein Der; Reviewed 99.32
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.31
PRK00089292 era GTPase Era; Reviewed 99.31
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.3
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.3
cd04105203 SR_beta Signal recognition particle receptor, beta 99.3
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.29
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.29
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.28
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.28
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.28
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.28
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.27
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.27
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.27
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.27
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.27
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.26
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.26
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.25
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.25
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.25
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.24
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.23
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.23
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.22
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.22
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.22
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.22
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.22
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.22
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.22
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.21
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.21
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.21
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.21
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.2
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.2
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.2
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.2
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.19
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.19
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.19
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.18
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.18
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.18
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.18
PTZ00369189 Ras-like protein; Provisional 99.18
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.18
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.17
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.17
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.17
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.17
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.17
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.17
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.16
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.16
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.16
PLN03118211 Rab family protein; Provisional 99.16
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.16
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.15
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.15
PLN00223181 ADP-ribosylation factor; Provisional 99.15
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.15
PRK04213201 GTP-binding protein; Provisional 99.15
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.14
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 99.14
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.14
COG0218200 Predicted GTPase [General function prediction only 99.14
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.13
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.13
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.13
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.13
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.12
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.12
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.12
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.12
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.12
COG0486454 ThdF Predicted GTPase [General function prediction 99.12
KOG0052391 consensus Translation elongation factor EF-1 alpha 99.11
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.1
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.1
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.1
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.1
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.1
PTZ00133182 ADP-ribosylation factor; Provisional 99.1
PLN03110216 Rab GTPase; Provisional 99.09
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.09
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.08
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.08
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.08
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.08
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.07
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.07
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.07
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.07
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.06
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.06
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.06
PRK12298390 obgE GTPase CgtA; Reviewed 99.05
PLN03108210 Rab family protein; Provisional 99.05
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.04
PRK12299335 obgE GTPase CgtA; Reviewed 99.04
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.04
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.03
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.02
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.02
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.02
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.02
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.01
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.01
PRK11058426 GTPase HflX; Provisional 99.0
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.0
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.0
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.0
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.0
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.0
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 98.99
KOG0095213 consensus GTPase Rab30, small G protein superfamil 98.99
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 98.99
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 98.98
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 98.98
KOG0080209 consensus GTPase Rab18, small G protein superfamil 98.97
PF00025175 Arf: ADP-ribosylation factor family The prints ent 98.97
KOG0394210 consensus Ras-related GTPase [General function pre 98.97
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 98.97
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 98.96
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 98.95
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 98.95
TIGR00437591 feoB ferrous iron transporter FeoB. FeoB (773 amin 98.93
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 98.93
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 98.92
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 98.91
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 98.9
PLN00023334 GTP-binding protein; Provisional 98.9
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.9
KOG0098216 consensus GTPase Rab2, small G protein superfamily 98.89
PRK12296500 obgE GTPase CgtA; Reviewed 98.89
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 98.88
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 98.87
PRK12297424 obgE GTPase CgtA; Reviewed 98.87
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 98.86
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 98.83
COG1084346 Predicted GTPase [General function prediction only 98.83
COG3596296 Predicted GTPase [General function prediction only 98.81
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 98.8
COG1100219 GTPase SAR1 and related small G proteins [General 98.76
KOG0078207 consensus GTP-binding protein SEC4, small G protei 98.76
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 98.71
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 98.71
PRK09866741 hypothetical protein; Provisional 98.7
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 98.69
KOG0088218 consensus GTPase Rab21, small G protein superfamil 98.68
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 98.68
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 98.67
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 98.66
KOG0087222 consensus GTPase Rab11/YPT3, small G protein super 98.66
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 98.64
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 98.63
KOG0086214 consensus GTPase Rab4, small G protein superfamily 98.62
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 98.62
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 98.61
PF0314474 GTP_EFTU_D2: Elongation factor Tu domain 2; InterP 98.6
KOG0090238 consensus Signal recognition particle receptor, be 98.57
COG0370653 FeoB Fe2+ transport system protein B [Inorganic io 98.54
cd01896233 DRG The developmentally regulated GTP-binding prot 98.54
KOG0079198 consensus GTP-binding protein H-ray, small G prote 98.5
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 98.47
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 98.41
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 98.4
COG2262411 HflX GTPases [General function prediction only] 98.39
KOG0395196 consensus Ras-related GTPase [General function pre 98.39
TIGR02836492 spore_IV_A stage IV sporulation protein A. A compa 98.36
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 98.36
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 98.34
COG1163365 DRG Predicted GTPase [General function prediction 98.32
PRK13768253 GTPase; Provisional 98.32
KOG0093193 consensus GTPase Rab3, small G protein superfamily 98.29
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 98.29
KOG4252246 consensus GTP-binding protein [Signal transduction 98.28
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 98.27
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 98.26
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.22
PRK09435332 membrane ATPase/protein kinase; Provisional 98.18
cd0134283 Translation_Factor_II_like Translation_Factor_II_l 98.15
PTZ00099176 rab6; Provisional 98.14
KOG0077193 consensus Vesicle coat complex COPII, GTPase subun 98.13
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 98.12
KOG1489366 consensus Predicted GTP-binding protein (ODN super 98.09
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 98.08
KOG0096216 consensus GTPase Ran/TC4/GSP1 (nuclear protein tra 98.04
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 98.01
TIGR00993763 3a0901s04IAP86 chloroplast protein import componen 97.94
KOG0097215 consensus GTPase Rab14, small G protein superfamil 97.89
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 97.88
cd0369883 eRF3_II_like eRF3_II_like: domain similar to domai 97.87
COG4917148 EutP Ethanolamine utilization protein [Amino acid 97.86
KOG2486320 consensus Predicted GTPase [General function predi 97.84
cd03110179 Fer4_NifH_child This protein family's function is 97.83
cd0369391 EF1_alpha_II EF1_alpha_II: this family represents 97.82
cd03115173 SRP The signal recognition particle (SRP) mediates 97.77
PTZ00258390 GTP-binding protein; Provisional 97.75
KOG0083192 consensus GTPase Rab26/Rab37, small G protein supe 97.73
KOG3883198 consensus Ras family small GTPase [Signal transduc 97.71
cd03114148 ArgK-like The function of this protein family is u 97.71
KOG1954532 consensus Endocytosis/signaling protein EHD1 [Sign 97.7
COG0536369 Obg Predicted GTPase [General function prediction 97.69
KOG0091213 consensus GTPase Rab39, small G protein superfamil 97.69
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 97.67
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 97.66
cd02036179 MinD Bacterial cell division requires the formatio 97.64
PRK09601364 GTP-binding protein YchF; Reviewed 97.64
COG5019373 CDC3 Septin family protein [Cell division and chro 97.61
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.59
cd03112158 CobW_like The function of this protein family is u 97.59
KOG3886295 consensus GTP-binding protein [Signal transduction 97.52
TIGR00101199 ureG urease accessory protein UreG. This model rep 97.5
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 97.48
TIGR00064272 ftsY signal recognition particle-docking protein F 97.47
KOG2655366 consensus Septin family protein (P-loop GTPase) [C 97.43
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.42
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.41
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 97.41
PRK00771437 signal recognition particle protein Srp54; Provisi 97.4
PRK09602396 translation-associated GTPase; Reviewed 97.4
cd0408982 eRF3_II eRF3_II: domain II of the eukaryotic class 97.4
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 97.39
PRK10416318 signal recognition particle-docking protein FtsY; 97.39
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.36
PRK14974336 cell division protein FtsY; Provisional 97.35
KOG0072182 consensus GTP-binding ADP-ribosylation factor-like 97.33
TIGR00959428 ffh signal recognition particle protein. This mode 97.33
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 97.33
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 97.31
KOG0448749 consensus Mitofusin 1 GTPase, involved in mitochon 97.29
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 97.28
COG0523323 Putative GTPases (G3E family) [General function pr 97.28
KOG0393198 consensus Ras-related small GTPase, Rho type [Gene 97.23
KOG0081219 consensus GTPase Rab27, small G protein superfamil 97.23
PRK10867433 signal recognition particle protein; Provisional 97.17
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 97.11
KOG1673205 consensus Ras GTPases [General function prediction 97.1
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.08
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.07
cd0369487 GTPBP_II Domain II of the GP-1 family of GTPase. T 97.05
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 97.0
KOG1490620 consensus GTP-binding protein CRFG/NOG1 (ODN super 96.99
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 96.99
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 96.99
KOG1534273 consensus Putative transcription factor FET5 [Tran 96.97
PRK13849231 putative crown gall tumor protein VirC1; Provision 96.95
cd0369787 EFTU_II EFTU_II: Elongation factor Tu domain II. E 96.94
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 96.91
cd03111106 CpaE_like This protein family consists of proteins 96.9
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.89
KOG1547336 consensus Septin CDC10 and related P-loop GTPases 96.88
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.87
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 96.84
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 96.83
PRK12288347 GTPase RsgA; Reviewed 96.82
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 96.81
PHA02518211 ParA-like protein; Provisional 96.79
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 96.76
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 96.74
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 96.73
PRK09563287 rbgA GTPase YlqF; Reviewed 96.71
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 96.71
cd0369683 selB_II selB_II: this subfamily represents the dom 96.7
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 96.7
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 96.68
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 96.67
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 96.65
cd0369581 CysN_NodQ_II CysN_NodQ_II: This subfamily represen 96.61
cd03688113 eIF2_gamma_II eIF2_gamma_II: this subfamily repres 96.6
cd02032267 Bchl_like This family of proteins contains bchL an 96.59
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 96.56
COG1162301 Predicted GTPases [General function prediction onl 96.55
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 96.52
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 96.51
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 96.51
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 96.49
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.45
PRK12289352 GTPase RsgA; Reviewed 96.44
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 96.41
COG1161322 Predicted GTPases [General function prediction onl 96.37
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.37
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.34
TIGR00257204 IMPACT_YIGZ uncharacterized protein, YigZ family. 96.34
KOG0410410 consensus Predicted GTP binding protein [General f 96.32
TIGR02475341 CobW cobalamin biosynthesis protein CobW. A broade 96.26
PRK11568204 hypothetical protein; Provisional 96.18
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 96.18
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 96.15
PRK11537318 putative GTP-binding protein YjiA; Provisional 96.07
TIGR00092368 GTP-binding protein YchF. This predicted GTP-bindi 96.04
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 96.03
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 95.97
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 95.94
TIGR01281268 DPOR_bchL light-independent protochlorophyllide re 95.92
COG0012372 Predicted GTPase, probable translation factor [Tra 95.91
COG0552340 FtsY Signal recognition particle GTPase [Intracell 95.9
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein Y 95.88
PRK13796365 GTPase YqeH; Provisional 95.87
KOG1486364 consensus GTP-binding protein DRG2 (ODN superfamil 95.87
cd0369284 mtIF2_IVc mtIF2_IVc: this family represents the C2 95.81
PRK08099399 bifunctional DNA-binding transcriptional repressor 95.78
PRK13185270 chlL protochlorophyllide reductase iron-sulfur ATP 95.73
CHL00072290 chlL photochlorophyllide reductase subunit L 95.68
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 95.68
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 95.61
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 95.57
PRK10818270 cell division inhibitor MinD; Provisional 95.54
PRK00098298 GTPase RsgA; Reviewed 95.53
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 95.35
PRK13695174 putative NTPase; Provisional 95.26
PRK09563287 rbgA GTPase YlqF; Reviewed 95.15
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 95.15
TIGR01007204 eps_fam capsular exopolysaccharide family. This mo 95.09
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 95.09
cd02117212 NifH_like This family contains the NifH (iron prot 95.05
KOG0780483 consensus Signal recognition particle, subunit Srp 95.05
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 95.0
cd0370295 IF2_mtIF2_II This family represents the domain II 95.0
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 94.86
KOG2485335 consensus Conserved ATP/GTP binding protein [Gener 94.85
KOG0447980 consensus Dynamin-like GTP binding protein [Genera 94.79
cd02040270 NifH NifH gene encodes component II (iron protein) 94.6
KOG2743391 consensus Cobalamin synthesis protein [Coenzyme tr 94.55
KOG1533290 consensus Predicted GTPase [General function predi 94.53
KOG2423572 consensus Nucleolar GTPase [General function predi 94.34
KOG1491391 consensus Predicted GTP-binding protein (ODN super 94.09
PRK13232273 nifH nitrogenase reductase; Reviewed 93.97
COG3523 1188 IcmF Type VI protein secretion system component Va 93.97
KOG3887347 consensus Predicted small GTPase involved in nucle 93.76
PRK13230279 nitrogenase reductase-like protein; Reviewed 93.71
COG1618179 Predicted nucleotide kinase [Nucleotide transport 93.59
TIGR01287275 nifH nitrogenase iron protein. This model describe 93.44
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 93.3
TIGR01969251 minD_arch cell division ATPase MinD, archaeal. Thi 93.19
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 93.09
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 92.92
COG0455262 flhG Antiactivator of flagellar biosynthesis FleN, 92.92
PF0918656 DUF1949: Domain of unknown function (DUF1949); Int 92.62
KOG2484435 consensus GTPase [General function prediction only 92.5
PRK12289352 GTPase RsgA; Reviewed 92.49
cd0370195 IF2_IF5B_II IF2_IF5B_II: This family represents th 92.37
PRK01889356 GTPase RsgA; Reviewed 92.35
PRK13235274 nifH nitrogenase reductase; Reviewed 92.31
KOG1424562 consensus Predicted GTP-binding protein MMR1 [Gene 92.16
PF1355562 AAA_29: P-loop containing region of AAA domain 92.14
KOG4423229 consensus GTP-binding protein-like, RAS superfamil 92.13
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 92.11
KOG0082354 consensus G-protein alpha subunit (small G protein 92.06
KOG3022300 consensus Predicted ATPase, nucleotide-binding [Ce 91.97
TIGR01968261 minD_bact septum site-determining protein MinD. Th 91.72
cd03703110 aeIF5B_II aeIF5B_II: This family represents the do 91.68
PRK01889356 GTPase RsgA; Reviewed 91.56
COG1149284 MinD superfamily P-loop ATPase containing an inser 91.49
PRK00098298 GTPase RsgA; Reviewed 91.28
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 91.22
cd02034116 CooC The accessory protein CooC, which contains a 91.14
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 91.0
CHL00175281 minD septum-site determining protein; Validated 90.97
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 90.83
KOG2484435 consensus GTPase [General function prediction only 90.73
>KOG0469 consensus Elongation factor 2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=6.4e-165  Score=1294.01  Aligned_cols=780  Identities=66%  Similarity=1.072  Sum_probs=754.6

Q ss_pred             EEEEEcccccCCCCChhHHHHHHHHHcCCcccccCCceeecCChhhHhhhCcccccceEEEEeecchhhhhccccccCCC
Q 003804            9 ISVCLGPDANSTFAGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALKSYRGERQGN   88 (794)
Q Consensus         9 ~~v~i~~~vG~~~~GKTTL~~~Ll~~~g~i~~~~~G~~~~~D~~~~E~~rgiTi~~~~~~~~~~~~~~~~~~~~~~~~~~   88 (794)
                      .|..+   ++|+|||||||+++|...+|+|+...+|++|++|++.+||+|||||+++.+++.|..+..-++.+....+++
T Consensus        20 RNmSV---IAHVDHGKSTLTDsLV~kAgIis~akaGe~Rf~DtRkDEQeR~iTIKStAISl~~e~~~~dl~~~k~~~d~~   96 (842)
T KOG0469|consen   20 RNMSV---IAHVDHGKSTLTDSLVQKAGIISAAKAGETRFTDTRKDEQERGITIKSTAISLFFEMSDDDLKFIKQEGDGN   96 (842)
T ss_pred             ccceE---EEEecCCcchhhHHHHHhhceeeecccCCccccccccchhhcceEeeeeeeeehhhhhHhHHHHhcCCCCCc
Confidence            46667   999999999999999999999997779999999999999999999999999999987777777777777888


Q ss_pred             ceEEEEEcCCCccchHHHHHHhhhccCceEEEEeCCCCcchhHHHHHHHHHhcCCccEEEEecCccchhccCCCHHHHHH
Q 003804           89 EYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVDGEEAYQ  168 (794)
Q Consensus        89 ~~~inlIDTPGh~df~~e~~~~l~~~D~ailvvda~~gv~~qt~~~~~~~~~~~~~~iv~iNKiD~~~~~~~~~~~~~~~  168 (794)
                      ++.|||||+|||+||++|+..|||+.|||++|||+++|++.||+++++|+..+++++++|+|||||.++||+++++++|+
T Consensus        97 ~FLiNLIDSPGHVDFSSEVTAALRVTDGALVVVDcv~GvCVQTETVLrQA~~ERIkPvlv~NK~DRAlLELq~~~EeLyq  176 (842)
T KOG0469|consen   97 GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLVMNKMDRALLELQLSQEELYQ  176 (842)
T ss_pred             ceeEEeccCCCcccchhhhhheeEeccCcEEEEEccCceEechHHHHHHHHHhhccceEEeehhhHHHHhhcCCHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhhhhhcccCCCCCCceeeccCceeeeccCccceeeehhhHHHHHhhhcCCChHhHHHHhhcccccCCCCCc
Q 003804          169 TFQKVIENANVIMATYEDPLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATRK  248 (794)
Q Consensus       169 ~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~v~~~s~~~g~~~~~~~~a~~~~~~~~id~~~l~~~~wg~~~~~~~~~~  248 (794)
                      .|+++++.+|.+++.|.+.++|++.+.|.+++|.|+|+++||+|++.+||+.|.++|++|..+|..+|||++|+++++++
T Consensus       177 tf~R~VE~vNviisTy~d~~~g~~~v~P~kg~v~F~SGLhGWaFTlrQFa~~Y~~KF~~~~~kmm~~LWg~~~f~~ktkk  256 (842)
T KOG0469|consen  177 TFQRIVENVNVIISTYGDGPMGDVQVDPEKGTVGFGSGLHGWAFTLRQFAEMYAKKFGIDVRKMMNRLWGDNFFNPKTKK  256 (842)
T ss_pred             HHHHHHhcccEEEEecccCCcCceEecCCCCceeeccccchhhhhHHHHHHHHHHHhCCcHHHHHHHhhcccccCccCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeecC--CCCCcchhhHhHHhhchHHHHHHHHhccChhhHHHHHhhcCCcCCHHHHHHhHHHHHHHHHhccccchHHHHH
Q 003804          249 WTSRN--TGSPTCKRGFVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLPASSALLE  326 (794)
Q Consensus       249 ~~~~~--~~~~~~~~~~~~~~l~p~~~l~e~~~~~d~~~le~~l~~~~~~l~~~el~~~~~~l~~~i~~~~~P~~~~LLd  326 (794)
                      |..+.  ..++.+++.|+.++|+|||++++++.+...+.+..+|+.+++.+..++....+++|++.+|++|+|...+||+
T Consensus       257 ~~~s~t~~~gn~~~r~F~~~iLdPIykvfdaimN~kkeei~~llekl~v~lk~~~kd~eGK~LlK~vMr~wLPAadalle  336 (842)
T KOG0469|consen  257 WSKSATDAEGNPLRRAFCMFILDPIYKVFDAIMNFKKEEIATLLEKLEVTLKGDEKDLEGKALLKVVMRKWLPAADALLE  336 (842)
T ss_pred             ccccccccccCccccceeEEeechHHHHHHHHhhccHHHHHHHHHHhcceeccccccccchHHHHHHHHHhcchHHHHHH
Confidence            98765  3567889999999999999999999999999999999999999999999889999999999999999999999


Q ss_pred             HHHhcCCChhhhhhhhhccccCCCCcccccccccccCCCCCeEEEEEEeeecCCCCcceEEEEEEeeeecCCCEEEEcCC
Q 003804          327 MMIFHLPSPATAQKYRVENLYEGPLDDAYANAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGKVATGLKVRIMGP  406 (794)
Q Consensus       327 ~i~~~lPsP~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~plva~VfK~~~~~~~g~~l~~~RV~sG~L~~g~~l~v~~~  406 (794)
                      +|.-+||||..+|.+|...+|.|+.+|+.+-++++||+++|+.+||+|+.+++++|+|++|+|||||++.+|+.+++.||
T Consensus       337 mIalhLPSPvtaQkyR~e~LYEGP~DDe~a~aik~CD~~aplmmYvSKMvPtsDkgRFyAFGRVFsG~v~~G~KvRiqgP  416 (842)
T KOG0469|consen  337 MIALHLPSPVTAQKYRAEYLYEGPADDEAAVAIKNCDPKAPLMMYVSKMVPTSDKGRFYAFGRVFSGKVFTGLKVRIQGP  416 (842)
T ss_pred             HHHhhCCCchHHHHHHHHHhhcCCCchHHhhHhhccCCCCCeEEeeeeccccCCCceEEEEeeeecceeccCcEEEEeCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCccccceeeeceEEEEecCceeeeCcccCCCEEEEeccccccccceeeecCCCCCcccccccccCCCceEEEEEE
Q 003804          407 NYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQ  486 (794)
Q Consensus       407 n~~~~~~~~~~~~kv~~l~~~~g~~~~~v~~a~AGdI~ai~gl~~~~~~tgTl~~~~~~~~~~~~~~~~~~~Pv~~~aIe  486 (794)
                      ||.+|++++.+...|.+..+|||+..++|+.++||+|+++.|+++++.+|||+++.+.  ++.++.|+|+.+||+.++||
T Consensus       417 nY~PGkkedl~~K~iqRtvlMMGr~vepied~PaGNIiGlvGvDqfLvKtGTiTt~e~--AHNmrvMKFSVSPVV~VAVe  494 (842)
T KOG0469|consen  417 NYVPGKKEDLYIKAIQRTVLMMGRFVEPIEDCPAGNIIGLVGVDQFLVKTGTITTSEA--AHNMRVMKFSVSPVVRVAVE  494 (842)
T ss_pred             CCCCCcHHHHHHHHHHHHHHHhcccccccccCCCCcEEEEeehhHhhhccCceeehhh--hccceEEEeeccceEEEEEe
Confidence            9999999888878888999999999999999999999999999999999999999887  88999999999999999999


Q ss_pred             eCCCCCHhHHHHHHHHHHhcCCcEEEEEcCCCcEEEEecchhHHHHHHHHHHhhccCCeeeEEcCcEEEEEeecccccce
Q 003804          487 CKVASDLPKLVEGLKRLAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSCR  566 (794)
Q Consensus       487 p~~~~d~~kl~~aL~~L~~eDPsl~v~~~etge~il~g~GelHLei~~~~L~~~f~~~v~v~~~~p~V~yrETi~~~~~~  566 (794)
                      ++++.|++||.++|++|+++||...+..+|+||++|.|.||||||||+.+|++.| |+++++.|+|.|+||||+.+.++.
T Consensus       495 ~Knp~DLpKLvEGLkrLakSDP~v~~~~~esGehiiAgaGeLHLEICLkDLeedh-A~iPlk~sdPvVsYrEtvs~~ss~  573 (842)
T KOG0469|consen  495 AKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDH-ACIPLKKSDPVVSYRETVSEESSQ  573 (842)
T ss_pred             cCChhhhHHHHHHHHHHhccCCeEEEEeccCCceEEeccchhhHHHHHhhHhhcc-cCCceecCCCeeeeecccccccch
Confidence            9999999999999999999999999999999999999999999999999999999 899999999999999999999999


Q ss_pred             eEeecCCCceeEEEEEEeeCCccchhhhccCCCCCCCCcc----------------------------------------
Q 003804          567 TVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPK----------------------------------------  606 (794)
Q Consensus       567 ~~~~~~~~~~~~v~~~~ePl~~~~~~~i~~g~i~~~~~~~----------------------------------------  606 (794)
                      .+.++++|+|+++++.++|++.++.+.|++|.+.+.|+.|                                        
T Consensus       574 ~~lsKSpNKHNRi~mtaeP~~~~l~~~i~~g~v~~rd~fK~rAr~~aeky~~dvt~aRKIWCfgPd~tg~Nll~D~TK~v  653 (842)
T KOG0469|consen  574 TCLSKSPNKHNRIYMTAEPMDDGLSDDIENGKVNARDEFKARARILAEKYGWDVTEARKIWCFGPDGTGPNLLVDQTKGV  653 (842)
T ss_pred             hhhccCCcccceeEEecccCCchhhhhhhcCccChhHHHHHHHHHHHHHhCCchhhhheeeEeCCCCCCCcEEEecchhh
Confidence            9999999999999999999999999999999886655332                                        


Q ss_pred             -chHHhHHHHHHHHHHHHHcCCcCCCCeeeEEEEEEeeeecccccccCcCchHHHHHHHHHHHHHhcCCceecCeEEEEE
Q 003804          607 -YLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEI  685 (794)
Q Consensus       607 -~~~~i~~~i~~g~~~a~~~Gpl~g~pv~~v~v~l~d~~~~~ds~~~~~~~~~~a~~~a~~~al~~a~~~llEPi~~~eI  685 (794)
                       |+++|++++..|||||.++|||+|+.|++|+|.|.|...|.|..|++.+|+++.+|++|+++++.|+|+|+||+|.|||
T Consensus       654 qylnEIKdsVvagFqwA~keG~l~~E~mRgvrfni~DvtLHADAIHRGggQiipt~rr~~ya~~l~A~P~l~EPvylvEI  733 (842)
T KOG0469|consen  654 QYLNEIKDSVVAGFQWATKEGPLFGENMRGVRFNILDVTLHADAIHRGGGQIIPTARRVLYASVLTAGPILQEPVYLVEI  733 (842)
T ss_pred             HHHHHHHHHHHHHHHHHhccCCcccccccceeEEeeeeeeehhhhhcCCCeechHHHHHHHHHHHhcCceecCceEEEEE
Confidence             9999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeccCcchhHHHHhhhcccceeeeeccCCCCcEEEEEEechhhhhCchHHHhhhcCCceEeeeEeccccccCCCCCCCCh
Q 003804          686 QAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRAATSGQAFPQCVFDHWDMMSSDPLEPGS  765 (794)
Q Consensus       686 ~~p~~~~g~v~~~L~~rrg~i~~~~~~~~~~~~~I~a~vP~~e~~~y~~~Lrs~T~G~g~~~~~f~~y~~~~~~~~~~~~  765 (794)
                      +||++++|.|++.|+++||++.+++...|++++.|+|++|+.|+|||..+|||.|+|+|..+|.|+||+++|+||+|++|
T Consensus       734 q~pe~avGgiy~vLn~kRG~v~~e~q~~Gtp~f~vkayLPVnESFgFt~dLrs~t~GqAfpq~vFdHws~lpgdp~dp~s  813 (842)
T KOG0469|consen  734 QCPEQAVGGIYGVLNRKRGHVFEEEQVPGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQMVFDHWSILPGDPLDPTS  813 (842)
T ss_pred             eCchhhhchhhheeeccccceecccccCCCcceEEEEEeecccccccchhhhcccCCccccceeeeccccCCCCCCCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHhcCCCCCCCCcccccccC
Q 003804          766 QASQLVLDIRKRKGLKEQMTPLSEYEDKL  794 (794)
Q Consensus       766 ~~~~~~~~~r~rkGl~~~~~~~~~~~~~l  794 (794)
                      ..-+++.++|+||||.|.+|.+.+|+|||
T Consensus       814 k~~~iV~~~RKrkglke~~P~~~~y~Dkl  842 (842)
T KOG0469|consen  814 KPGQIVLATRKRKGLKEGVPDLDEYLDKL  842 (842)
T ss_pred             cchHHHHHHHHhcCCCCCCCChHHHhhcC
Confidence            99999999999999999999999999997

>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0465 consensus Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>KOG0467 consensus Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>KOG0464 consensus Elongation factor G [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>cd01683 EF2_IV_snRNP EF-2_domain IV_snRNP domain is a part of 116kD U5-specific protein of the U5 small nucleoprotein (snRNP) particle, essential component of the spliceosome Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>cd01681 aeEF2_snRNP_like_IV This family represents domain IV of archaeal and eukaryotic elongation factor 2 (aeEF-2) and of an evolutionarily conserved U5 snRNP-specific protein Back     alignment and domain information
>cd04098 eEF2_C_snRNP eEF2_C_snRNP: This family includes a C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>KOG0459 consensus Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>smart00838 EFG_C Elongation factor G C-terminus Back     alignment and domain information
>PF00679 EFG_C: Elongation factor G C-terminus; InterPro: IPR000640 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04096 eEF2_snRNP_like_C eEF2_snRNP_like_C: this family represents a C-terminal domain of eukaryotic elongation factor 2 (eEF-2) and a homologous domain of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd04097 mtEFG1_C mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PF14492 EFG_II: Elongation Factor G, domain II; PDB: 1WDT_A 2DY1_A 2XEX_A 1ELO_A 2XSY_Y 2WRK_Y 1DAR_A 2WRI_Y 2XUY_Y 3J0E_H Back     alignment and domain information
>cd03711 Tet_C Tet_C: C-terminus of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>cd03713 EFG_mtEFG_C EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G Back     alignment and domain information
>cd03710 BipA_TypA_C BipA_TypA_C: a C-terminal portion of BipA or TypA having homology to the C terminal domains of the elongation factors EF-G and EF-2 Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd01514 Elongation_Factor_C Elongation factor G C-terminus Back     alignment and domain information
>cd03709 lepA_C lepA_C: This family represents the C-terminal region of LepA, a GTP-binding protein localized in the cytoplasmic membrane Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PF03764 EFG_IV: Elongation factor G, domain IV; InterPro: IPR005517 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>cd04090 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>KOG0463 consensus GTP-binding protein GP-1 [General function prediction only] Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>cd01684 Tet_like_IV EF-G_domain IV_RPP domain is a part of bacterial ribosomal protected proteins (RPP) family Back     alignment and domain information
>cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes Back     alignment and domain information
>cd01680 EFG_like_IV Elongation Factor G-like domain IV Back     alignment and domain information
>cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3) Back     alignment and domain information
>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>cd01434 EFG_mtEFG1_IV EFG_mtEFG1_IV: domains similar to domain IV of the bacterial translational elongation factor (EF) EF-G Back     alignment and domain information
>cd01693 mtEFG2_like_IV mtEF-G2 domain IV Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>KOG0466 consensus Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0052 consensus Translation elongation factor EF-1 alpha/Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>KOG0394 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>PF03144 GTP_EFTU_D2: Elongation factor Tu domain 2; InterPro: IPR004161 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2486 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>KOG3886 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] Back     alignment and domain information
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>KOG1673 consensus Ras GTPases [General function prediction only] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03694 GTPBP_II Domain II of the GP-1 family of GTPase Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>KOG1534 consensus Putative transcription factor FET5 [Transcription] Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>cd03688 eIF2_gamma_II eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00257 IMPACT_YIGZ uncharacterized protein, YigZ family Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>TIGR02475 CobW cobalamin biosynthesis protein CobW Back     alignment and domain information
>PRK11568 hypothetical protein; Provisional Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>PRK10818 cell division inhibitor MinD; Provisional Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd03702 IF2_mtIF2_II This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2 Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only] Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>KOG2743 consensus Cobalamin synthesis protein [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG2423 consensus Nucleolar GTPase [General function prediction only] Back     alignment and domain information
>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3887 consensus Predicted small GTPase involved in nuclear protein import [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD, archaeal Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] Back     alignment and domain information
>PF09186 DUF1949: Domain of unknown function (DUF1949); InterPro: IPR015269 Members of this entry are a set of functionally uncharacterised hypothetical bacterial proteins Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>cd03701 IF2_IF5B_II IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD Back     alignment and domain information
>cd03703 aeIF5B_II aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query794
1n0v_C842 Crystal Structure Of Elongation Factor 2 Length = 8 0.0
1u2r_A842 Crystal Structure Of Adp-Ribosylated Ribosomal Tran 0.0
1zn0_B655 Coordinates Of Rrf And Ef-G Fitted Into Cryo-Em Map 2e-31
3izp_E688 Conformation Of Ef-G During Translocation Length = 3e-31
1fnm_A691 Structure Of Thermus Thermophilus Ef-G H573a Length 3e-31
1ktv_A691 Crystal Structure Of Elongation Factor G Dimer With 6e-31
1efg_A691 The Crystal Structure Of Elongation Factor G Comple 6e-31
2bm1_A691 Ribosomal Elongation Factor G (Ef-G) Fusidic Acid R 7e-31
2bm0_A691 Ribosomal Elongation Factor G (Ef-G) Fusidic Acid R 7e-31
2j7k_A691 Crystal Structure Of The T84a Mutant Ef-G:gdpcp Com 7e-31
2bv3_A691 Crystal Structure Of A Mutant Elongation Factor G T 9e-29
2rdo_7704 50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length = 1e-26
3j0e_H702 Models For The T. Thermophilus Ribosome Recycling F 1e-26
2xex_A693 Crystal Structure Of Staphylococcus Aureus Elongati 2e-24
3zzt_A693 Crystal Structure Of Staphylococcus Aureus Elongati 2e-24
3zz0_A693 Crystal Structure Of Ribosomal Elongation Factor (E 2e-24
3zzu_A693 Crystal Structure Of Staphylococcus Aureus Elongati 2e-24
4fn5_A709 Elongation Factor G 1 (Pseudomonas Aeruginosa) In C 3e-22
2ywe_A600 Crystal Structure Of Lepa From Aquifex Aeolicus Len 1e-16
2ywg_A600 Crystal Structure Of Gtp-Bound Lepa From Aquifex Ae 2e-16
3cb4_D599 The Crystal Structure Of Lepa Length = 599 1e-14
3deg_C545 Complex Of Elongating Escherichia Coli 70s Ribosome 2e-14
1wdt_A665 Crystal Structure Of Ttk003000868 From Thermus Ther 2e-13
3j25_A638 Structural Basis For Tetm-Mediated Tetracycline Res 7e-13
3vqt_A548 Crystal Structure Analysis Of The Translation Facto 1e-11
3tr5_A528 Structure Of A Peptide Chain Release Factor 3 (Prfc 4e-10
2h5e_A529 Crystal Structure Of E.Coli Polypeptide Release Fac 7e-08
3uoq_W534 Crystal Structure Of Release Factor Rf3 Trapped In 7e-08
4ac9_A482 Crystal Structure Of Translation Elongation Factor 1e-04
1jqs_C68 Fitting Of L11 Protein And Elongation Factor G (Dom 6e-04
>pdb|1N0V|C Chain C, Crystal Structure Of Elongation Factor 2 Length = 842 Back     alignment and structure 
Iteration: 1

 Score =  993 bits (2568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/816 (59%), Positives = 605/816 (74%), Gaps = 48/816 (5%)
Query: 23  GKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALKSYR 82
           GKSTLTDSLV  AGII+   AG+ R TDTR+DE ERGITIKST ISLY EM+D  +K  +
Sbjct: 31  GKSTLTDSLVQRAGIISAAKAGEARFTDTRKDEQERGITIKSTAISLYSEMSDEDVKEIK 90
Query: 83  GERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGER 142
            +  GN +LINLIDSPGHVDFSSEVTAALR+TDGALVVVD IEGVCVQTETVLRQALGER
Sbjct: 91  QKTDGNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGER 150
Query: 143 IRPVLTVNKMDRCFLELQVDGEEAYQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVA 202
           I+PV+ +NK+DR  LELQV  E+ YQTF + +E+ NVI++TY D +LGDVQVYP +GTVA
Sbjct: 151 IKPVVVINKVDRALLELQVSKEDLYQTFARTVESVNVIVSTYADEVLGDVQVYPARGTVA 210
Query: 203 FSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATRKWTSRNT---GSPTC 259
           F +GLHGWAFT+  FA  YA KFGVD++KMM+RLWG++FF+P T+KWT+++T   G P  
Sbjct: 211 FGSGLHGWAFTIRQFATRYAKKFGVDKAKMMDRLWGDSFFNPKTKKWTNKDTDAEGKP-L 269
Query: 260 KRGFVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLP 319
           +R F  F  +PI ++    MN +KD++  +L+KL + +K +EK+L GKAL+K VM+ +LP
Sbjct: 270 ERAFNMFILDPIFRLFTAIMNFKKDEIPVLLEKLEIVLKGDEKDLEGKALLKVVMRKFLP 329
Query: 320 ASSALLEMMIFHLPSPATAQKYRVENLYEGPLDDAYANAIRNCDPEGPLMLYVSKMIPAS 379
           A+ ALLEM++ HLPSP TAQ YR E LYEGP DDA   AI+NCDP+  LMLYVSKM+P S
Sbjct: 330 AADALLEMIVLHLPSPVTAQAYRAEQLYEGPADDANCIAIKNCDPKADLMLYVSKMVPTS 389
Query: 380 DKGRFFAFGRVFSGKVATGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVP 439
           DKGRF+AFGRVF+G V +G KVRI GPNYVPG+K DL++K++QR V+ MG+  E ++D P
Sbjct: 390 DKGRFYAFGRVFAGTVKSGQKVRIQGPNYVPGKKDDLFIKAIQRVVLMMGRFVEPIDDCP 449
Query: 440 CGNTVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEG 499
            GN + +VG+DQ++ K  TLT  +   AH ++ MKFSVSPVV+VAV+ K A+DLPKLVEG
Sbjct: 450 AGNIIGLVGIDQFLLKTGTLTTSET--AHNMKVMKFSVSPVVQVAVEVKNANDLPKLVEG 507
Query: 500 LKRLAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRET 559
           LKRL+KSDP V+  M ESGEHI+AG GELHLEICL+DL+ D   G  +  S PVV++RET
Sbjct: 508 LKRLSKSDPCVLTYMSESGEHIVAGTGELHLEICLQDLEHDH-AGVPLKISPPVVAYRET 566
Query: 560 VLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPK------------- 606
           V  +S +T +SKSPNKHNR+Y++A P++E ++ AI++G I PRDD K             
Sbjct: 567 VESESSQTALSKSPNKHNRIYLKAEPIDEEVSLAIENGIINPRDDFKARARIMADDYGWD 626
Query: 607 ----------------------------YLNEIKDSVVAGFQWASKEGALAEENMRGICF 638
                                       YL+EIKDSVVA FQWA+KEG +  E MR +  
Sbjct: 627 VTDARKIWCFGPDGNGPNLVIDQTKAVQYLHEIKDSVVAAFQWATKEGPIFGEEMRSVRV 686
Query: 639 EVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSV 698
            + DV LHADAIHRGGGQ+IPT RR  YA  L A P++ EPV+LVEIQ PEQA+GGIYSV
Sbjct: 687 NILDVTLHADAIHRGGGQIIPTMRRATYAGFLLADPKIQEPVFLVEIQCPEQAVGGIYSV 746
Query: 699 LNQKRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRAATSGQAFPQCVFDHWDMMSS 758
           LN+KRG V  E QRPGTPL+ +KAYLPV ESFGF+  LR AT GQAFPQ VFDHW  + S
Sbjct: 747 LNKKRGQVVSEEQRPGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVFDHWSTLGS 806
Query: 759 DPLEPGSQASQLVLDIRKRKGLKEQMTPLSEYEDKL 794
           DPL+P S+A ++VL  RKR G+KE++    EY DKL
Sbjct: 807 DPLDPTSKAGEIVLAARKRHGMKEEVPGWQEYYDKL 842
>pdb|1U2R|A Chain A, Crystal Structure Of Adp-Ribosylated Ribosomal Translocase From Saccharomyces Cerevisiae Length = 842 Back     alignment and structure
>pdb|1ZN0|B Chain B, Coordinates Of Rrf And Ef-G Fitted Into Cryo-Em Map Of The 50s Subunit Bound With Both Ef-G (Gdpnp) And Rrf Length = 655 Back     alignment and structure
>pdb|3IZP|E Chain E, Conformation Of Ef-G During Translocation Length = 688 Back     alignment and structure
>pdb|1FNM|A Chain A, Structure Of Thermus Thermophilus Ef-G H573a Length = 691 Back     alignment and structure
>pdb|1KTV|A Chain A, Crystal Structure Of Elongation Factor G Dimer Without Nucleotide Length = 691 Back     alignment and structure
>pdb|1EFG|A Chain A, The Crystal Structure Of Elongation Factor G Complexed With Gdp, At 2.7 Angstroms Resolution Length = 691 Back     alignment and structure
>pdb|2BM1|A Chain A, Ribosomal Elongation Factor G (Ef-G) Fusidic Acid Resistant Mutant G16v Length = 691 Back     alignment and structure
>pdb|2BM0|A Chain A, Ribosomal Elongation Factor G (Ef-G) Fusidic Acid Resistant Mutant T84a Length = 691 Back     alignment and structure
>pdb|2J7K|A Chain A, Crystal Structure Of The T84a Mutant Ef-G:gdpcp Complex Length = 691 Back     alignment and structure
>pdb|2BV3|A Chain A, Crystal Structure Of A Mutant Elongation Factor G Trapped With A Gtp Analogue Length = 691 Back     alignment and structure
>pdb|2RDO|7 Chain 7, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length = 704 Back     alignment and structure
>pdb|3J0E|H Chain H, Models For The T. Thermophilus Ribosome Recycling Factor And The E. Coli Elongation Factor G Bound To The E. Coli Post-Termination Complex Length = 702 Back     alignment and structure
>pdb|2XEX|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G Length = 693 Back     alignment and structure
>pdb|3ZZT|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G With A Fusidic-Acid-Resistant Mutation F88l Length = 693 Back     alignment and structure
>pdb|3ZZ0|A Chain A, Crystal Structure Of Ribosomal Elongation Factor (Ef)-G From Staphylococcus Aureus With A Fusidic Acid Hyper-Sensitivity Mutation M16i Length = 693 Back     alignment and structure
>pdb|3ZZU|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G With Mutations M16i And F88l Length = 693 Back     alignment and structure
>pdb|4FN5|A Chain A, Elongation Factor G 1 (Pseudomonas Aeruginosa) In Complex With Argyrin B Length = 709 Back     alignment and structure
>pdb|2YWE|A Chain A, Crystal Structure Of Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|2YWG|A Chain A, Crystal Structure Of Gtp-Bound Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|3CB4|D Chain D, The Crystal Structure Of Lepa Length = 599 Back     alignment and structure
>pdb|3DEG|C Chain C, Complex Of Elongating Escherichia Coli 70s Ribosome And Ef4(Lepa)- Gmppnp Length = 545 Back     alignment and structure
>pdb|1WDT|A Chain A, Crystal Structure Of Ttk003000868 From Thermus Thermophilus Hb8 Length = 665 Back     alignment and structure
>pdb|3J25|A Chain A, Structural Basis For Tetm-Mediated Tetracycline Resistance Length = 638 Back     alignment and structure
>pdb|3VQT|A Chain A, Crystal Structure Analysis Of The Translation Factor Rf3 Length = 548 Back     alignment and structure
>pdb|3TR5|A Chain A, Structure Of A Peptide Chain Release Factor 3 (Prfc) From Coxiella Burnetii Length = 528 Back     alignment and structure
>pdb|2H5E|A Chain A, Crystal Structure Of E.Coli Polypeptide Release Factor Rf3 Length = 529 Back     alignment and structure
>pdb|3UOQ|W Chain W, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp State On A Rotated Conformation Of The Ribosome (Without Viomycin) Length = 534 Back     alignment and structure
>pdb|4AC9|A Chain A, Crystal Structure Of Translation Elongation Factor Selb From Methanococcus Maripaludis In Complex With Gdp Length = 482 Back     alignment and structure
>pdb|1JQS|C Chain C, Fitting Of L11 Protein And Elongation Factor G (Domain G' And V) In The Cryo-Em Map Of E. Coli 70s Ribosome Bound With Ef-G And Gmppcp, A Nonhydrolysable Gtp Analog Length = 68 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query794
1n0u_A842 EF-2, elongation factor 2; G-protein, CIS-proline, 0.0
2dy1_A665 Elongation factor G; translocation, GTP complex, s 2e-34
2dy1_A665 Elongation factor G; translocation, GTP complex, s 1e-22
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 7e-32
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 7e-20
2xex_A693 Elongation factor G; GTPase, translation, biosynth 7e-32
2xex_A693 Elongation factor G; GTPase, translation, biosynth 3e-18
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 5e-30
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 3e-18
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 1e-21
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 1e-21
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 2e-15
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 2e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1f60_A458 Elongation factor EEF1A; protein-protein complex, 4e-07
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 1e-06
1wb1_A482 Translation elongation factor SELB; selenocysteine 4e-06
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 1e-05
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 3e-05
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 9e-04
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Length = 842 Back     alignment and structure
 Score = 1030 bits (2665), Expect = 0.0
 Identities = 483/816 (59%), Positives = 604/816 (74%), Gaps = 46/816 (5%)

Query: 22  AGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALKSY 81
            GKSTLTDSLV  AGII+   AG+ R TDTR+DE ERGITIKST ISLY EM+D  +K  
Sbjct: 30  HGKSTLTDSLVQRAGIISAAKAGEARFTDTRKDEQERGITIKSTAISLYSEMSDEDVKEI 89

Query: 82  RGERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGE 141
           + +  GN +LINLIDSPGHVDFSSEVTAALR+TDGALVVVD IEGVCVQTETVLRQALGE
Sbjct: 90  KQKTDGNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGE 149

Query: 142 RIRPVLTVNKMDRCFLELQVDGEEAYQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTV 201
           RI+PV+ +NK+DR  LELQV  E+ YQTF + +E+ NVI++TY D +LGDVQVYP +GTV
Sbjct: 150 RIKPVVVINKVDRALLELQVSKEDLYQTFARTVESVNVIVSTYADEVLGDVQVYPARGTV 209

Query: 202 AFSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATRKWTSRNTGS--PTC 259
           AF +GLHGWAFT+  FA  YA KFGVD++KMM+RLWG++FF+P T+KWT+++T +     
Sbjct: 210 AFGSGLHGWAFTIRQFATRYAKKFGVDKAKMMDRLWGDSFFNPKTKKWTNKDTDAEGKPL 269

Query: 260 KRGFVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLP 319
           +R F  F  +PI ++    MN +KD++  +L+KL + +K +EK+L GKAL+K VM+ +LP
Sbjct: 270 ERAFNMFILDPIFRLFTAIMNFKKDEIPVLLEKLEIVLKGDEKDLEGKALLKVVMRKFLP 329

Query: 320 ASSALLEMMIFHLPSPATAQKYRVENLYEGPLDDAYANAIRNCDPEGPLMLYVSKMIPAS 379
           A+ ALLEM++ HLPSP TAQ YR E LYEGP DDA   AI+NCDP+  LMLYVSKM+P S
Sbjct: 330 AADALLEMIVLHLPSPVTAQAYRAEQLYEGPADDANCIAIKNCDPKADLMLYVSKMVPTS 389

Query: 380 DKGRFFAFGRVFSGKVATGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVP 439
           DKGRF+AFGRVF+G V +G KVRI GPNYVPG+K DL++K++QR V+ MG+  E ++D P
Sbjct: 390 DKGRFYAFGRVFAGTVKSGQKVRIQGPNYVPGKKDDLFIKAIQRVVLMMGRFVEPIDDCP 449

Query: 440 CGNTVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEG 499
            GN + +VG+DQ++ K  TLT  +   AH ++ MKFSVSPVV+VAV+ K A+DLPKLVEG
Sbjct: 450 AGNIIGLVGIDQFLLKTGTLTTSE--TAHNMKVMKFSVSPVVQVAVEVKNANDLPKLVEG 507

Query: 500 LKRLAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRET 559
           LKRL+KSDP V+  M ESGEHI+AG GELHLEICL+DL+ D   G  +  S PVV++RET
Sbjct: 508 LKRLSKSDPCVLTYMSESGEHIVAGTGELHLEICLQDLEHDH-AGVPLKISPPVVAYRET 566

Query: 560 VLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPK------------- 606
           V  +S +T +SKSPNKHNR+Y++A P++E ++ AI++G I PRDD K             
Sbjct: 567 VESESSQTALSKSPNKHNRIYLKAEPIDEEVSLAIENGIINPRDDFKARARIMADDYGWD 626

Query: 607 ----------------------------YLNEIKDSVVAGFQWASKEGALAEENMRGICF 638
                                       YL+EIKDSVVA FQWA+KEG +  E MR +  
Sbjct: 627 VTDARKIWCFGPDGNGPNLVIDQTKAVQYLHEIKDSVVAAFQWATKEGPIFGEEMRSVRV 686

Query: 639 EVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSV 698
            + DV LHADAIHRGGGQ+IPT RR  YA  L A P++ EPV+LVEIQ PEQA+GGIYSV
Sbjct: 687 NILDVTLHADAIHRGGGQIIPTMRRATYAGFLLADPKIQEPVFLVEIQCPEQAVGGIYSV 746

Query: 699 LNQKRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRAATSGQAFPQCVFDHWDMMSS 758
           LN+KRG V  E QRPGTPL+ +KAYLPV ESFGF+  LR AT GQAFPQ VFDHW  + S
Sbjct: 747 LNKKRGQVVSEEQRPGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVFDHWSTLGS 806

Query: 759 DPLEPGSQASQLVLDIRKRKGLKEQMTPLSEYEDKL 794
           DPL+P S+A ++VL  RKR G+KE++    EY DKL
Sbjct: 807 DPLDPTSKAGEIVLAARKRHGMKEEVPGWQEYYDKL 842
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Length = 665 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Length = 665 Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Length = 704 Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Length = 704 Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Length = 693 Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Length = 693 Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Length = 691 Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Length = 691 Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Length = 600 Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Length = 599 Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Length = 529 Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Length = 528 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Length = 458 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 434 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Length = 482 Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Length = 467 Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Length = 435 Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Length = 594 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query794
1n0u_A842 EF-2, elongation factor 2; G-protein, CIS-proline, 100.0
4fn5_A709 EF-G 1, elongation factor G 1; translation, transl 100.0
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 100.0
2xex_A693 Elongation factor G; GTPase, translation, biosynth 100.0
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 100.0
3j25_A638 Tetracycline resistance protein TETM; antibiotic r 100.0
2dy1_A665 Elongation factor G; translocation, GTP complex, s 100.0
3vqt_A548 RF-3, peptide chain release factor 3; translation, 100.0
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 100.0
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 100.0
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 100.0
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 100.0
3e3x_A332 BIPA; MCSG,PSI2, structural genomics, protein stru 100.0
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 99.97
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.97
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 99.97
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 99.97
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.96
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 99.95
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.95
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 99.95
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.95
1f60_A458 Elongation factor EEF1A; protein-protein complex, 99.95
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 99.95
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.94
2elf_A370 Protein translation elongation factor 1A; tRNA, py 99.94
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.94
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 99.93
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 99.92
1wb1_A482 Translation elongation factor SELB; selenocysteine 99.92
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 99.91
3izy_P537 Translation initiation factor IF-2, mitochondrial; 99.91
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.56
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.53
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.51
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.51
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.51
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.49
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.46
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.46
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.45
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 99.43
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.42
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.42
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.38
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.38
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.38
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.37
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.37
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.36
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.36
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.36
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.36
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.36
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.36
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.36
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.36
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.35
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.35
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.35
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.35
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.35
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.35
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.34
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.34
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.34
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.34
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.34
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.34
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.34
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.33
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.33
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.33
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.33
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.33
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.33
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.33
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.32
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.32
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.32
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.32
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.32
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.32
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.32
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.32
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.32
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.32
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.31
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.31
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.31
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.31
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.31
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.31
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.31
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.3
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.3
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.3
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.3
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.3
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.3
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.3
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.3
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.3
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.3
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.3
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.3
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.3
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.3
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.3
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.29
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.29
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.29
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.29
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.29
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.29
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.28
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.27
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.27
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.27
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.27
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.27
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.27
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.27
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.27
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.27
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.27
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.26
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.26
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.26
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.26
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.25
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.25
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.25
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.25
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.25
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.25
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.25
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.25
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.24
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.24
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.24
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.24
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.24
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.23
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.23
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.23
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.23
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.23
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.22
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.21
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.21
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.21
2ged_A193 SR-beta, signal recognition particle receptor beta 99.21
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.21
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.2
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.19
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.18
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.18
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.18
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.18
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.17
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.17
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.16
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 99.15
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.13
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.13
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.13
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.12
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.68
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.07
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.0
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 98.98
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.97
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 98.96
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 98.96
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 98.94
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.93
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 98.92
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 98.92
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 98.9
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.9
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 98.89
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 98.88
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 98.86
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 98.85
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 98.78
1wxq_A397 GTP-binding protein; structural genomics, riken st 98.76
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 98.67
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 98.66
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 98.61
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 98.59
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 98.56
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 98.51
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.48
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 98.41
2www_A349 Methylmalonic aciduria type A protein, mitochondri 98.39
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 98.38
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.35
1jal_A363 YCHF protein; nucleotide-binding fold, structural 98.33
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 98.28
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 98.23
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 98.22
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 98.17
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 98.17
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 97.95
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 97.94
2xxa_A433 Signal recognition particle protein; protein trans 97.91
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.9
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 97.89
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.86
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 97.85
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.84
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 97.82
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 97.8
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 97.67
2hf9_A226 Probable hydrogenase nickel incorporation protein 97.63
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 97.6
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 97.58
3e1y_E204 Eukaryotic peptide chain release factor GTP-bindi 97.47
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 97.46
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 97.46
3cwq_A209 Para family chromosome partitioning protein; alpha 97.31
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.09
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 97.08
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 97.07
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 97.05
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 97.0
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 96.92
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 96.85
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 96.78
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 96.73
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 96.72
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 96.62
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.51
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 96.36
2cve_A191 Hypothetical protein TTHA1053; COG1739, UPF0029, s 96.36
3cnl_A262 YLQF, putative uncharacterized protein; circular p 96.31
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 96.28
3end_A307 Light-independent protochlorophyllide reductase ir 96.27
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.24
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 96.2
1vi7_A217 Hypothetical protein YIGZ; structural genomics, un 96.15
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 95.85
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 95.16
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 95.16
3cnl_A262 YLQF, putative uncharacterized protein; circular p 95.04
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 95.03
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 94.63
2og2_A359 Putative signal recognition particle receptor; nuc 94.29
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 93.78
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 93.69
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 93.52
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 93.51
3lh2_S76 4E10_1VI7A_S0_002_N (T88); epitope-scaffold, immun 93.37
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 93.36
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 93.06
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 92.77
1xe1_A116 Hypothetical protein PF0907; structural genomics, 92.66
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 92.5
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 92.18
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 92.12
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 92.05
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 91.97
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 91.25
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 91.01
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 90.91
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 90.55
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 89.92
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 89.57
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 89.51
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 89.27
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 89.14
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 89.02
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 88.89
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 88.88
4ido_A457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 88.62
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 88.34
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 88.29
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 88.28
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 88.1
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 87.97
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 87.28
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 87.01
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 87.01
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 86.73
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 86.7
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 86.65
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 86.59
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 86.57
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 86.57
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 86.51
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 86.43
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 86.41
1kag_A173 SKI, shikimate kinase I; transferase, structural g 86.3
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 86.11
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 86.09
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 86.06
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 86.03
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 85.85
2wbm_A252 MTHSBDS, ribosome maturation protein SDO1 homolog; 85.79
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 85.39
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 85.16
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 85.15
1xjc_A169 MOBB protein homolog; structural genomics, midwest 85.09
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 85.0
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 84.72
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 84.68
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 84.33
3vaa_A199 Shikimate kinase, SK; structural genomics, center 84.32
1t95_A240 Hypothetical protein AF0491; shwachman-bodian-diam 84.31
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 84.28
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 84.2
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 84.2
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 84.16
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 84.13
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 84.12
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 84.04
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 83.86
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 83.71
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 83.67
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 83.67
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 83.65
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 83.59
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 83.59
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 83.55
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 83.53
2eyu_A261 Twitching motility protein PILT; pilus retraction 83.5
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 83.43
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 83.35
1b0u_A262 Histidine permease; ABC transporter, transport pro 83.33
1g6h_A257 High-affinity branched-chain amino acid transport 83.32
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 83.3
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 83.19
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 83.15
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 83.08
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 83.02
1sgw_A214 Putative ABC transporter; structural genomics, P p 82.95
1ji0_A240 ABC transporter; ATP binding protein, structural g 82.93
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 82.92
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 82.86
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 82.85
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 82.84
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 82.81
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 82.61
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 82.55
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 82.45
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 82.35
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 82.35
2ghi_A260 Transport protein; multidrug resistance protein, M 82.33
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 82.26
4a74_A231 DNA repair and recombination protein RADA; hydrola 82.12
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 82.03
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 81.89
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 81.83
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 81.82
3tlx_A243 Adenylate kinase 2; structural genomics, structura 81.71
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 81.69
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 81.65
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 81.52
3pg5_A361 Uncharacterized protein; structural genomics, PSI- 81.46
3kta_A182 Chromosome segregation protein SMC; structural mai 81.44
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 81.38
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 81.34
1via_A175 Shikimate kinase; structural genomics, transferase 81.33
2kjq_A149 DNAA-related protein; solution structure, NESG, st 81.22
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 81.17
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 81.07
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 81.05
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 81.03
1d1n_A99 Initiation factor 2; beta-barrel, gene regulation; 81.01
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 80.99
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 80.92
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 80.91
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 80.8
3io5_A333 Recombination and repair protein; storage dimer, i 80.63
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 80.52
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 80.47
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 80.42
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 80.05
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-144  Score=1310.74  Aligned_cols=782  Identities=61%  Similarity=1.011  Sum_probs=692.6

Q ss_pred             eeEEEEEcccccCCCCChhHHHHHHHHHcCCcccccCCceeecCChhhHhhhCcccccceEEEEeecchhhhhccccccC
Q 003804            7 TTISVCLGPDANSTFAGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALKSYRGERQ   86 (794)
Q Consensus         7 ~~~~v~i~~~vG~~~~GKTTL~~~Ll~~~g~i~~~~~G~~~~~D~~~~E~~rgiTi~~~~~~~~~~~~~~~~~~~~~~~~   86 (794)
                      ...||+|   +||+|||||||+++|++.+|.+.+...|.++++|++++|++||+|+.++..++.|........++....+
T Consensus        18 ~~rnI~I---iG~~~~GKTTL~~~Ll~~~g~i~~~~~~~~~~~D~~~~E~~rgiTI~~~~~~~~~~~~~~~~~~i~~~~~   94 (842)
T 1n0u_A           18 NVRNMSV---IAHVDHGKSTLTDSLVQRAGIISAAKAGEARFTDTRKDEQERGITIKSTAISLYSEMSDEDVKEIKQKTD   94 (842)
T ss_dssp             GEEEEEE---ECCGGGTHHHHHHHHHHHHBCCBC------------------CCCBCCCEEEEEEECCHHHHHHCSSCCC
T ss_pred             cccEEEE---ECCCCCCHHHHHHHHHHhcCCcccccCCCceeecCchhhhhcceeEeeceeEEEeccccccccccccccc
Confidence            4679999   9999999999999999999988775556678999999999999999999999998621111111111234


Q ss_pred             CCceEEEEEcCCCccchHHHHHHhhhccCceEEEEeCCCCcchhHHHHHHHHHhcCCccEEEEecCccchhccCCCHHHH
Q 003804           87 GNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVDGEEA  166 (794)
Q Consensus        87 ~~~~~inlIDTPGh~df~~e~~~~l~~~D~ailvvda~~gv~~qt~~~~~~~~~~~~~~iv~iNKiD~~~~~~~~~~~~~  166 (794)
                      ++++.+||||||||.||..++.++++.+|+||+|||+++|++.||..+|+++...++|+++|+||+|+...+++++++++
T Consensus        95 ~~~~~i~liDTPG~~df~~~~~~~l~~aD~ailVvDa~~g~~~qt~~~~~~~~~~~~p~ilviNK~D~~~~e~~~~~~e~  174 (842)
T 1n0u_A           95 GNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINKVDRALLELQVSKEDL  174 (842)
T ss_dssp             SSEEEEEEECCCCCCSSCHHHHHHHHTCSEEEEEEETTTBSCHHHHHHHHHHHHTTCEEEEEEECHHHHHHTSCCCHHHH
T ss_pred             CCCceEEEEECcCchhhHHHHHHHHHhCCEEEEEEeCCCCCCHHHHHHHHHHHHcCCCeEEEEECCCcchhhhccCHHHH
Confidence            45799999999999999999999999999999999999999999999999999999999999999999988999999999


Q ss_pred             HHHHHHHHHHhhhhhhcccCCCCCCceeeccCceeeeccCccceeeehhhHHHHHhhhcCCChHhHHHHhhcccccCCCC
Q 003804          167 YQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPAT  246 (794)
Q Consensus       167 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~v~~~s~~~g~~~~~~~~a~~~~~~~~id~~~l~~~~wg~~~~~~~~  246 (794)
                      +..+++++++++..+..|.+...|++.+.|..++++|+|+.+||+|++++|++.|.++|+++...+.+++||++||++++
T Consensus       175 ~~~~~~~~~~i~~~l~~~~~~~~~~~~~~p~~~~v~~~sa~~g~~~~~~~f~~~y~~~~~~~~~~l~~~~~~d~~~~~~~  254 (842)
T 1n0u_A          175 YQTFARTVESVNVIVSTYADEVLGDVQVYPARGTVAFGSGLHGWAFTIRQFATRYAKKFGVDKAKMMDRLWGDSFFNPKT  254 (842)
T ss_dssp             HHHHHHHHHHHHHHHHHHSCGGGCCCCCCGGGTCEEEEETTTTEEEEHHHHHHHHHTTTTSCHHHHHHHTSSSCEEETTT
T ss_pred             HHHHHHHHHHHHHHHhhccccccCceeeceEEeeeEEeecccccccchhhhhhhcchhcCCCHHHHHHHHhccccccCCC
Confidence            99999999999999877665555666788999999999999999999999999999999999999999999999998877


Q ss_pred             CceeecC--CCCCcchhhHhHHhhchHHHHHHHHhccChhhHHHHHhhcCCcCCHHHHHHhHHHHHHHHHhccccchHHH
Q 003804          247 RKWTSRN--TGSPTCKRGFVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLPASSAL  324 (794)
Q Consensus       247 ~~~~~~~--~~~~~~~~~~~~~~l~p~~~l~e~~~~~d~~~le~~l~~~~~~l~~~el~~~~~~l~~~i~~~~~P~~~~L  324 (794)
                      ++|...+  .++...++.|++++++|+|+|++++++.|+++|++||+++|++++.++++.+.++|+++++++|+|++++|
T Consensus       255 ~~~~~~~i~~~~~~~~~~f~~~~~~~~~~l~e~~~~~d~~~~e~~l~~~g~~l~~~e~~~~~~~l~~~~~~~~~pv~~~L  334 (842)
T 1n0u_A          255 KKWTNKDTDAEGKPLERAFNMFILDPIFRLFTAIMNFKKDEIPVLLEKLEIVLKGDEKDLEGKALLKVVMRKFLPAADAL  334 (842)
T ss_dssp             TEEESCSBCTTCCBCCBHHHHHTHHHHHHHHHHHHTTCTTHHHHHHHHTTCCCCGGGGGCCHHHHHHHHHHHHSBHHHHH
T ss_pred             CeEEEecCCchhhhhhHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHcCCCCCHHHHhhhhHHHHHHHHhhccchHHHH
Confidence            6776543  22344578999999999999999999999999999999999999999988788999999999999999999


Q ss_pred             HHHHHhcCCChhhhhhhhhccccCCCCcccccccccccCCCCCeEEEEEEeeecCCCCcceEEEEEEeeeecCCCEEEEc
Q 003804          325 LEMMIFHLPSPATAQKYRVENLYEGPLDDAYANAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGKVATGLKVRIM  404 (794)
Q Consensus       325 Ld~i~~~lPsP~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~plva~VfK~~~~~~~g~~l~~~RV~sG~L~~g~~l~v~  404 (794)
                      ||+|++|+|||.+++.++...+|.|+.+++....++.|++++|++|+|||+..+++.|++++|+|||||+|++|+.|+++
T Consensus       335 Ld~i~~~lPsP~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~p~~a~VfK~~~~~~~G~~l~~~RV~sG~l~~g~~v~v~  414 (842)
T 1n0u_A          335 LEMIVLHLPSPVTAQAYRAEQLYEGPADDANCIAIKNCDPKADLMLYVSKMVPTSDKGRFYAFGRVFAGTVKSGQKVRIQ  414 (842)
T ss_dssp             HHHHHHHSCCHHHHHHHHHHHHBSSCTTSHHHHHHHTTCTTSSCEEEEEEEEEBSSTTCEEEEEEEEESEEETTCEEEEE
T ss_pred             HHHHHHhCCChhHhcccccccccCCcccccccceeeccCCCCCeEEEEEeeeecCCCCceEEEEEEEeeeecCCCEEEec
Confidence            99999999999999888887777765443334456789999999999999999999997799999999999999999999


Q ss_pred             CCCCCCCCccccceeeeceEEEEecCceeeeCcccCCCEEEEeccccccccceeeecCCCCCcccccccccCCCceEEEE
Q 003804          405 GPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVA  484 (794)
Q Consensus       405 ~~n~~~~~~~~~~~~kv~~l~~~~g~~~~~v~~a~AGdI~ai~gl~~~~~~tgTl~~~~~~~~~~~~~~~~~~~Pv~~~a  484 (794)
                      ++++++++.+++..+||++|++++|+++++|++|.|||||+|.||+++.+++||||+...  +..+.++.++.+|+++++
T Consensus       415 ~~~~n~~~~~~~~~~rv~~l~~~~g~~~~~v~~~~aGdI~ai~gl~~~~~~t~Tl~~~~~--~~~l~~~~~~~~Pv~~~a  492 (842)
T 1n0u_A          415 GPNYVPGKKDDLFIKAIQRVVLMMGRFVEPIDDCPAGNIIGLVGIDQFLLKTGTLTTSET--AHNMKVMKFSVSPVVQVA  492 (842)
T ss_dssp             CTTCCSSSCTTEEEEECCEEEEEETTEEEEESEEETTCEEEEESCTTTCCSSEEEESCTT--CCCBCCCCCCCSCCEEEE
T ss_pred             cccccCCCCcccceEEeeeeEeeccCcccccceeCCCCEEEEEccccceecceeecCCCC--ccccccCCCCCCceEEEE
Confidence            888776655444468999999999999999999999999999999998778889998776  778889998767999999


Q ss_pred             EEeCCCCCHhHHHHHHHHHHhcCCcEEEEEcCCCcEEEEecchhHHHHHHHHHHhhccCCeeeEEcCcEEEEEeeccccc
Q 003804          485 VQCKVASDLPKLVEGLKRLAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKS  564 (794)
Q Consensus       485 Iep~~~~d~~kl~~aL~~L~~eDPsl~v~~~etge~il~g~GelHLei~~~~L~~~f~~~v~v~~~~p~V~yrETi~~~~  564 (794)
                      |+|+++.|++||.+||++|++|||+|++.++||||++|+|||||||||+++||+++| +|+++++++|+|+|||||++++
T Consensus       493 vep~~~~d~~kl~~~L~kL~~eDp~l~v~~~etge~il~g~GelHLei~~~rL~~~f-~~vev~~~~P~V~yrETi~~~~  571 (842)
T 1n0u_A          493 VEVKNANDLPKLVEGLKRLSKSDPCVLTYMSESGEHIVAGTGELHLEICLQDLEHDH-AGVPLKISPPVVAYRETVESES  571 (842)
T ss_dssp             EEESSGGGHHHHHHHHHHHHHHCTTCEEEECTTSCEEEEESSHHHHHHHHHHHHHTT-SCSCEEEECCCCCCEEEESSCC
T ss_pred             EEECCHHHHHHHHHHHHHHHHhCCcEEEEEcCCCCEEEEeccHHHHHHHHHHHHHHh-cCCceEecCcEEEEEEeecccc
Confidence            999999999999999999999999999999999999999999999999999999999 7999999999999999999999


Q ss_pred             ceeEeecCCCceeEEEEEEeeCCccchhhhccCCCCCC-----------------------------------------C
Q 003804          565 CRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPR-----------------------------------------D  603 (794)
Q Consensus       565 ~~~~~~~~~~~~~~v~~~~ePl~~~~~~~i~~g~i~~~-----------------------------------------~  603 (794)
                      +..++.+++++|+++++++||++.++...++.|.+...                                         .
T Consensus       572 ~~~~~~~~~~~~~~v~~~~ePl~~~~~~~~~~g~v~~~~~~~~~~~~l~~~~~~d~~~~~~iw~~~p~~~~~~~f~~~~~  651 (842)
T 1n0u_A          572 SQTALSKSPNKHNRIYLKAEPIDEEVSLAIENGIINPRDDFKARARIMADDYGWDVTDARKIWCFGPDGNGPNLVIDQTK  651 (842)
T ss_dssp             SSCEEEECTTSSCEEEEEEEECCHHHHHHHHTTSSCTTSCHHHHHHHHHHTTCCCHHHHHTEEEESSTTTSSEEEEECCC
T ss_pred             ccceeeccCCcceEEEEEEEECcHHHhhHhhcCeecccccHHHHHHHHHHhcCcchhhhhceeeeccCCCCCcEEEecCC
Confidence            88888888999999999999999877666666643110                                         0


Q ss_pred             CccchHHhHHHHHHHHHHHHHcCCcCCCCeeeEEEEEEeeeecccccccCcCchHHHHHHHHHHHHHhcCCceecCeEEE
Q 003804          604 DPKYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLV  683 (794)
Q Consensus       604 ~~~~~~~i~~~i~~g~~~a~~~Gpl~g~pv~~v~v~l~d~~~~~ds~~~~~~~~~~a~~~a~~~al~~a~~~llEPi~~~  683 (794)
                      +..|+++++++|++||+||+++|||||+||+||+|+|+||++|.|+++++++||++|+++||++|+++|+|+||||||+|
T Consensus       652 g~~~~~~~~~~v~~G~~~a~~~G~L~g~pv~~v~v~l~dg~~h~d~~~~~~g~f~~a~~~a~~~a~~~a~p~LLEPi~~v  731 (842)
T 1n0u_A          652 AVQYLHEIKDSVVAAFQWATKEGPIFGEEMRSVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLADPKIQEPVFLV  731 (842)
T ss_dssp             CCTTHHHHHHHHHHHHHHHHHSCTTTSCCBCSEEEEEEEEECCSSGGGSSHHHHHHHHHHHHHHHHHHSCEEEEEEEEEE
T ss_pred             CccccHHHHHHHHHHHHHHHhcCCcCCceeeeEEEEEEEeeecCCccccchhHHHHHHHHHHHHHHHhCCCeEEeeEEEE
Confidence            12388899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEeccCcchhHHHHhhhcccceeeeeccCCCCcEEEEEEechhhhhCchHHHhhhcCCceEeeeEeccccccCCCCCCC
Q 003804          684 EIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRAATSGQAFPQCVFDHWDMMSSDPLEP  763 (794)
Q Consensus       684 eI~~p~~~~g~v~~~L~~rrg~i~~~~~~~~~~~~~I~a~vP~~e~~~y~~~Lrs~T~G~g~~~~~f~~y~~~~~~~~~~  763 (794)
                      +|+||++++|+|++||++|||+|+++++.+|+++++|+|++|++|||||+++|||+|+|+|+|+|+|+||++||++|+++
T Consensus       732 eI~vP~e~~G~V~~dL~~RRG~i~~~~~~~g~~~~~I~a~vP~aE~fgy~~~LRs~T~G~g~~~~~F~~y~~vp~~~~~~  811 (842)
T 1n0u_A          732 EIQCPEQAVGGIYSVLNKKRGQVVSEEQRPGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVFDHWSTLGSDPLDP  811 (842)
T ss_dssp             EEEECGGGHHHHHHHHHTTTCEEEEEEC---CCCEEEEEEEEGGGCTTHHHHHHHHTTTCCEEEEEEEEEEECCSCTTCT
T ss_pred             EEEccHHHHHHHHHHHHhcCcEEeccccCCCCceEEEEEEcChHHhhhhHHHHHhhCCCCceEEEEeccceeCCCCccch
Confidence            99999999999999999999999999987766789999999999999999999999999999999999999999999999


Q ss_pred             ChhHHHHHHHHHHhcCCCCCCCCcccccccC
Q 003804          764 GSQASQLVLDIRKRKGLKEQMTPLSEYEDKL  794 (794)
Q Consensus       764 ~~~~~~~~~~~r~rkGl~~~~~~~~~~~~~l  794 (794)
                      +|+|+++|+++|+||||++++|.+++|+|+|
T Consensus       812 ~~~a~~~~~~~R~rKGl~~~~p~~~~~~d~~  842 (842)
T 1n0u_A          812 TSKAGEIVLAARKRHGMKEEVPGWQEYYDKL  842 (842)
T ss_dssp             TSHHHHHHHHHHHHTTCCSSCCCGGGGCCCC
T ss_pred             hhHHHHHHHHHHHhCCCCCCCCCHHHhccCC
Confidence            9999999999999999999999999999997
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3e3x_A BIPA; MCSG,PSI2, structural genomics, protein struct initiative, midwest center for structural genomics, GTP-BIN nucleotide-binding; HET: MLZ MLY; 1.95A {Vibrio parahaemolyticus} Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3e1y_E Eukaryotic peptide chain release factor GTP-bindi ERF3A; translation termination, peptide release, PTC, P biosynthesis, GTP-binding; HET: ATP; 3.80A {Homo sapiens} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2cve_A Hypothetical protein TTHA1053; COG1739, UPF0029, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: TLA; 1.60A {Thermus thermophilus} SCOP: d.14.1.11 d.58.11.2 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>1vi7_A Hypothetical protein YIGZ; structural genomics, unknown function; 2.80A {Escherichia coli} SCOP: d.14.1.11 d.58.11.2 Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>3lh2_S 4E10_1VI7A_S0_002_N (T88); epitope-scaffold, immune system; 2.65A {Artificial gene} Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>1xe1_A Hypothetical protein PF0907; structural genomics, unknown function, protein structure INI secsg, conserved hypothetical protein; HET: MSE; 2.00A {Pyrococcus furiosus} SCOP: b.43.3.1 Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2wbm_A MTHSBDS, ribosome maturation protein SDO1 homolog; shwachman-bodian-diamond syndrome protein; 1.75A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1t95_A Hypothetical protein AF0491; shwachman-bodian-diamond syndrome protein orthologue, unknown function; 1.90A {Archaeoglobus fulgidus} SCOP: a.5.8.1 d.235.1.2 d.58.11.3 PDB: 1p9q_C Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1d1n_A Initiation factor 2; beta-barrel, gene regulation; NMR {Geobacillus stearothermophilus} SCOP: b.43.3.1 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 794
d1n0ua2341 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N- 1e-110
d1n0ua1138 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), 4e-49
d1n0ua3165 d.14.1.1 (A:561-725) Elongation factor 2 (eEF-2), 5e-42
d1n0ua5117 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) 9e-41
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 6e-24
d1n0ua479 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2) 8e-24
d2bv3a589 d.58.11.1 (A:600-688) Elongation factor G (EF-G) { 5e-23
d2bv3a2276 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-t 8e-23
d2dy1a596 d.58.11.1 (A:570-665) Elongation factor G (EF-G) { 2e-20
d1d2ea3196 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), 3e-17
d2bv3a475 d.58.11.1 (A:404-478) Elongation factor G (EF-G) { 3e-16
d1f60a3239 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N 1e-15
d1jnya3224 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N 3e-15
d2dy1a477 d.58.11.1 (A:378-454) Elongation factor G (EF-G) { 4e-13
d2qn6a3205 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma su 4e-11
d1zunb3222 c.37.1.8 (B:16-237) Sulfate adenylate transferase 6e-10
d2dy1a1103 b.43.3.1 (A:275-377) Elongation factor G (EF-G), d 1e-08
d1r5ba3245 c.37.1.8 (A:215-459) Eukaryotic peptide chain rele 2e-07
d1yrba1244 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB09 2e-07
d2dy1a2267 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-t 9e-07
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 1e-06
d2bv3a1121 b.43.3.1 (A:283-403) Elongation factor G (EF-G), d 1e-04
d1kk1a3195 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma su 0.001
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 341 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor 2 (eEF-2), N-terminal (G) domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  337 bits (865), Expect = e-110
 Identities = 195/314 (62%), Positives = 248/314 (78%), Gaps = 2/314 (0%)

Query: 22  AGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALKSY 81
            GKSTLTDSLV  AGII+   AG+ R TDTR+DE ERGITIKST ISLY EM+D  +K  
Sbjct: 28  HGKSTLTDSLVQRAGIISAAKAGEARFTDTRKDEQERGITIKSTAISLYSEMSDEDVKEI 87

Query: 82  RGERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGE 141
           + +  GN +LINLIDSPGHVDFSSEVTAALR+TDGALVVVD IEGVCVQTETVLRQALGE
Sbjct: 88  KQKTDGNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGE 147

Query: 142 RIRPVLTVNKMDRCFLELQVDGEEAYQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTV 201
           RI+PV+ +NK+DR  LELQV  E+ YQTF + +E+ NVI++TY D +LGDVQVYP +GTV
Sbjct: 148 RIKPVVVINKVDRALLELQVSKEDLYQTFARTVESVNVIVSTYADEVLGDVQVYPARGTV 207

Query: 202 AFSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATRKWTSRNTGS--PTC 259
           AF +GLHGWAFT+  FA  YA KFGVD++KMM+RLWG++FF+P T+KWT+++T +     
Sbjct: 208 AFGSGLHGWAFTIRQFATRYAKKFGVDKAKMMDRLWGDSFFNPKTKKWTNKDTDAEGKPL 267

Query: 260 KRGFVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLP 319
           +R F  F  +PI ++    MN +KD++  +L+KL + +K +EK+L GKAL+K VM+ +LP
Sbjct: 268 ERAFNMFILDPIFRLFTAIMNFKKDEIPVLLEKLEIVLKGDEKDLEGKALLKVVMRKFLP 327

Query: 320 ASSALLEMMIFHLP 333
           A+ ALLEM++ HLP
Sbjct: 328 AADALLEMIVLHLP 341
>d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 138 Back     information, alignment and structure
>d1n0ua3 d.14.1.1 (A:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 165 Back     information, alignment and structure
>d1n0ua5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 117 Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure
>d1n0ua4 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 79 Back     information, alignment and structure
>d2bv3a5 d.58.11.1 (A:600-688) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} Length = 89 Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 276 Back     information, alignment and structure
>d2dy1a5 d.58.11.1 (A:570-665) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 96 Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 196 Back     information, alignment and structure
>d2bv3a4 d.58.11.1 (A:404-478) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} Length = 75 Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 239 Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 224 Back     information, alignment and structure
>d2dy1a4 d.58.11.1 (A:378-454) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 77 Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 205 Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 222 Back     information, alignment and structure
>d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 103 Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 245 Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Length = 244 Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 267 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} Length = 121 Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 195 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query794
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 100.0
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 100.0
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 100.0
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 100.0
d1n0ua5117 Elongation factor 2 (eEF-2) {Baker's yeast (Saccha 99.97
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.97
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.97
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.95
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.94
d1n0ua1138 Elongation factor 2 (eEF-2), domain II {Baker's ye 99.94
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.93
d2dy1a596 Elongation factor G (EF-G) {Thermus thermophilus, 99.92
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.9
d1n0ua3165 Elongation factor 2 (eEF-2), domain IV {Baker's ye 99.89
d2bv3a589 Elongation factor G (EF-G) {Thermus thermophilus [ 99.88
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.88
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.86
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.86
d1n0ua479 Elongation factor 2 (eEF-2) {Baker's yeast (Saccha 99.86
d2dy1a477 Elongation factor G (EF-G) {Thermus thermophilus, 99.84
d2bv3a3121 Elongation factor G (EF-G), domain IV {Thermus the 99.82
d2bv3a475 Elongation factor G (EF-G) {Thermus thermophilus [ 99.81
d2bv3a1121 Elongation factor G (EF-G), domain II {Thermus the 99.77
d2dy1a3115 Elongation factor G (EF-G), domain IV {Thermus the 99.77
d2dy1a1103 Elongation factor G (EF-G), domain II {Thermus the 99.72
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.5
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.49
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.39
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.35
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.29
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.28
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.25
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.24
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.24
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.23
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.22
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.22
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.2
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.19
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.18
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.16
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.15
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.15
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.14
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.12
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.12
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.11
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.11
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.11
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.09
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.08
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.07
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.07
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.06
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.05
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.04
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.02
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.01
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.01
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.01
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.01
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.01
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.0
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.0
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 98.99
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 98.99
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 98.99
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 98.97
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 98.96
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 98.96
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 98.96
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.94
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 98.93
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 98.92
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 98.91
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 98.88
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.85
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.82
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 98.82
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.81
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 98.79
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 98.79
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 98.75
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.7
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.69
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.67
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 98.64
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.62
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.61
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 98.6
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 98.47
d1f60a194 Elongation factor eEF-1alpha, domain 2 {Baker's ye 98.11
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.02
d1jnya195 Elongation factor eEF-1alpha, domain 2 {Archaeon S 97.99
d1efca192 Elongation factor Tu (EF-Tu), domain 2 {Escherichi 97.97
d2c78a1100 Elongation factor Tu (EF-Tu), domain 2 {Thermus th 97.94
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 97.94
d1r5ba195 Eukaryotic peptide chain release factor ERF2, post 97.72
d1d2ea198 Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos t 97.7
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 97.64
d1wb1a192 Elongation factor SelB, domains 2 and 4 {Methanoco 97.59
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.42
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.4
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 97.4
d1zunb192 Sulfate adenylate transferase subunit cysN/C, EF-T 97.39
d1s0ua1118 Initiation factor eIF2 gamma subunit, domain II {A 97.26
d1kk1a1121 Initiation factor eIF2 gamma subunit, domain II {A 97.21
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 97.17
d1xe1a_91 Hypothetical protein PF0907 {Pyrococcus furiosus [ 97.11
d1vmaa2213 GTPase domain of the signal recognition particle r 97.06
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.06
d2qy9a2211 GTPase domain of the signal recognition particle r 96.98
d1okkd2207 GTPase domain of the signal recognition particle r 96.95
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 96.91
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.79
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.71
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.69
d2qn6a1114 Initiation factor eIF2 gamma subunit, domain II {S 96.4
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 96.17
d1vi7a271 Hypothetical protein YigZ, C-terminal domain {Esch 95.91
d1g7sa2128 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 95.47
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 95.28
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 94.93
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 93.84
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 93.72
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 93.61
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 93.51
d1g7sa1101 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 93.25
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 93.12
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 93.04
d1t95a373 Hypothetical protein AF0491, C-terminal domain {Ar 92.98
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 92.07
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 92.07
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 92.03
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 91.85
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 91.52
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 91.02
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 90.68
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 90.42
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.0
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 89.78
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 89.77
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 89.7
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 89.69
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.44
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 89.33
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 89.2
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 89.04
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 89.01
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 88.98
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 88.31
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 88.23
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 88.22
d1d1na_99 Initiation factor IF2/eIF5b, domains 2 and 4 {Baci 88.19
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 88.12
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 87.54
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 87.42
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 87.25
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 86.96
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 86.86
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 86.5
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 86.47
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 86.18
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 86.14
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 86.08
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 86.01
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 85.92
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 85.78
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 85.77
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 85.63
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 85.38
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 85.29
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 85.19
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 85.17
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 85.13
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 84.93
d2awna2232 Maltose transport protein MalK, N-terminal domain 84.9
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 84.9
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 84.82
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 84.75
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 84.64
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 84.52
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 84.33
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 84.02
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 83.65
d1g2912240 Maltose transport protein MalK, N-terminal domain 83.65
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 83.46
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 83.44
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 83.2
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 83.11
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 83.04
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 82.75
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 81.78
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 81.71
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 81.58
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 80.8
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 80.7
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 80.47
d2hyda1255 Putative multidrug export ATP-binding/permease pro 80.28
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 80.21
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 80.06
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor 2 (eEF-2), N-terminal (G) domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=3.5e-62  Score=525.44  Aligned_cols=324  Identities=60%  Similarity=0.973  Sum_probs=284.4

Q ss_pred             eeEEEEEcccccCCCCChhHHHHHHHHHcCCcccccCCceeecCChhhHhhhCcccccceEEEEeecchhhhhccccccC
Q 003804            7 TTISVCLGPDANSTFAGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALKSYRGERQ   86 (794)
Q Consensus         7 ~~~~v~i~~~vG~~~~GKTTL~~~Ll~~~g~i~~~~~G~~~~~D~~~~E~~rgiTi~~~~~~~~~~~~~~~~~~~~~~~~   86 (794)
                      ...||||   +||+|||||||+++|++.+|.+++...|+.+++|++++|++||+|++++.+++.|..............+
T Consensus        16 ~IRNI~i---iGhvd~GKTTL~d~Ll~~~g~i~~~~~~~~~~~D~~~~E~eRgiTi~~~~~~l~~~~~~~~~~~~~~~~~   92 (341)
T d1n0ua2          16 NVRNMSV---IAHVDHGKSTLTDSLVQRAGIISAAKAGEARFTDTRKDEQERGITIKSTAISLYSEMSDEDVKEIKQKTD   92 (341)
T ss_dssp             GEEEEEE---ECCGGGTHHHHHHHHHHHHBCCBC------------------CCCBCCCEEEEEEECCHHHHHHCSSCCC
T ss_pred             cCcEEEE---EeCCCCcHHHHHHHHHHHCCCccccccccccccccchhHHhcCceEeCCEEEEEeccCcccccchhcccc
Confidence            3458999   9999999999999999999999887677788999999999999999999999999755443333444556


Q ss_pred             CCceEEEEEcCCCccchHHHHHHhhhccCceEEEEeCCCCcchhHHHHHHHHHhcCCccEEEEecCccchhccCCCHHHH
Q 003804           87 GNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVDGEEA  166 (794)
Q Consensus        87 ~~~~~inlIDTPGh~df~~e~~~~l~~~D~ailvvda~~gv~~qt~~~~~~~~~~~~~~iv~iNKiD~~~~~~~~~~~~~  166 (794)
                      .+++.|||||||||.||..|+.+|++.+|+||+||||.+|++.||+++|++|.++++|+++|||||||.+.|+...++++
T Consensus        93 ~~~~~inliDtPGh~dF~~ev~~al~~~D~allVVda~eGv~~qT~~~~~~a~~~~~p~i~viNKiDr~~~el~~~~~~~  172 (341)
T d1n0ua2          93 GNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINKVDRALLELQVSKEDL  172 (341)
T ss_dssp             SSEEEEEEECCCCCCSSCHHHHHHHHTCSEEEEEEETTTBSCHHHHHHHHHHHHTTCEEEEEEECHHHHHHTSCCCHHHH
T ss_pred             ccceEEEEEcCCCcHHHHHHHHHHHhhcCceEEEEecccCcchhHHHHHHHHHHcCCCeEEEEECcccccccHHhhHHHH
Confidence            78899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhhhhhcccCCCCCCceeeccCceeeeccCccceeeehhhHHHHHhhhcCCChHhHHHHhhcccccCCCC
Q 003804          167 YQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPAT  246 (794)
Q Consensus       167 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~v~~~s~~~g~~~~~~~~a~~~~~~~~id~~~l~~~~wg~~~~~~~~  246 (794)
                      |++++++++.+|..+..+.+...+++.++|..+||.|+|+.+||+|++++||++|+++++++...+.++|||++||++++
T Consensus       173 ~~~l~~~i~~vn~~i~~~~~~~~~~~~~~P~~gnV~FaSa~~g~~Ftl~~fa~~y~~k~~~~~~~l~~~LWGd~y~~~~~  252 (341)
T d1n0ua2         173 YQTFARTVESVNVIVSTYADEVLGDVQVYPARGTVAFGSGLHGWAFTIRQFATRYAKKFGVDKAKMMDRLWGDSFFNPKT  252 (341)
T ss_dssp             HHHHHHHHHHHHHHHHHHSCGGGCCCCCCGGGTCEEEEETTTTEEEEHHHHHHHHHTTTTSCHHHHHHHTSSSCEEETTT
T ss_pred             HHHHcCccccccceeeecccccccccccCcccCceEecccccCeEEeeHHHHHHHHHHhCCCHHHHHHHhccCccccccc
Confidence            99999999999999988877766778899999999999999999999999999999999999999999999999999999


Q ss_pred             CceeecCC--CCCcchhhHhHHhhchHHHHHHHHhccChhhHHHHHhhcCCcCCHHHHHHhHHHHHHHHHhccccchHHH
Q 003804          247 RKWTSRNT--GSPTCKRGFVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLPASSAL  324 (794)
Q Consensus       247 ~~~~~~~~--~~~~~~~~~~~~~l~p~~~l~e~~~~~d~~~le~~l~~~~~~l~~~el~~~~~~l~~~i~~~~~P~~~~L  324 (794)
                      ++|...+.  .++.+++.|++|+|+|+|+++.++.+.+.+.+.++++++|+.++.++.+.+.+.|++.+|++|+|...+|
T Consensus       253 kk~~~~~~~~~~~~lk~~FVqfILepI~ki~~~~~~~~~~~l~k~l~~l~i~l~~~~~~~~~k~llk~v~~~~~~~~~~l  332 (341)
T d1n0ua2         253 KKWTNKDTDAEGKPLERAFNMFILDPIFRLFTAIMNFKKDEIPVLLEKLEIVLKGDEKDLEGKALLKVVMRKFLPAADAL  332 (341)
T ss_dssp             TEEESCSBCTTCCBCCBHHHHHTHHHHHHHHHHHHTTCTTHHHHHHHHTTCCCCGGGGGCCHHHHHHHHHHHHSBHHHHH
T ss_pred             ceeeccCCcccCCcccceeeeeeHHHHHHHHHHHhhcchhHHHHHHHHcCcccChHhhccchHHHHHHHHHHHcCchhHH
Confidence            99886653  4456789999999999999999999999999999999999999999998889999999999999999999


Q ss_pred             HHHHHhcCC
Q 003804          325 LEMMIFHLP  333 (794)
Q Consensus       325 Ld~i~~~lP  333 (794)
                      ||+|+.++|
T Consensus       333 l~~iv~~iP  341 (341)
T d1n0ua2         333 LEMIVLHLP  341 (341)
T ss_dssp             HHHHHHHSC
T ss_pred             HHHHHHhCc
Confidence            999999998
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n0ua5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2dy1a5 d.58.11.1 (A:570-665) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n0ua3 d.14.1.1 (A:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bv3a5 d.58.11.1 (A:600-688) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1n0ua4 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy1a4 d.58.11.1 (A:378-454) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2bv3a3 d.14.1.1 (A:479-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bv3a4 d.58.11.1 (A:404-478) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a3 d.14.1.1 (A:455-569) Elongation factor G (EF-G), domain IV {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi7a2 d.58.11.2 (A:138-208) Hypothetical protein YigZ, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1g7sa1 b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t95a3 d.58.11.3 (A:162-234) Hypothetical protein AF0491, C-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1na_ b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 2 and 4 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure