Citrus Sinensis ID: 003814

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790---
MIVGLAGWLAEYVRGRRRILLSNYEQNAVLLNRSRLDFDISPLNHYCTSILLQNLSLSVSFYANSKCLFRQFFHWSKSMILSNGLSVQSRYGNGLSIDTCFPEIKSVTNSSCKSFGEDDVSTGVCSDDDISLKDAFGPGFFYHANYGPSSNGASGNQNSHLQPPQAISSSIDFFEARGPDAHVVLDPSIWPMYASSDQVPSTSAELSRAAADESSGFAQPAVSLSQPGAVSGGVERNCFTSYAPLHLAALKGDWDFARNFFNLNPEAVCVRISRNQDTALHIAAGARRTLFVQELVNLMTPEDLALRNKVGNTALCFAAVSGVTKIAEVMVNKNRELPSIRGNKGATPLCMAALLGHKEMIWYLYSVTKEEDLKEEDRIELLVAVIDAGLYDVALDLIQHHPQLAMARDGNGETALHVLARKPSAFASGSQLGFWRRCIYSVPGMRAILDPKLMHLQALELVKRLWEQVLLLDDSKIGELLRKPSRLLFTAVELGNVEFLMVLIQMYPNLIWKVDDHSRSMFHIAVVHRQEKIFNLIYELGAHKDLIASYKDENNNNMLHLAGKLAPPDRLKIDSGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTPHILFSEEHRRLVREGEKWMKDTASSCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFLHYKSFMVFAVSDALALFCSATSILMFLSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMAAFAATLFIVLGDDFVWIAIPIATGACVPVSLFALLQFPLLSDMISHLYKYSIFTRRSNHLLY
cccHHHHHHHHHHHcccEEEEEccccHHHHHcccccccccccccHHHHHHHHHHHcccccccccccHHHHHHcHHHHHHHHHccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccHHHHHHHHHccccccccccccccHHHHHcccccccHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccHHcccccccccHHHHHHHcccHHHHHHHHHcccHHHHcccccccccHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccccccccccccHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccHHHHcccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
cccHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccccccccccccHHHHHHHHHccEEEEEEcccHHHHHHHHHHcHHHHHHccccHHHHHHccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccHHcHcccHHHHHHHccccccccccHHHccHHHHHHcccHHHHHHHHccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccEcccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccHHHHHHHcccHHHHHHHHHHcHHHHccccHHHHHHHcccHHHHHHHHHccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEHcccHHHEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEcc
MIVGLAGWLAEYVRGRRRILLSNYEQNAVLLNRsrldfdisplnhYCTSILLQNLSLSVSFYANSKCLFRQFFHWSksmilsnglsvqsrygnglsidtcfpeiksvtnsscksfgeddvstgvcsdddislkdafgpgffyhanygpssngasgnqnshlqppqaisssidffeargpdahvvldpsiwpmyassdqvpstsAELSRAaadessgfaqpavslsqpgavsggverncftsyapLHLAALKGDWDFARNFFNLNPEAVCVRISRNQDTALHIAAGARRTLFVQELVNLMTPEDLALRNKVGNTALCFAAVSGVTKIAEVMVNKnrelpsirgnkgatpLCMAALLGHKEMIWYLYSvtkeedlkeEDRIELLVAVIDAGLYDVALDLIQhhpqlamardgngeTALHVLArkpsafasgsqlgfWRRCiysvpgmraildPKLMHLQALELVKRLWEQVLLLDdskigellrkpsRLLFTAVELGNVEFLMVLIQMYPNliwkvddhsrsMFHIAVVHRQEKIFNLIYELGAHKDLIASYkdennnnmlhlagklappdrlkidsGAALQLRRELHWFKEIEKVVqpsyreaknsegrtphilfsEEHRRLVREGEKWMKDTASSCMVVATLIATVMFAAAftvpggnddstgrpiflHYKSFMVFAVSDALALFCSATSILMFLSIITSRyaeedfvhslpNRLIIGLATLFISIATMMAAFAATLFIVLGDdfvwiaipiatgacvpVSLFALLQFPLLSDMISHLYKYSIFtrrsnhlly
MIVGLAGWLAEYVRGRRRILLSNYEQNAVLLNRSRLDFDISPLNHYCTSILLQNLSLSVSFYANSKCLFRQFFHWSKSMILSNGLSVQSRYGNGLSIDTCFPEIKSVTNSSCKSFGEDDVSTGVCSDDDISLKDAFGPGFFYHANYGPSSNGASGNQNSHLQPPQAISSSIDFFEARGPDAHVVLDPSIWPMYASSDQVPSTSAELSRAAADESSGFAQPAVSLSQPGAVSGGVERNCFTSYAPLHLAALKGDWDFARNFFNLNPEAVCVRISRNQDTALHIAAGARRTLFVQELVNLMTPEDLALRNKVGNTALCFAAVSGVTKIAEVMVNKNrelpsirgnkgaTPLCMAALLGHKEMIWYLYSVTKEEDLKEEDRIELLVAVIDAGLYDVALDLIQHHPQLAMARDGNGETALHVLARKPsafasgsqlgfWRRCIYSVPGMRAILDPKLMHLQALELVKRLWEQVLLLDDskigellrkpSRLLFTAVELGNVEFLMVLIQMYPNLIWKVDDHSRSMFHIAVVHRQEKIFNLIYELGAHKDLIASYKDENNNNMLHLagklappdrLKIDSGAALQLRRELHWfkeiekvvqpsyreaknsegrtphilfseehRRLVREGEKWMKDTASSCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFLHYKSFMVFAVSDALALFCSATSILMFLSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMAAFAATLFIVLGDDFVWIAIPIATGACVPVSLFALLQFPLLSDMISHLYKysiftrrsnhlly
MIVGLAGWLAEYVRGRRRILLSNYEQNAVLLNRSRLDFDISPLNHYCTSILLQNLSLSVSFYANSKCLFRQFFHWSKSMILSNGLSVQSRYGNGLSIDTCFPEIKSVTNSSCKSFGEDDVSTGVCSDDDISLKDAFGPGFFYHANYGPSSNGASGNQNSHLQPPQAISSSIDFFEARGPDAHVVLDPSIWPMYASSDQVPSTSAELSRAAADESSGFAQPAVSLSQPGAVSGGVERNCFTSYAPLHLAALKGDWDFARNFFNLNPEAVCVRISRNQDTALHIAAGARRTLFVQELVNLMTPEDLALRNKVGNTALCFAAVSGVTKIAEVMVNKNRELPSIRGNKGATPLCMAALLGHKEMIWYLYSVTKEEDLKEEDRIELLVAVIDAGLYDVALDLIQHHPQLAMARDGNGETALHVLARKPSAFASGSQLGFWRRCIYSVPGMRAILDPKLMHLQALELVKRLWEQVLLLDDSKIGELLRKPSRLLFTAVELGNVEFLMVLIQMYPNLIWKVDDHSRSMFHIAVVHRQEKIFNLIYELGAHKDLIASYKDENNNNMLHLAGKLAPPDRLKIDSGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTPHILFSEEHRRLVREGEKWMKDTASSCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFLHYKSFMVFAVSDALALFCSATSILMFLSIITSRYAEEDFVHSLPNRLIIGLATLFISiatmmaafaatlfiVLGDDFVWIAIPIATGACVPVSLFALLQFPLLSDMISHLYKYSIFTRRSNHLLY
*IVGLAGWLAEYVRGRRRILLSNYEQNAVLLNRSRLDFDISPLNHYCTSILLQNLSLSVSFYANSKCLFRQFFHWSKSMILSNGLSVQSRYGNGLSIDTCFPEIKSVTNSSCKSFGEDDVSTGVCSDDDISLKDAFGPGFFYHANY*************************DFFEARGPDAHVVLDPSIWPMY**************************************GGVERNCFTSYAPLHLAALKGDWDFARNFFNLNPEAVCVRISRNQDTALHIAAGARRTLFVQELVNLMTPEDLALRNKVGNTALCFAAVSGVTKIAEVMVNKNRELPSIRGNKGATPLCMAALLGHKEMIWYLYSVTKEEDLKEEDRIELLVAVIDAGLYDVALDLIQHHPQLAMARDGNGETALHVLARKPSAFASGSQLGFWRRCIYSVPGMRAILDPKLMHLQALELVKRLWEQVLLLDDSKIGELLRKPSRLLFTAVELGNVEFLMVLIQMYPNLIWKVDDHSRSMFHIAVVHRQEKIFNLIYELGAHKDLIASYKDENNNNMLHLAGKLAPPDRLKIDSGAALQLRRELHWFKEIEKVVQ***************ILFS***RRLVREGEKWMKDTASSCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFLHYKSFMVFAVSDALALFCSATSILMFLSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMAAFAATLFIVLGDDFVWIAIPIATGACVPVSLFALLQFPLLSDMISHLYKYSIFTRR******
*IVGLAGWLAEYVRGRRRILLSNYEQNAVLLNRSRLDFDISPLNHYCTSILLQNLSLSVSFYANSKCLFRQFFHWSKSMILSNGLSVQSRYGNGLSIDTCF******************VSTGVCSDDDISLKDAFGPGFF*************GNQNSHLQPPQAISSSIDFFEARGPDAHVVLDPSIWPMYASSDQVPS*************SGFAQPAVS*************NCFTSYAPLHLAALKGDWDFARNFFNLNPEAVCVRISRNQDTALHIAAGARRTLFVQELVNLMTPEDLALRNKVGNTALCFAAVSGVTKIAEVMVNKNRELPSIRGNKGATPLCMAALLGHKEMIWYLYSVTKEEDLKEEDRIELLVAVIDAGLYDVALDLIQHHPQLAMARDGNGETALHVLARKPSAFASGSQLGFWRRCIYSVPGMRAILDPKLMHLQALELVKRLWEQVLLLDDSKIGELLRKPSRLLFTAVELGNVEFLMVLIQMYPNLIWKVDDHSRSMFHIAVVHRQEKIFNLIYELGAHKDLIASYKDENNNNMLHLAGKLAPPDRLKIDSGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTP*********************TASSCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFLHYKSFMVFAVSDALALFCSATSILMFLSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMAAFAATLFIVLGDDFVWIAIPIATGACVPVSLFALLQFPLLSDMISHLYKYSIFTRR**H***
MIVGLAGWLAEYVRGRRRILLSNYEQNAVLLNRSRLDFDISPLNHYCTSILLQNLSLSVSFYANSKCLFRQFFHWSKSMILSNGLSVQSRYGNGLSIDTCFPEIKSVTNSSCKSFGEDDVSTGVCSDDDISLKDAFGPGFFYHANYGPSS************PPQAISSSIDFFEARGPDAHVVLDPSIWPMYAS***************************SLSQPGAVSGGVERNCFTSYAPLHLAALKGDWDFARNFFNLNPEAVCVRISRNQDTALHIAAGARRTLFVQELVNLMTPEDLALRNKVGNTALCFAAVSGVTKIAEVMVNKNRELPSIRGNKGATPLCMAALLGHKEMIWYLYSVTKEEDLKEEDRIELLVAVIDAGLYDVALDLIQHHPQLAMARDGNGETALHVLARKPSAFASGSQLGFWRRCIYSVPGMRAILDPKLMHLQALELVKRLWEQVLLLDDSKIGELLRKPSRLLFTAVELGNVEFLMVLIQMYPNLIWKVDDHSRSMFHIAVVHRQEKIFNLIYELGAHKDLIASYKDENNNNMLHLAGKLAPPDRLKIDSGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTPHILFSEEHRRLVREGEKWMKDTASSCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFLHYKSFMVFAVSDALALFCSATSILMFLSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMAAFAATLFIVLGDDFVWIAIPIATGACVPVSLFALLQFPLLSDMISHLYKYSIFTRRSNHLLY
MIVGLAGWLAEYVRGRRRILLSNYEQNAVLLNRSRLDFDISPLNHYCTSILLQNLSLSVSFYANSKCLFRQFFHWSKSMILSNGLSVQSR**N*L*IDTC*PE***********************DDDISLKDAFGPGFFYHANY**********************SS**FFEARGPDAHVVLDPSIWPMYASSDQVPSTSAELSRAAADESSGFAQPAVSLSQPGAVSGGVERNCFTSYAPLHLAALKGDWDFARNFFNLNPEAVCVRISRNQDTALHIAAGARRTLFVQELVNLMTPEDLALRNKVGNTALCFAAVSGVTKIAEVMVNKNRELPSIRGNKGATPLCMAALLGHKEMIWYLYSVTKEEDLKEEDRIELLVAVIDAGLYDVALDLIQHHPQLAMARDGNGETALHVLARKPSAFASGSQLGFWRRCIYSVPGMRAILDPKLMHLQALELVKRLWEQVLLLDDSKIGELLRKPSRLLFTAVELGNVEFLMVLIQMYPNLIWKVDDHSRSMFHIAVVHRQEKIFNLIYELGAHKDLIASYKDENNNNMLHLAGKLAPPDRLKIDSGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTPHILFSEEHRRLVREGEKWMKDTASSCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFLHYKSFMVFAVSDALALFCSATSILMFLSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMAAFAATLFIVLGDDFVWIAIPIATGACVPVSLFALLQFPLLSDMISHLYKYSIFTRRS*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIVGLAGWLAEYVRGRRRILLSNYEQNAVLLNRSRLDFDISPLNHYCTSILLQNLSLSVSFYANSKCLFRQFFHWSKSMILSNGLSVQSRYGNGLSIDTCFPEIKSVTNSSCKSFGEDDVSTGVCSDDDISLKDAFGPGFFYHANYGPSSNGASGNQNSHLQPPQAISSSIDFFEARGPDAHVVLDPSIWPMYASSDQVPSTSAELSRAAADESSGFAQPAVSLSQPGAVSGGVERNCFTSYAPLHLAALKGDWDFARNFFNLNPEAVCVRISRNQDTALHIAAGARRTLFVQELVNLMTPEDLALRNKVGNTALCFAAVSGVTKIAEVMVNKNRELPSIRGNKGATPLCMAALLGHKEMIWYLYSVTKEEDLKEEDRIELLVAVIDAGLYDVALDLIQHHPQLAMARDGNGETALHVLARKPSAFASGSQLGFWRRCIYSVPGMRAILDPKLMHLQALELVKRLWEQVLLLDDSKIGELLRKPSRLLFTAVELGNVEFLMVLIQMYPNLIWKVDDHSRSMFHIAVVHRQEKIFNLIYELGAHKDLIASYKDENNNNMLHLAGKLAPPDRLKIDSGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTPHILFSEEHRRLVREGEKWMKDTASSCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFLHYKSFMVFAVSDALALFCSATSILMFLSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMAAFAATLFIVLGDDFVWIAIPIATGACVPVSLFALLQFPLLSDMISHLYKYSIFTRRSNHLLY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query793 2.2.26 [Sep-21-2011]
Q9C7A2590 Ankyrin repeat-containing no no 0.377 0.506 0.256 2e-16
Q6AWW5524 Ankyrin repeat-containing no no 0.568 0.860 0.229 1e-11
A5PMU4 1280 Ankyrin repeat and steril yes no 0.223 0.138 0.310 2e-08
Q9ZU96532 Ankyrin repeat-containing no no 0.518 0.772 0.216 4e-08
Q92625 1134 Ankyrin repeat and SAM do yes no 0.223 0.156 0.305 6e-08
Q7Z6G8 1248 Ankyrin repeat and steril no no 0.224 0.142 0.304 7e-07
Q8BIZ1 1259 Ankyrin repeat and steril yes no 0.224 0.141 0.304 8e-07
P0C6S7 1260 Ankyrin repeat and steril no no 0.224 0.141 0.304 9e-07
Q01484 3957 Ankyrin-2 OS=Homo sapiens no no 0.416 0.083 0.247 1e-06
Q12955 4377 Ankyrin-3 OS=Homo sapiens no no 0.192 0.034 0.296 2e-06
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function desciption
 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 94/366 (25%), Positives = 154/366 (42%), Gaps = 67/366 (18%)

Query: 475 SKIGELLR----KPSRLLFTAVELGNVEFLMVLIQMYPNLIWKVDDHSRSMFHIAVVHRQ 530
           SK G LL          L  A   G+VE +  L+   P L  ++D   ++  H+AV  + 
Sbjct: 219 SKAGNLLEISRSNNKNALHLAARQGHVEVIKALLSKDPQLARRIDKKGQTALHMAVKGQS 278

Query: 531 EKIFNLIYELGAHKDLIASYKDENNNNMLHLAGK----------LAPPD----------R 570
            ++  L+ +       I    D++ N  LH+A +          L+ PD          +
Sbjct: 279 SEVVKLLLDADP---AIVMQPDKSCNTALHVATRKKRAEIVELLLSLPDTNANTLTRDHK 335

Query: 571 LKIDSGAALQLRRELHWFKE--------------------------IEKVVQPSYREAKN 604
             +D    L L  E  + KE                          I+  V     + K 
Sbjct: 336 TALDIAEGLPLSEESSYIKECLARSGALRANELNQPRDELRSTVTQIKNDVHIQLEQTKR 395

Query: 605 SEGRTPHILFSEEHRRLVREGEKWMKDTASSCMVVATLIATVMFAAAFTVPGGNDDSTGR 664
           +     +I  S+E R+L REG   + +  +S  VVA L ATV FAA FTVPGG D++ G 
Sbjct: 396 TNKNVHNI--SKELRKLHREG---INNATNSVTVVAVLFATVAFAAIFTVPGG-DNNDGS 449

Query: 665 PIFLHYKSFMVFAVSDALALFCSATSILMFLSIITSRYAEEDFVHSLPNRLIIGLATLFI 724
            + +   SF +F + +ALALF S   +++ ++++      E  V  + N+L + LA++  
Sbjct: 450 AVVVGRASFKIFFIFNALALFTSLAVVVVQITLVRGETKAEKRVVEVINKL-MWLASMCT 508

Query: 725 SIATMMAAFAATLFIVLGDDFVWIA--IPIATGACVPVSLFALLQFPLLSDMISHLYKYS 782
           S+     AF A+ +IV+G    W A  + +  G  +   L  +  + + S     + K  
Sbjct: 509 SV-----AFLASSYIVVGRKNEWAAELVTVVGGVIMAGVLGTMTYYVVKSKRTRSMRKKV 563

Query: 783 IFTRRS 788
              RRS
Sbjct: 564 KSARRS 569

Arabidopsis thaliana (taxid: 3702)
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function description
>sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 Back     alignment and function description
>sp|Q9ZU96|Y2168_ARATH Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=1 SV=1 Back     alignment and function description
>sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 Back     alignment and function description
>sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 Back     alignment and function description
>sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 Back     alignment and function description
>sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query793
359472754789 PREDICTED: ankyrin repeat-containing pro 0.866 0.870 0.634 0.0
147784800 1697 hypothetical protein VITISV_029434 [Viti 0.873 0.408 0.589 0.0
297737987 1855 unnamed protein product [Vitis vinifera] 0.833 0.356 0.601 0.0
359483665762 PREDICTED: ankyrin repeat-containing pro 0.776 0.808 0.648 0.0
224136692743 predicted protein [Populus trichocarpa] 0.713 0.761 0.641 0.0
356532648739 PREDICTED: uncharacterized protein LOC10 0.687 0.737 0.609 0.0
297740805702 unnamed protein product [Vitis vinifera] 0.711 0.803 0.574 0.0
147860696891 hypothetical protein VITISV_011174 [Viti 0.684 0.609 0.546 1e-173
225425076563 PREDICTED: ankyrin repeat-containing pro 0.638 0.898 0.532 1e-164
359473665602 PREDICTED: LOW QUALITY PROTEIN: ankyrin 0.693 0.913 0.542 1e-161
>gi|359472754|ref|XP_002276402.2| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  889 bits (2296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/723 (63%), Positives = 547/723 (75%), Gaps = 36/723 (4%)

Query: 89  SRYGNGLSIDTCFPEIKSVTNSSCKSFGEDDVST--GVCSDDDI-----SLKDAFGPGFF 141
           SR    LS+ +CFPE++S   S CKS  +D+ S+  G  S DDI     +  D    G  
Sbjct: 9   SRLKRSLSLQSCFPEVRSAEASGCKS-PDDNASSVNGGRSFDDIRHNVDTCLDIDDQGIS 67

Query: 142 YHANYGPSSNGA---------------SGNQNSHLQPPQAISSSIDFFEARGPDAHVVLD 186
             ++ G +S  +               S  QNS  +  QA+       EA G DAHV LD
Sbjct: 68  PASSGGKTSTASRRIFPLESRSPCRSVSDIQNSKSELLQAVP------EAIGSDAHVALD 121

Query: 187 PSIWPMYASSDQVPSTSAELS--RAAADESSGFAQPAVSLSQPGAVSGGVERNCFTSYAP 244
            S WP  ++  +  ++ ++ S  R A D S     P  S+   GA+SG +  N   +Y  
Sbjct: 122 LSSWPGGSTHPKNETSKSDASPVRQAVDHSF----PLASVHYSGAISGEIRSNGLKAYVL 177

Query: 245 LHLAALKGDWDFARNFFNLNPEAVCVRISRNQDTALHIAAGARRTLFVQELVNLMTPEDL 304
           L LAAL GDW  A+ F   NP+AV  RI+R  +TALHIAAGAR T FV+ELV LM P+DL
Sbjct: 178 LCLAALNGDWKSAKAFLESNPQAVRARITRRSETALHIAAGARHTRFVEELVKLMKPDDL 237

Query: 305 ALRNKVGNTALCFAAVSGVTKIAEVMVNKNRELPSIRGNKGATPLCMAALLGHKEMIWYL 364
           AL+NKVGNTALCFAA SG+T+IAEVMVNKNRELP IRG+KG TPL MAAL+GHK+M+ YL
Sbjct: 238 ALQNKVGNTALCFAAASGITRIAEVMVNKNRELPMIRGSKGVTPLYMAALVGHKDMVRYL 297

Query: 365 YSVTKEEDLKEEDRIELLVAVIDAGLYDVALDLIQHHPQLAMARDGNGETALHVLARKPS 424
           YSVT+E++L +EDRI LLVA I A L+DVAL ++   P+LAMARDGNG+TALHVLARKP 
Sbjct: 298 YSVTEEDNLTKEDRIGLLVAAITANLFDVALHMLHEDPELAMARDGNGDTALHVLARKPL 357

Query: 425 AFASGSQLGFWRRCIYSVPGMRAILDPKLMHLQALELVKRLWEQVLLLD-DSKIGELLRK 483
           AF SGSQLG W RCIYS PG +++ D KLMH+QALELV++LW+++L LD D KIGEL+R 
Sbjct: 358 AFYSGSQLGIWHRCIYSFPGFKSVYDKKLMHIQALELVQQLWDKILSLDHDPKIGELIRT 417

Query: 484 PSRLLFTAVELGNVEFLMVLIQMYPNLIWKVDDHSRSMFHIAVVHRQEKIFNLIYELGAH 543
           PSRLLFTA ELG VEF+ VLI+ YP+LIWKV+D S+++FH+AV HRQEKIFNLIYE+GAH
Sbjct: 418 PSRLLFTAAELGIVEFITVLIRSYPDLIWKVNDQSQTIFHVAVAHRQEKIFNLIYEIGAH 477

Query: 544 KDLIASYKDENNNNMLHLAGKLAPPDRLKIDSGAALQLRRELHWFKEIEKVVQPSYREAK 603
           KD IA+YKDE NNNMLHLAGKLAP +RLKIDSGAA QL+RELHWFKE+EK++QPSY E K
Sbjct: 478 KDYIAAYKDEKNNNMLHLAGKLAPSNRLKIDSGAAFQLQRELHWFKEVEKIIQPSYTEMK 537

Query: 604 NSEGRTPHILFSEEHRRLVREGEKWMKDTASSCMVVATLIATVMFAAAFTVPGGNDDSTG 663
           N +GRTP ILF+EEH+ LVREGEKWMKDTASSCMVVATLIATVMFAAAF+VPGGNDD TG
Sbjct: 538 NEQGRTPQILFTEEHKDLVREGEKWMKDTASSCMVVATLIATVMFAAAFSVPGGNDDDTG 597

Query: 664 RPIFLHYKSFMVFAVSDALALFCSATSILMFLSIITSRYAEEDFVHSLPNRLIIGLATLF 723
           RPIFL  KSF+VFA+SDALALF SATSIL+FLSI+TSRYAEEDF+ SLPNRLIIGLATLF
Sbjct: 598 RPIFLTKKSFLVFAISDALALFSSATSILIFLSILTSRYAEEDFLESLPNRLIIGLATLF 657

Query: 724 ISIATMMAAFAATLFIVLGDDFVWIAIPIATGACVPVSLFALLQFPLLSDMISHLYKYSI 783
           IS+ATMM AF ATLFIVLG + VW+A P+A  ACVPV+LF LL+FPL  DMISH Y+ SI
Sbjct: 658 ISVATMMIAFCATLFIVLGPELVWVANPMALVACVPVTLFPLLKFPLFIDMISHRYRSSI 717

Query: 784 FTR 786
             R
Sbjct: 718 IFR 720

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147784800|emb|CAN68568.1| hypothetical protein VITISV_029434 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737987|emb|CBI27188.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483665|ref|XP_003632996.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224136692|ref|XP_002322392.1| predicted protein [Populus trichocarpa] gi|222869388|gb|EEF06519.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356532648|ref|XP_003534883.1| PREDICTED: uncharacterized protein LOC100814269 [Glycine max] Back     alignment and taxonomy information
>gi|297740805|emb|CBI30987.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147860696|emb|CAN81449.1| hypothetical protein VITISV_011174 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225425076|ref|XP_002271486.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359473665|ref|XP_003631341.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query793
TAIR|locus:2175413669 AT5G04700 "AT5G04700" [Arabido 0.428 0.508 0.440 4.4e-90
TAIR|locus:2180228625 AT5G04690 "AT5G04690" [Arabido 0.688 0.873 0.381 6e-87
TAIR|locus:2175448603 AT5G04730 "AT5G04730" [Arabido 0.435 0.572 0.396 8.6e-73
TAIR|locus:2165174347 AT5G35810 "AT5G35810" [Arabido 0.422 0.965 0.446 4.1e-72
TAIR|locus:2080240574 AT3G54070 "AT3G54070" [Arabido 0.587 0.811 0.361 4.9e-69
TAIR|locus:2165194282 AT5G35830 [Arabidopsis thalian 0.185 0.521 0.455 2.7e-28
TAIR|locus:2128781677 AT4G03460 "AT4G03460" [Arabido 0.255 0.299 0.290 5.7e-14
TAIR|locus:2092522590 ITN1 "INCREASED TOLERANCE TO N 0.606 0.815 0.244 1.9e-13
TAIR|locus:2075009607 AT3G09550 [Arabidopsis thalian 0.525 0.686 0.243 5.3e-13
TAIR|locus:2031948627 AT1G05640 "AT1G05640" [Arabido 0.533 0.674 0.249 5.7e-13
TAIR|locus:2175413 AT5G04700 "AT5G04700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 701 (251.8 bits), Expect = 4.4e-90, Sum P(2) = 4.4e-90
 Identities = 152/345 (44%), Positives = 213/345 (61%)

Query:   444 GMRAILDPKLMHLQALELVKRLWEQVLLLDDSKIGELLRKPSRLLFTAVELGNVEFLMVL 503
             G+  +   K+MHLQA +L+  + E+ L L   +  E + +   LLF AV  GNV+FL+ +
Sbjct:   322 GIDEVYRLKVMHLQAKKLLLGISEETLALGLKERSETVDEA--LLF-AVRYGNVDFLVEM 378

Query:   504 IQMYPNLIWKVDDHSRS-MFHIAVVHRQEKIFNLIYELGAHKDLIASYKDENNNNMLHLA 562
             I+    L+W     S S +F +AV  RQEK+F+L+Y L   K L+ + KD + N +LHLA
Sbjct:   379 IRNNSELLWSTRTSSSSTLFLLAVEFRQEKVFSLLYGLDDRKYLLLADKDCDGNGVLHLA 438

Query:   563 GKLAPPDRLKIDSGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTPHILFSEEHRRLV 622
             G  +PP +L    GA LQL+REL WFKE+E++     +E  N+E +TP  +F++EH+ L 
Sbjct:   439 GFPSPPSKLSSVVGAPLQLQRELQWFKEVERIAPEIEKERVNTEEQTPIEIFTKEHQGLR 498

Query:   623 REGEKWMKDTASSCMVVATLIATVMFAAAFTVPGGNDD-STGRPIFLHYKSFMVFAVSDA 681
             +E EKWMKDTA SC +VA LI TV FAA FTVPGG DD S G+P  L  + F++F VSD 
Sbjct:   499 QEAEKWMKDTAMSCSLVAALIVTVTFAAVFTVPGGTDDNSKGKPFHLRDRRFIIFIVSDL 558

Query:   682 LALFCSATSILMFLSIITSRYAEEDFVHSLPNRLIIGLATLXXXXXXXXXXXXXXLFIVL 741
             ++ F S TS+L+FL I+T+RY+ +DF+  LP ++I GL+ L              LF ++
Sbjct:   559 ISCFASCTSVLIFLGILTARYSFDDFLVFLPTKMIAGLSILFVSIAAMLIAFSSALFTMM 618

Query:   742 GDDFVWIAIPIATGACVPVSLFALLQFPLLSDMISHLYKYSIFTR 786
             G +  WI  P    AC+P  LF LLQ+PLL +MI   Y   IF R
Sbjct:   619 GKEGKWIVAPTILFACLPALLFVLLQYPLLKEMIFSTYGKGIFDR 663
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2180228 AT5G04690 "AT5G04690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175448 AT5G04730 "AT5G04730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165174 AT5G35810 "AT5G35810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080240 AT3G54070 "AT3G54070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165194 AT5G35830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128781 AT4G03460 "AT4G03460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092522 ITN1 "INCREASED TOLERANCE TO NACL" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031948 AT1G05640 "AT1G05640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00151039
hypothetical protein (743 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query793
pfam13962114 pfam13962, PGG, Domain of unknown function 7e-34
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-12
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-11
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-08
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-04
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-04
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 0.004
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information 
 Score =  125 bits (316), Expect = 7e-34
 Identities = 45/121 (37%), Positives = 65/121 (53%), Gaps = 13/121 (10%)

Query: 626 EKWMKDTASSCMVVATLIATVMFAAAFTVPGG-----NDDSTGRPIFL-HYKSFMVFAVS 679
            +W++ T +S +VVATLIATV FAA FT PGG          G PI     + F  F VS
Sbjct: 1   SEWLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVS 60

Query: 680 DALALFCSATSILMFLSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMAAFAATLFI 739
           + +A   S  ++++ L I+        F   LP RL+  L  L++S+ ++M AFAA  + 
Sbjct: 61  NTIAFVASLVAVILLLYIV------PSFSRRLP-RLLALLTLLWLSLLSLMVAFAAGSYR 113

Query: 740 V 740
           V
Sbjct: 114 V 114

The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 793
PHA02876682 ankyrin repeat protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 100.0
PHA02792631 ankyrin-like protein; Provisional 99.97
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PHA02792631 ankyrin-like protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA02795437 ankyrin-like protein; Provisional 99.94
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.93
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.93
PHA02795437 ankyrin-like protein; Provisional 99.93
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.92
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.92
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.92
PF13962113 PGG: Domain of unknown function 99.91
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.9
PLN03192823 Voltage-dependent potassium channel; Provisional 99.9
PLN03192823 Voltage-dependent potassium channel; Provisional 99.89
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.89
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.88
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.87
KOG0514452 consensus Ankyrin repeat protein [General function 99.84
KOG0514452 consensus Ankyrin repeat protein [General function 99.84
PHA02741169 hypothetical protein; Provisional 99.83
PHA02743166 Viral ankyrin protein; Provisional 99.83
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.83
PHA02741169 hypothetical protein; Provisional 99.83
PHA02743166 Viral ankyrin protein; Provisional 99.83
PHA02736154 Viral ankyrin protein; Provisional 99.81
PHA02884300 ankyrin repeat protein; Provisional 99.81
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.79
PHA02736154 Viral ankyrin protein; Provisional 99.78
PHA02884300 ankyrin repeat protein; Provisional 99.78
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.77
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.71
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.7
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.69
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.67
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.66
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.66
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.64
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.63
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.51
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.5
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.45
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.43
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.32
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.31
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.3
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.3
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.28
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.27
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.23
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.22
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.22
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.21
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.69
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.56
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.55
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.54
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.52
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.52
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.5
PF1360630 Ank_3: Ankyrin repeat 98.48
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.47
PF1360630 Ank_3: Ankyrin repeat 98.43
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.4
KOG0522560 consensus Ankyrin repeat protein [General function 98.38
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.36
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.3
KOG0522560 consensus Ankyrin repeat protein [General function 98.29
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.24
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.13
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.07
KOG0520975 consensus Uncharacterized conserved protein, conta 98.0
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.82
KOG0520975 consensus Uncharacterized conserved protein, conta 97.81
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.8
KOG0511516 consensus Ankyrin repeat protein [General function 97.74
KOG0511516 consensus Ankyrin repeat protein [General function 97.66
KOG2384223 consensus Major histocompatibility complex protein 97.59
KOG2384223 consensus Major histocompatibility complex protein 97.52
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.01
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.79
KOG2505591 consensus Ankyrin repeat protein [General function 94.8
KOG2505591 consensus Ankyrin repeat protein [General function 94.06
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 93.3
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 92.64
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 91.95
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 90.5
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=4.1e-45  Score=436.25  Aligned_cols=345  Identities=16%  Similarity=0.141  Sum_probs=267.0

Q ss_pred             CCCCchHHHHHHHcCCHHHHHHHHhcCCccccccCCCCCchHHHHHH---------------------------------
Q 003814          238 CFTSYAPLHLAALKGDWDFARNFFNLNPEAVCVRISRNQDTALHIAA---------------------------------  284 (793)
Q Consensus       238 d~~g~T~Lh~Aa~~G~~~~v~~LL~~~~~~~~~~~d~~g~TpLh~Aa---------------------------------  284 (793)
                      +..++||||.|+..|+.|+|+.|++++|..+... |..|.||||+|+                                 
T Consensus        38 ~~~~~t~LH~A~~~g~~e~V~~ll~~~~~~~~~~-~~~~~tpLh~a~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~  116 (682)
T PHA02876         38 ESIPFTAIHQALQLRQIDIVEEIIQQNPELIYIT-DHKCHSTLHTICIIPNVMDIVISLTLDCDIILDIKYASIILNKHK  116 (682)
T ss_pred             ccccchHHHHHHHHHhhhHHHHHHHhCcccchhh-chhhccccccccCCCCccccccccccchhhcccccHHHHHHHHHH
Confidence            4456777777777777777777777776644443 667777777555                                 


Q ss_pred             -------------------------------------HhCcHHHHHHHHhcCCCCcccccccCCChHHHHHHHhCcHHHH
Q 003814          285 -------------------------------------GARRTLFVQELVNLMTPEDLALRNKVGNTALCFAAVSGVTKIA  327 (793)
Q Consensus       285 -------------------------------------~~g~~eiVk~LL~~~~gad~~~~d~~G~TpLh~Aa~~g~~~iv  327 (793)
                                                           ..|+.+++++|++  .|++++.+|..|.||||+|+..|+.++|
T Consensus       117 ~~~~~~~il~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~~i~k~Ll~--~Gadvn~~d~~G~TpLh~Aa~~G~~~iv  194 (682)
T PHA02876        117 LDEACIHILKEAISGNDIHYDKINESIEYMKLIKERIQQDELLIAEMLLE--GGADVNAKDIYCITPIHYAAERGNAKMV  194 (682)
T ss_pred             HHHHHHHHHHHHhcCCcccHHhhccchhhhHHHHHHHHCCcHHHHHHHHh--CCCCCCCCCCCCCCHHHHHHHCCCHHHH
Confidence                                                 4567778888888  7888888888888888888888888888


Q ss_pred             HHHHhCCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHH-----------------------------HhcCCCCCcccccC
Q 003814          328 EVMVNKNRELPSIRGNKGATPLCMAALLGHKEMIWYL-----------------------------YSVTKEEDLKEEDR  378 (793)
Q Consensus       328 ~~Ll~~g~~~~~~~~~~G~TpLh~Aa~~g~~eiv~~L-----------------------------l~~gad~n~~~~~g  378 (793)
                      ++|+++|++++ ..+.+|.||||+|+..|+.+++++|                             ++.|++++..+..|
T Consensus       195 ~~LL~~Gad~n-~~~~~g~t~L~~A~~~~~~~ivk~Ll~~~~~~~~~~~~L~~ai~~~~~~~~~~Ll~~g~~vn~~d~~g  273 (682)
T PHA02876        195 NLLLSYGADVN-IIALDDLSVLECAVDSKNIDTIKAIIDNRSNINKNDLSLLKAIRNEDLETSLLLYDAGFSVNSIDDCK  273 (682)
T ss_pred             HHHHHCCCCcC-ccCCCCCCHHHHHHHcCCHHHHHHHHhcCCCCCCCcHHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCC
Confidence            88888888876 5777788888888877777666555                             45566777788889


Q ss_pred             chHHHHHHHcCCh-hHHHHHHhhCcccccccCCCCCCHHHHHHhCCCCccccchhhHHHHhhhcC--CCcccccCCchhH
Q 003814          379 IELLVAVIDAGLY-DVALDLIQHHPQLAMARDGNGETALHVLARKPSAFASGSQLGFWRRCIYSV--PGMRAILDPKLMH  455 (793)
Q Consensus       379 ~t~Lh~A~~~g~~-eiv~~LL~~~~~~~~~~d~~G~TpLh~A~~~g~~~~s~~~~~~~~~ll~~~--~~~~~~~~~t~lh  455 (793)
                      .||||+|+..++. ++++.|++.|+++ +.+|.+|.||||+|+..|.      ..+.++.++..+  ++..+..+.||+|
T Consensus       274 ~TpLh~Aa~~~~~~~iv~lLl~~gadi-n~~d~~g~TpLh~Aa~~g~------~~~~v~~Ll~~gadin~~d~~g~TpLh  346 (682)
T PHA02876        274 NTPLHHASQAPSLSRLVPKLLERGADV-NAKNIKGETPLYLMAKNGY------DTENIRTLIMLGADVNAADRLYITPLH  346 (682)
T ss_pred             CCHHHHHHhCCCHHHHHHHHHHCCCCC-CCcCCCCCCHHHHHHHhCC------CHHHHHHHHHcCCCCCCcccCCCcHHH
Confidence            9999999999886 6889999999885 8889999999999998874      256777777654  4556678889999


Q ss_pred             HHHHHHHHHHHHHHHhcCccccccccCCCChHHHHHHHcCCHHHHHHHHHhCCCCcccccCCCCCHHHHHHHcCC-HHHH
Q 003814          456 LQALELVKRLWEQVLLLDDSKIGELLRKPSRLLFTAVELGNVEFLMVLIQMYPNLIWKVDDHSRSMFHIAVVHRQ-EKIF  534 (793)
Q Consensus       456 ~a~~~~~~~Ll~~~l~~~~~~~~~~~~~g~t~Lh~Aa~~g~~eiv~~LL~~g~d~~~~~d~~G~T~Lh~A~~~g~-~~iv  534 (793)
                      .++...-..-+...+...+.+++.+|..|.||||+|+..|+.+++++|+++|++ ++..+..|.||||+|+..++ ..++
T Consensus       347 ~A~~~~~~~~iv~lLl~~gadin~~d~~G~TpLh~Aa~~~~~~iv~~Ll~~gad-~~~~~~~g~T~Lh~A~~~~~~~~~v  425 (682)
T PHA02876        347 QASTLDRNKDIVITLLELGANVNARDYCDKTPIHYAAVRNNVVIINTLLDYGAD-IEALSQKIGTALHFALCGTNPYMSV  425 (682)
T ss_pred             HHHHhCCcHHHHHHHHHcCCCCccCCCCCCCHHHHHHHcCCHHHHHHHHHCCCC-ccccCCCCCchHHHHHHcCCHHHHH
Confidence            987422111222233345888888999999999999999999999999999999 78889999999999997665 5678


Q ss_pred             HHHHHcCCChhhhhhcccCCCCcHHHHHhHhCCCCcccccCCchhHhHHHhhhHHHHHHhhc-cchhHhhhcCCCCchhh
Q 003814          535 NLIYELGAHKDLIASYKDENNNNMLHLAGKLAPPDRLKIDSGAALQLRRELHWFKEIEKVVQ-PSYREAKNSEGRTPHIL  613 (793)
Q Consensus       535 ~~Ll~~gad~~~l~n~~D~~G~TpLHlAa~~~~~~~l~l~~Ga~~~~~~~l~~~~~v~~ll~-~~~~~~~n~~G~Tpl~l  613 (793)
                      ++|+++|++++.    +|.+|+||||+|+..+..                   .+.++.++. +++++.+|..|+||+++
T Consensus       426 k~Ll~~gadin~----~d~~G~TpLh~Aa~~~~~-------------------~~iv~lLl~~Gad~n~~d~~g~tpl~~  482 (682)
T PHA02876        426 KTLIDRGANVNS----KNKDLSTPLHYACKKNCK-------------------LDVIEMLLDNGADVNAINIQNQYPLLI  482 (682)
T ss_pred             HHHHhCCCCCCc----CCCCCChHHHHHHHhCCc-------------------HHHHHHHHHCCCCCCCCCCCCCCHHHH
Confidence            999999999886    999999999999987632                   112333333 45668999999999999


Q ss_pred             hhhh
Q 003814          614 FSEE  617 (793)
Q Consensus       614 a~e~  617 (793)
                      |.+.
T Consensus       483 a~~~  486 (682)
T PHA02876        483 ALEY  486 (682)
T ss_pred             HHHh
Confidence            8764

>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query793
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 6e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure 
Iteration: 1

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 74/179 (41%), Gaps = 14/179 (7%)
Query: 244 PLHLAALKGDWDFARNFFN--LNPEAVCVRISRNQDTALHIAAGARRTLFVQELVNLMTP 301
           PLH+A+  G     +N      +P    V++    +T LH+AA A  T   + L  L   
Sbjct: 17  PLHVASFMGHLPIVKNLLQRGASPNVSNVKV----ETPLHMAARAGHTEVAKYL--LQNK 70
Query: 302 EDLALRNKVGNTALCFAAVSGVTKIAEVMVNKNRELPSIRGNKGATPLCMAALLGHKEMI 361
             +  + K   T L  AA  G T + ++++  N   P++    G TPL +AA  GH E +
Sbjct: 71  AKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNAN-PNLATTAGHTPLHIAAREGHVETV 129
Query: 362 WYLYSVTKEEDLKEEDRIELLVAVIDAGLYDVALDLIQH--HPQLAMARDGNGETALHV 418
             L      +    +     L      G   VA  L++   HP    A   NG T LHV
Sbjct: 130 LALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPN---AAGKNGLTPLHV 185

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query793
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-14
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-11
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-08
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-12
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-12
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-08
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-04
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-13
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-11
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-12
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-12
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-07
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-07
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-07
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-08
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-04
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-04
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-12
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-05
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-04
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-07
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-11
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-05
2rfa_A232 Transient receptor potential cation channel subfa 3e-11
2rfa_A232 Transient receptor potential cation channel subfa 6e-09
2rfa_A232 Transient receptor potential cation channel subfa 2e-08
2rfa_A232 Transient receptor potential cation channel subfa 9e-04
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-08
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-08
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-07
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-05
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 8e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 8e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-04
2pnn_A273 Transient receptor potential cation channel subfa 1e-10
2pnn_A273 Transient receptor potential cation channel subfa 2e-10
2pnn_A273 Transient receptor potential cation channel subfa 3e-08
2pnn_A273 Transient receptor potential cation channel subfa 1e-07
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-08
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-08
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-08
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-05
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-04
2etb_A256 Transient receptor potential cation channel subfam 9e-10
2etb_A256 Transient receptor potential cation channel subfam 2e-08
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-04
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-09
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-08
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-04
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-08
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-09
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-07
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-07
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-09
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-09
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-06
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-09
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-07
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-06
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-08
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-08
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-05
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-08
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-08
3v30_A172 DNA-binding protein rfxank; structural genomics co 7e-08
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-04
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-07
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-08
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-07
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-08
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-06
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-07
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-07
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-05
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 9e-07
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-07
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-07
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-07
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-05
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-05
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 9e-05
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-04
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 9e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 8e-04
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
 Score = 71.8 bits (177), Expect = 4e-14
 Identities = 38/190 (20%), Positives = 66/190 (34%), Gaps = 17/190 (8%)

Query: 244 PLHLAALKGDWDFARNFFNLNPEAVCVRISRNQD--TALHIAAGARRTLFVQELVNLMTP 301
            LHLA +  +              +     +N    T LH+A    +    + L+     
Sbjct: 11  FLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGC- 69

Query: 302 EDLALRNKVGNTALCFAAVSGVTKIAEVMVNK--NRELPSI---RGNKGATPLCMAALLG 356
            D  LR+  GNT L  A   G      V+        L SI       G T L +A++ G
Sbjct: 70  -DPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHG 128

Query: 357 HKEMIWYLYSVTKEEDLKEEDRIE----LLVAVIDAGLYDVALDLIQHHPQLAMARDGNG 412
           +  ++  L  V+   D+  ++       L +AV D    D+   L++    +       G
Sbjct: 129 YLGIVELL--VSLGADVNAQEPCNGRTALHLAV-DLQNPDLVSLLLKCGADVN-RVTYQG 184

Query: 413 ETALHVLARK 422
            +   +   +
Sbjct: 185 YSPYQLTWGR 194
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query793
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2etb_A256 Transient receptor potential cation channel subfam 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.9
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.9
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.89
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.88
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.87
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.87
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.87
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.86
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.86
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.86
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.85
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.85
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.85
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.84
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.83
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.82
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.81
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.81
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.8
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.8
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.79
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.79
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.79
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.76
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.68
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.65
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=1.8e-52  Score=472.84  Aligned_cols=359  Identities=20%  Similarity=0.202  Sum_probs=305.4

Q ss_pred             chhhHHhhcCCCCc---------CCcccCCCCCchHHHHHHHcCCHHHHHHHHhcCCccccccCCCCCchHHHHHHHhCc
Q 003814          218 AQPAVSLSQPGAVS---------GGVERNCFTSYAPLHLAALKGDWDFARNFFNLNPEAVCVRISRNQDTALHIAAGARR  288 (793)
Q Consensus       218 ~~~l~~l~~~G~~~---------~~~~~~d~~g~T~Lh~Aa~~G~~~~v~~LL~~~~~~~~~~~d~~g~TpLh~Aa~~g~  288 (793)
                      .+|++.|+..|+..         .+++..+..|+||||+||..|+.+++++|++.+. +++.+ +..|+||||+|+..|+
T Consensus        15 ~t~L~~Aa~~g~~~~v~~Ll~~g~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~-~~~~~-~~~g~t~L~~A~~~g~   92 (437)
T 1n11_A           15 LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKA-KVNAK-AKDDQTPLHCAARIGH   92 (437)
T ss_dssp             CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTC-CSSCC-CTTSCCHHHHHHHHTC
T ss_pred             CCHHHHHHHCCCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCC-CCCCC-CCCCCCHHHHHHHCCC
Confidence            34555555544432         2567788889999999999999999999998754 44444 7889999999999999


Q ss_pred             HHHHHHHHhcCCCCcccccccCCChHHHHHHHhCcHHHHHHHHhCCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhcC
Q 003814          289 TLFVQELVNLMTPEDLALRNKVGNTALCFAAVSGVTKIAEVMVNKNRELPSIRGNKGATPLCMAALLGHKEMIWYLYSVT  368 (793)
Q Consensus       289 ~eiVk~LL~~~~gad~~~~d~~G~TpLh~Aa~~g~~~iv~~Ll~~g~~~~~~~~~~G~TpLh~Aa~~g~~eiv~~Ll~~g  368 (793)
                      .++|++|++  +|++++.+|..|.||||+|+..|+.+++++|++++++.. ..+..|.||||+|+..|+.+++++|+++|
T Consensus        93 ~~~v~~Ll~--~ga~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~-~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g  169 (437)
T 1n11_A           93 TNMVKLLLE--NNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQA-CMTKKGFTPLHVAAKYGKVRVAELLLERD  169 (437)
T ss_dssp             HHHHHHHHH--HTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSC-CCCTTSCCHHHHHHHTTCHHHHHHHHHTT
T ss_pred             HHHHHHHHh--CCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCc-CCCCCCCCHHHHHHHcCCHHHHHHHHhCC
Confidence            999999999  799999999999999999999999999999999998876 67888999999999999999999999999


Q ss_pred             CCCCcccccCchHHHHHHHcCChhHHHHHHhhCcccccccCCCCCCHHHHHHhCCCCccccchhhHHHHhhhcCC--Ccc
Q 003814          369 KEEDLKEEDRIELLVAVIDAGLYDVALDLIQHHPQLAMARDGNGETALHVLARKPSAFASGSQLGFWRRCIYSVP--GMR  446 (793)
Q Consensus       369 ad~n~~~~~g~t~Lh~A~~~g~~eiv~~LL~~~~~~~~~~d~~G~TpLh~A~~~g~~~~s~~~~~~~~~ll~~~~--~~~  446 (793)
                      ++++..+..|.||||.|+..|+.+++++|++++++. +..+.+|.||||+|+..|+       .++++.|+..+.  +..
T Consensus       170 ~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~-~~~~~~g~t~L~~A~~~~~-------~~~~~~Ll~~g~~~~~~  241 (437)
T 1n11_A          170 AHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSP-HSPAWNGYTPLHIAAKQNQ-------VEVARSLLQYGGSANAE  241 (437)
T ss_dssp             CCTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCS-CCCCTTCCCHHHHHHHTTC-------HHHHHHHHHTTCCTTCC
T ss_pred             CCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCC-CCcCCCCCCHHHHHHHcCC-------HHHHHHHHHcCCCCCCC
Confidence            999999999999999999999999999999999885 7788899999999999886       788898887654  445


Q ss_pred             cccCCchhHHHHH----HHHHHHHHHHHhcCccccccccCCCChHHHHHHHcCCHHHHHHHHHhCCCCcccccCCCCCHH
Q 003814          447 AILDPKLMHLQAL----ELVKRLWEQVLLLDDSKIGELLRKPSRLLFTAVELGNVEFLMVLIQMYPNLIWKVDDHSRSMF  522 (793)
Q Consensus       447 ~~~~~t~lh~a~~----~~~~~Ll~~~l~~~~~~~~~~~~~g~t~Lh~Aa~~g~~eiv~~LL~~g~d~~~~~d~~G~T~L  522 (793)
                      +..+.||+|.++.    +++++|+++     +.+++..+..|.||||+|++.|+.+++++|+++|++ ++.+|..|+|||
T Consensus       242 ~~~g~t~L~~A~~~g~~~~v~~Ll~~-----~~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~-~~~~~~~g~t~L  315 (437)
T 1n11_A          242 SVQGVTPLHLAAQEGHAEMVALLLSK-----QANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVM-VDATTRMGYTPL  315 (437)
T ss_dssp             CTTCCCHHHHHHHTTCHHHHHHHHTT-----TCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCC-TTCCCSSCCCHH
T ss_pred             CCCCCCHHHHHHHCCCHHHHHHHHhc-----CCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCcc-CCCCCCCCCCHH
Confidence            6678899999984    566665543     677788888999999999999999999999999998 888899999999


Q ss_pred             HHHHHcCCHHHHHHHHHcCCChhhhhhcccCCCCcHHHHHhHhCCCCcccccCCchhHhHHHhhhHHHHHHhhc-cchhH
Q 003814          523 HIAVVHRQEKIFNLIYELGAHKDLIASYKDENNNNMLHLAGKLAPPDRLKIDSGAALQLRRELHWFKEIEKVVQ-PSYRE  601 (793)
Q Consensus       523 h~A~~~g~~~iv~~Ll~~gad~~~l~n~~D~~G~TpLHlAa~~~~~~~l~l~~Ga~~~~~~~l~~~~~v~~ll~-~~~~~  601 (793)
                      |+|+..|+.+++++|+++|++++.    +|..|+||||+|++.|+.+                    .++.+++ +++++
T Consensus       316 ~~A~~~g~~~~v~~Ll~~gad~n~----~~~~g~t~L~~A~~~g~~~--------------------iv~~Ll~~ga~~~  371 (437)
T 1n11_A          316 HVASHYGNIKLVKFLLQHQADVNA----KTKLGYSPLHQAAQQGHTD--------------------IVTLLLKNGASPN  371 (437)
T ss_dssp             HHHHHSSCSHHHHHHHHTTCCTTC----CCTTSCCHHHHHHHTTCHH--------------------HHHHHHHTTCCSC
T ss_pred             HHHHHcCcHHHHHHHHhcCCCCCC----CCCCCCCHHHHHHHCChHH--------------------HHHHHHHCcCCCC
Confidence            999999999999999999999885    8999999999999988754                    3344443 45668


Q ss_pred             hhhcCCCCchhhhhhhhh
Q 003814          602 AKNSEGRTPHILFSEEHR  619 (793)
Q Consensus       602 ~~n~~G~Tpl~la~e~~~  619 (793)
                      .+|.+|+||+++|.+...
T Consensus       372 ~~~~~g~t~l~~A~~~g~  389 (437)
T 1n11_A          372 EVSSDGTTPLAIAKRLGY  389 (437)
T ss_dssp             CCCSSSCCHHHHHHHTTC
T ss_pred             CCCCCCCCHHHHHHHcCc
Confidence            899999999999987653
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 793
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-15
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-13
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.001
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-11
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-10
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-10
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.004
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.003
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.001
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.003
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.004
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 76.2 bits (186), Expect = 3e-15
 Identities = 67/350 (19%), Positives = 118/350 (33%), Gaps = 46/350 (13%)

Query: 244 PLHLAALKGDWDFARNFFNLNPEAVCVRISRNQDTALHIAAGARRTLFVQELVNLM---- 299
           PLH+AA  G  + A+  + L  +A     +++  T LH AA    T  V+ L+       
Sbjct: 36  PLHMAARAGHTEVAK--YLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPN 93

Query: 300 ---------------------------TPEDLALRNKVGNTALCFAAVSGVTKIAEVMVN 332
                                           A   K G T L  AA  G  ++AE+++ 
Sbjct: 94  LATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLE 153

Query: 333 KNRELPSIRGNKGATPLCMAALLGHKEMIWYLYSVTKEEDLKEEDRIELLVAVIDAGLYD 392
           ++   P+  G  G TPL +A    + +++  L            +    L         +
Sbjct: 154 RDAH-PNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVE 212

Query: 393 VALDLIQHHPQLAMARDGNGETALHVLARKPSAFASGSQLGFWRRCIYSVPGMRAILDPK 452
           VA  L+Q+    A A    G T LH+ A++       +++        +   +       
Sbjct: 213 VARSLLQYGGS-ANAESVQGVTPLHLAAQE-----GHAEMVALLLSKQANGNLGNKSGLT 266

Query: 453 LMHLQALELVKRLWEQVLLLDDSKIGELLRKPSRLLFTAVELGNVEFLMVLIQMYPNLIW 512
            +HL A E    + + VL+     +    R     L  A   GN++ +   +  +   + 
Sbjct: 267 PLHLVAQEGHVPVAD-VLIKHGVMVDATTRMGYTPLHVASHYGNIKLVK-FLLQHQADVN 324

Query: 513 KVDDHSRSMFHIAVVHRQEKIFNLIYELGAHKDLIASYKDENNNNMLHLA 562
                  S  H A       I  L+ + GA  +        +    L +A
Sbjct: 325 AKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNE----VSSDGTTPLAIA 370
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query793
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.98
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.95
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.93
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.93
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.92
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.91
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.91
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.91
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.89
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.88
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.83
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.82
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.81
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.4e-44  Score=396.34  Aligned_cols=340  Identities=19%  Similarity=0.201  Sum_probs=291.5

Q ss_pred             chHHHHHHHcCCHHHHHHHHhcCCccccccCCCCCchHHHHHHHhCcHHHHHHHHhcCCCCcccccccCCChHHHHHHHh
Q 003814          242 YAPLHLAALKGDWDFARNFFNLNPEAVCVRISRNQDTALHIAAGARRTLFVQELVNLMTPEDLALRNKVGNTALCFAAVS  321 (793)
Q Consensus       242 ~T~Lh~Aa~~G~~~~v~~LL~~~~~~~~~~~d~~g~TpLh~Aa~~g~~eiVk~LL~~~~gad~~~~d~~G~TpLh~Aa~~  321 (793)
                      .||||+||..|+.++|++|++.+. +++.+ |..|+||||+||..|+.++|++|++  +|++++.+|.+|+||||+|+..
T Consensus         1 ~TpL~~Aa~~g~~~~v~~Ll~~g~-~in~~-d~~g~TpL~~A~~~g~~~iv~~Ll~--~gadi~~~~~~g~t~L~~A~~~   76 (408)
T d1n11a_           1 LTPLHVASFMGHLPIVKNLLQRGA-SPNVS-NVKVETPLHMAARAGHTEVAKYLLQ--NKAKVNAKAKDDQTPLHCAARI   76 (408)
T ss_dssp             CCHHHHHHHHTCHHHHHHHHHTTC-CSCCS-SSCCCCHHHHHHHHTCHHHHHHHHH--HTCCSSCCCTTSCCHHHHHHHH
T ss_pred             CChHHHHHHCcCHHHHHHHHHCCC-CCCCC-CCCCCCHHHHHHHcCCHHHHHHHHH--CcCCCCCCCCCCCCHHHHHHHc
Confidence            389999999999999999998754 55554 8999999999999999999999999  7999999999999999999999


Q ss_pred             CcHHHHHHHHhCCCCCC--------------------------------CCCCCCCCCHHHHHHHcCCHHHHHHHHhcCC
Q 003814          322 GVTKIAEVMVNKNRELP--------------------------------SIRGNKGATPLCMAALLGHKEMIWYLYSVTK  369 (793)
Q Consensus       322 g~~~iv~~Ll~~g~~~~--------------------------------~~~~~~G~TpLh~Aa~~g~~eiv~~Ll~~ga  369 (793)
                      |+.+++++|++.+++..                                ...+..+.++|+.|+..++.+++++|+++|+
T Consensus        77 g~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~  156 (408)
T d1n11a_          77 GHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDA  156 (408)
T ss_dssp             TCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTC
T ss_pred             CCHHHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHHcCC
Confidence            99999999997655431                                1346778999999999999999999999999


Q ss_pred             CCCcccccCchHHHHHHHcCChhHHHHHHhhCcccccccCCCCCCHHHHHHhCCCCccccchhhHHHHhhhcC--CCccc
Q 003814          370 EEDLKEEDRIELLVAVIDAGLYDVALDLIQHHPQLAMARDGNGETALHVLARKPSAFASGSQLGFWRRCIYSV--PGMRA  447 (793)
Q Consensus       370 d~n~~~~~g~t~Lh~A~~~g~~eiv~~LL~~~~~~~~~~d~~G~TpLh~A~~~g~~~~s~~~~~~~~~ll~~~--~~~~~  447 (793)
                      +++..+.+|.+|||+|+..|+.+++++|+++|+++ +..+..|.||+|.++....       .+....++...  .....
T Consensus       157 ~~~~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~-~~~~~~~~t~l~~~~~~~~-------~~~~~~l~~~~~~~~~~~  228 (408)
T d1n11a_         157 HPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSP-HSPAWNGYTPLHIAAKQNQ-------VEVARSLLQYGGSANAES  228 (408)
T ss_dssp             CTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCS-CCCCTTCCCHHHHHHHTTC-------HHHHHHHHHTTCCTTCCC
T ss_pred             CCCcCCCcCchHHHHHHHcCCHHHHHHHHhcCCcc-cccCCCCCCcchhhhccch-------hhhhhhhhhccccccccC
Confidence            99999999999999999999999999999999986 8889999999999999875       55566655443  34456


Q ss_pred             ccCCchhHHHHHHHHHHHHHHHHhcCccccccccCCCChHHHHHHHcCCHHHHHHHHHhCCCCcccccCCCCCHHHHHHH
Q 003814          448 ILDPKLMHLQALELVKRLWEQVLLLDDSKIGELLRKPSRLLFTAVELGNVEFLMVLIQMYPNLIWKVDDHSRSMFHIAVV  527 (793)
Q Consensus       448 ~~~~t~lh~a~~~~~~~Ll~~~l~~~~~~~~~~~~~g~t~Lh~Aa~~g~~eiv~~LL~~g~d~~~~~d~~G~T~Lh~A~~  527 (793)
                      ..+.+|+|.++......+++.. .......+..+..|.|||+.|++.++.+++++|+++|++ ++..+..+.||||.|+.
T Consensus       229 ~~~~t~l~~a~~~~~~~~~~~~-~~~~~~~~~~~~~g~~~l~~a~~~~~~~i~~~Ll~~g~~-~~~~~~~~~t~L~~~~~  306 (408)
T d1n11a_         229 VQGVTPLHLAAQEGHAEMVALL-LSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVM-VDATTRMGYTPLHVASH  306 (408)
T ss_dssp             TTCCCHHHHHHHTTCHHHHHHH-HTTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCC-TTCCCSSCCCHHHHHHH
T ss_pred             CCCCCHHHHHHHhCcHhHhhhh-hccccccccccCCCCChhhhhhhcCcHHHHHHHHHCCCc-cccccccccccchhhcc
Confidence            6788999998854433333332 233667777888999999999999999999999999999 88889999999999999


Q ss_pred             cCCHHHHHHHHHcCCChhhhhhcccCCCCcHHHHHhHhCCCCcccccCCchhHhHHHhhhHHHHHHhhc-cchhHhhhcC
Q 003814          528 HRQEKIFNLIYELGAHKDLIASYKDENNNNMLHLAGKLAPPDRLKIDSGAALQLRRELHWFKEIEKVVQ-PSYREAKNSE  606 (793)
Q Consensus       528 ~g~~~iv~~Ll~~gad~~~l~n~~D~~G~TpLHlAa~~~~~~~l~l~~Ga~~~~~~~l~~~~~v~~ll~-~~~~~~~n~~  606 (793)
                      .++.++++++++.|++++.    +|.+|+||||+|++.|+.+.                    ++.++. +++++.+|++
T Consensus       307 ~~~~~~~~~ll~~g~~in~----~d~~G~T~Lh~A~~~g~~~i--------------------v~~Ll~~GAd~n~~d~~  362 (408)
T d1n11a_         307 YGNIKLVKFLLQHQADVNA----KTKLGYSPLHQAAQQGHTDI--------------------VTLLLKNGASPNEVSSD  362 (408)
T ss_dssp             SSCSHHHHHHHHTTCCTTC----CCTTSCCHHHHHHHTTCHHH--------------------HHHHHHTTCCSCCCCSS
T ss_pred             cCcceeeeeeccccccccc----cCCCCCCHHHHHHHcCCHHH--------------------HHHHHHCCCCCCCCCCC
Confidence            9999999999999999885    99999999999999987542                    333443 4556899999


Q ss_pred             CCCchhhhhhhhh
Q 003814          607 GRTPHILFSEEHR  619 (793)
Q Consensus       607 G~Tpl~la~e~~~  619 (793)
                      |+||+|+|.+...
T Consensus       363 G~t~L~~A~~~~~  375 (408)
T d1n11a_         363 GTTPLAIAKRLGY  375 (408)
T ss_dssp             SCCHHHHHHHTTC
T ss_pred             CCCHHHHHHHcCC
Confidence            9999999988743
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure