Citrus Sinensis ID: 003853
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 791 | ||||||
| 297739695 | 822 | unnamed protein product [Vitis vinifera] | 0.993 | 0.956 | 0.770 | 0.0 | |
| 225441752 | 794 | PREDICTED: uncharacterized protein LOC10 | 0.993 | 0.989 | 0.770 | 0.0 | |
| 224090294 | 793 | predicted protein [Populus trichocarpa] | 0.997 | 0.994 | 0.768 | 0.0 | |
| 297820564 | 792 | exostosin family protein [Arabidopsis ly | 0.994 | 0.993 | 0.738 | 0.0 | |
| 42566010 | 793 | exostosin family protein [Arabidopsis th | 0.996 | 0.993 | 0.736 | 0.0 | |
| 42572713 | 791 | exostosin family protein [Arabidopsis th | 0.993 | 0.993 | 0.734 | 0.0 | |
| 356500491 | 795 | PREDICTED: uncharacterized protein LOC10 | 0.991 | 0.986 | 0.747 | 0.0 | |
| 147846684 | 1363 | hypothetical protein VITISV_016911 [Viti | 0.983 | 0.570 | 0.718 | 0.0 | |
| 255571564 | 728 | catalytic, putative [Ricinus communis] g | 0.912 | 0.991 | 0.785 | 0.0 | |
| 449501885 | 859 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.994 | 0.916 | 0.716 | 0.0 |
| >gi|297739695|emb|CBI29877.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1327 bits (3434), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 607/788 (77%), Positives = 688/788 (87%), Gaps = 2/788 (0%)
Query: 4 IEKWRFSWTLVATVASVLTLVSVVHLFLFPLVPSFDYFTARQQIQNSCVPIKESAERVTN 63
++KW+ SW+L+ATVASV+ L+SV HLFLFPL PS +YF+ Q Q +C PI S R +
Sbjct: 33 LQKWKCSWSLLATVASVVALISVAHLFLFPLAPSLEYFSMGQG-QKTCTPINASI-RGVD 90
Query: 64 RVWENSPPQLNLDHRFPADLHNAVVYRNAPWKAEIGRWLSGCDSVAKEVDLVEMIGGKSC 123
+N P +LDHRFPAD H +VVYR APWKAEIGRW SGCDS+A EV ++E IGGK C
Sbjct: 91 HDGKNLQPSFDLDHRFPADSHKSVVYRGAPWKAEIGRWFSGCDSIAAEVSIIEKIGGKDC 150
Query: 124 KSDCSGQGVCNHELGQCRCFHGFRGKGCSERIHFQCNFPKTPELPYGRWVVSICPTHCDT 183
K+DCSGQG+CNHELGQCRCFHGF G+GCSER+H CN+P +PE PYG WVVSICP CDT
Sbjct: 151 KNDCSGQGICNHELGQCRCFHGFSGEGCSERLHLDCNYPSSPEQPYGPWVVSICPASCDT 210
Query: 184 TRAMCFCGEGTKYPNRPVAEACGFQVNLPSQPGAPKSTDWAKADLDNIFTTNGSKPGWCN 243
TRAMCFCGEGTKYP+RPVAEACGFQ+NLP+ PG PK DW KADLDNIFTTN SKPGWCN
Sbjct: 211 TRAMCFCGEGTKYPHRPVAEACGFQMNLPTTPGDPKLVDWTKADLDNIFTTNDSKPGWCN 270
Query: 244 VDPEEAYALKVQFKEECDCKYDGLLGQFCEVPVSSTCVNQCSGHGHCRGGFCQCDSGWYG 303
VDP EAYALK+Q+KEECDCKYD LLG+FCE+PV TCVNQCSGHGHCRGGFCQC GWYG
Sbjct: 271 VDPTEAYALKMQYKEECDCKYDCLLGRFCEIPVLCTCVNQCSGHGHCRGGFCQCHRGWYG 330
Query: 304 VDCSIPSVMSSMSEWPQWLRPAHIDIPINANITGNLVNLNAVVKKKRPLLYVYDLPPEFN 363
DCSIPSV+SS+ EWP+WLRPAH+++P + +++G+LVNL+AVVKKKRPL+YVYDLPPEFN
Sbjct: 331 TDCSIPSVLSSVREWPRWLRPAHVEVPDDMHLSGSLVNLDAVVKKKRPLIYVYDLPPEFN 390
Query: 364 SLLLEGRHYKLECVNRIYNEKNETLWTDMLYGSQMAFYESILASPHRTLNGEEADFFFVP 423
SLLLEGRH+K ECVNRIY+++N T WT+ LYG+QMA YESILASPHRTL+GEEADFFFVP
Sbjct: 391 SLLLEGRHFKFECVNRIYDDRNATYWTEQLYGAQMAIYESILASPHRTLDGEEADFFFVP 450
Query: 424 VLDSCIITRADDAPHLSAQEHRGLRSSLTLEFYKKAYEHIIEHYPYWNRTSGRDHIWFFS 483
VLDSCII RADDAPHL+ H GLRSSLTLEFYK AY+HI+E YP+WNR+SGRDHIWFFS
Sbjct: 451 VLDSCIIVRADDAPHLNMHAHGGLRSSLTLEFYKTAYDHIVEQYPFWNRSSGRDHIWFFS 510
Query: 484 WDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAYWADNWDRISSSRRGNHSCFDPEKDL 543
WDEGACYAPKEIW+SMMLVHWGNTNSKHNHSTTAYWADNWD +SS RRGNH CFDP KDL
Sbjct: 511 WDEGACYAPKEIWDSMMLVHWGNTNSKHNHSTTAYWADNWDSVSSDRRGNHPCFDPYKDL 570
Query: 544 VLPAWKAPDAFVLRSKLWASPREKRKTLFYFNGNLGSAYPNGRPESSYSMGVRQKLAEEY 603
VLPAWK PD L SKLW+ PRE+RKTLFYFNGNLG AY GRPE++YSMG+RQK+AEE+
Sbjct: 571 VLPAWKRPDVVSLSSKLWSRPREQRKTLFYFNGNLGPAYEGGRPETTYSMGIRQKVAEEF 630
Query: 604 GSSPNKEGKLGKQHAEDVIVTSLRSENYHEDLSSSVFCGVLPGDGWSGRMEDSILQGCIP 663
GSSPNKEGKLGKQHAEDVIVT LRS NYHE L+SSVFCGV+PGDGWSGR EDSILQGCIP
Sbjct: 631 GSSPNKEGKLGKQHAEDVIVTPLRSGNYHESLASSVFCGVMPGDGWSGRFEDSILQGCIP 690
Query: 664 VVIQDGIFLPYENVLNYESFVVRISEDEIPNLINILRGLNETEIQFRLANVQKVWQRFLY 723
VVIQDGIFLP+EN+LNYESF VRI EDEIPNLI ILRG+NETEI+F+L NV+K+WQRFLY
Sbjct: 691 VVIQDGIFLPFENMLNYESFAVRIREDEIPNLIKILRGMNETEIEFKLENVRKIWQRFLY 750
Query: 724 RDSILLEAKRQNATFGRMNDWAVEFLKLREDDVFTTLIQILHYKLHNDPWRRELVHQKKD 783
RDSILLEA+RQ FG + DWAV+ L+L EDDVF TLIQ+LHYKLHNDPWR++L H KKD
Sbjct: 751 RDSILLEAERQKTAFGNVEDWAVQLLQLSEDDVFATLIQVLHYKLHNDPWRQQLAHLKKD 810
Query: 784 FGIPQECL 791
FG+ QECL
Sbjct: 811 FGLAQECL 818
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225441752|ref|XP_002277596.1| PREDICTED: uncharacterized protein LOC100267584 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224090294|ref|XP_002308967.1| predicted protein [Populus trichocarpa] gi|222854943|gb|EEE92490.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297820564|ref|XP_002878165.1| exostosin family protein [Arabidopsis lyrata subsp. lyrata] gi|297324003|gb|EFH54424.1| exostosin family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|42566010|ref|NP_191322.3| exostosin family protein [Arabidopsis thaliana] gi|44917463|gb|AAS49056.1| At3g57630 [Arabidopsis thaliana] gi|46931284|gb|AAT06446.1| At3g57630 [Arabidopsis thaliana] gi|332646159|gb|AEE79680.1| exostosin family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|42572713|ref|NP_974452.1| exostosin family protein [Arabidopsis thaliana] gi|110740929|dbj|BAE98560.1| hypothetical protein [Arabidopsis thaliana] gi|332646160|gb|AEE79681.1| exostosin family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356500491|ref|XP_003519065.1| PREDICTED: uncharacterized protein LOC100783624 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147846684|emb|CAN80640.1| hypothetical protein VITISV_016911 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255571564|ref|XP_002526728.1| catalytic, putative [Ricinus communis] gi|223533917|gb|EEF35642.1| catalytic, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449501885|ref|XP_004161484.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101226446 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 791 | ||||||
| TAIR|locus:2076691 | 793 | AT3G57630 "AT3G57630" [Arabido | 0.996 | 0.993 | 0.723 | 0.0 | |
| TAIR|locus:2172676 | 469 | F8H "AT5G22940" [Arabidopsis t | 0.176 | 0.298 | 0.307 | 7.8e-23 | |
| TAIR|locus:2159198 | 415 | GUT1 "AT5G61840" [Arabidopsis | 0.145 | 0.277 | 0.323 | 3.8e-21 | |
| TAIR|locus:2016004 | 412 | GUT2 "AT1G27440" [Arabidopsis | 0.201 | 0.385 | 0.277 | 1.6e-20 | |
| TAIR|locus:2144231 | 546 | AT5G11610 "AT5G11610" [Arabido | 0.189 | 0.274 | 0.321 | 9.7e-14 | |
| TAIR|locus:2120933 | 425 | AT4G38040 "AT4G38040" [Arabido | 0.113 | 0.211 | 0.344 | 1.5e-13 | |
| TAIR|locus:2145254 | 654 | AT5G25820 "AT5G25820" [Arabido | 0.189 | 0.229 | 0.289 | 1.6e-13 | |
| TAIR|locus:2027002 | 462 | AT1G21480 "AT1G21480" [Arabido | 0.187 | 0.320 | 0.254 | 1.9e-11 | |
| TAIR|locus:2046163 | 448 | FRA8 "FRAGILE FIBER 8" [Arabid | 0.212 | 0.375 | 0.260 | 2.9e-11 | |
| TAIR|locus:2152632 | 547 | AT5G37000 "AT5G37000" [Arabido | 0.120 | 0.173 | 0.364 | 2.1e-10 |
| TAIR|locus:2076691 AT3G57630 "AT3G57630" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3336 (1179.4 bits), Expect = 0., P = 0.
Identities = 573/792 (72%), Positives = 662/792 (83%)
Query: 1 MISIEKWRFSWXXXXXXXXXXXXXXXXHLFLFPLVPSFDYFTARQQIQNSCVPIKESAER 60
M S +KW+FSW HLFL P+VPSFD T RQ QN C P ES +
Sbjct: 1 MFSHQKWKFSWSQIATVASVIVLVSLVHLFLGPVVPSFDSITVRQA-QNLCGPSNESISQ 59
Query: 61 VTNRVWENSPPQLNLDHRFPADLHNAVVYRNAPWKAEIGRWLSGCDSVAKEVDLVEMIGG 120
VT S + D RFPAD H AVVYRNA WKAEIG+WLS CD+VAKEVD++E IGG
Sbjct: 60 VTKNS-SQSLVVVAFDRRFPADSHGAVVYRNASWKAEIGQWLSSCDAVAKEVDIIEPIGG 118
Query: 121 KSCKSDCSGQGVCNHELGQCRCFHGFRGKGCSERIHFQCNFPKTPELPYGRWVVSICPTH 180
+ C SDCSGQGVCNHE G CRCFHGF G+ CS+++ CN+ KTPE+PYG+WVVSIC H
Sbjct: 119 RKCMSDCSGQGVCNHEFGLCRCFHGFTGEDCSQKLRLDCNYEKTPEMPYGKWVVSICSRH 178
Query: 181 CDTTRAMCFCGEGTKYPNRPVAEACGFQVNLPSQPGAPKSTDWAKADLDNIFTTNGSKPG 240
CDTTRAMCFCGEGTKYPNRPV E+CGFQ+N P+ P PK TDW+K DLD I TTN SK G
Sbjct: 179 CDTTRAMCFCGEGTKYPNRPVPESCGFQINSPTNPDEPKMTDWSKPDLD-ILTTNSSKQG 237
Query: 241 WCNVDPEEAYALKVQFKEECDCKYDGLLGQFCEVPVSSTCVNQCSGHGHCRGGFCQCDSG 300
WCNVDPE+AYA+KV+ KEECDCKYD L G+FCE+PV TCVNQCSGHG CRGGFCQCD G
Sbjct: 238 WCNVDPEDAYAMKVKIKEECDCKYDCLWGRFCEIPVQCTCVNQCSGHGKCRGGFCQCDKG 297
Query: 301 WYGVDCSIPSVMSSMSEWPQWLRPAHIDIPINANITGNLVNLNAVVKKKRPLLYVYDLPP 360
W+G DCSIPS +S++ EWPQWLRPAH+++P N+ GNL+NL+AVVKKKRPL+Y+YDLPP
Sbjct: 298 WFGTDCSIPSTLSTVGEWPQWLRPAHLEVPSEKNVPGNLINLSAVVKKKRPLIYIYDLPP 357
Query: 361 EFNSLLLEGRHYKLECVNRIYNEKNETLWTDMLYGSQMAFYESILASPHRTLNGEEADFF 420
+FNSLL+EGRH+K ECVNRIY+E+N T+WTD LYGSQMAFYE+ILA+ HRT+NGEEADFF
Sbjct: 358 DFNSLLIEGRHFKFECVNRIYDERNATVWTDYLYGSQMAFYENILATAHRTMNGEEADFF 417
Query: 421 FVPVLDSCIITRADDAPHLSAQEHRGLRSSLTLEFYKKAYEHIIEHYPYWNRTSGRDHIW 480
FVPVLDSCII RADDAPH++ Q H GLRSSLTLEFYK+AYEHI+E YPYWNR++GRDHIW
Sbjct: 418 FVPVLDSCIINRADDAPHINMQNHTGLRSSLTLEFYKRAYEHIVEKYPYWNRSAGRDHIW 477
Query: 481 FFSWDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAYWADNWDRISSSRRGNHSCFDPE 540
FFSWDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAY+ DNWD IS RRG+H CFDP
Sbjct: 478 FFSWDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAYFGDNWDDISDERRGDHPCFDPR 537
Query: 541 KDLVLPAWKAPDAFVLRSKLWASPREKRKTLFYFNGNLGSAYPNGRPESSYSMGVRQKLA 600
KDLV+PAWK PD + +R W PREKRKTLFYFNGNLG AY GRPE SYSMG+RQKLA
Sbjct: 538 KDLVIPAWKVPDPYSMRKNYWERPREKRKTLFYFNGNLGPAYEKGRPEDSYSMGIRQKLA 597
Query: 601 EEYGSSPNKEGKLGKQHAEDVIVTSLRSENYHEDLSSSVFCGVLPGDGWSGRMEDSILQG 660
EE+GSSPNKEGKLGKQHAEDVIVT LRS+NYH+D+++S+FCG PGDGWSGRMEDSILQG
Sbjct: 598 EEFGSSPNKEGKLGKQHAEDVIVTPLRSDNYHKDIANSIFCGAFPGDGWSGRMEDSILQG 657
Query: 661 CIPVVIQDGIFLPYENVLNYESFVVRISEDEIPNLINILRGLNETEIQFRLANVQKVWQR 720
C+PV+IQDGI+LPYEN+LNYESF VR++ED+IPNLIN LRG +E EIQFRL NV+++WQR
Sbjct: 658 CVPVIIQDGIYLPYENMLNYESFAVRVNEDDIPNLINTLRGFSEAEIQFRLGNVKELWQR 717
Query: 721 FLYRDSILLEAKRQNATFGRMNDWAVEFLKLREDDVFTTLIQILHYKLHNDPWRRE-LVH 779
FL+RDSILLEA+RQ AT+G DWAV+F KL+ DD+F T+IQ LH+KLHNDPWRRE V+
Sbjct: 718 FLFRDSILLEAERQKATYGHEEDWAVQFSKLKHDDIFATIIQTLHFKLHNDPWRREQAVN 777
Query: 780 QKKDFGIPQECL 791
+ KD+G+PQECL
Sbjct: 778 RTKDYGLPQECL 789
|
|
| TAIR|locus:2172676 F8H "AT5G22940" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2159198 GUT1 "AT5G61840" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2016004 GUT2 "AT1G27440" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2144231 AT5G11610 "AT5G11610" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2120933 AT4G38040 "AT4G38040" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2145254 AT5G25820 "AT5G25820" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2027002 AT1G21480 "AT1G21480" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046163 FRA8 "FRAGILE FIBER 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152632 AT5G37000 "AT5G37000" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 791 | |||
| pfam03016 | 292 | pfam03016, Exostosin, Exostosin family | 4e-64 | |
| pfam07974 | 31 | pfam07974, EGF_2, EGF-like domain | 3e-05 |
| >gnl|CDD|217320 pfam03016, Exostosin, Exostosin family | Back alignment and domain information |
|---|
Score = 215 bits (550), Expect = 4e-64
Identities = 103/357 (28%), Positives = 140/357 (39%), Gaps = 70/357 (19%)
Query: 347 KKKRPLLYVYDLPPEFNSLLLEGRHYKLECVNRIYNEKNETLWTDMLYGSQMAFYESILA 406
K +YVYDLP FN L L + Y ++ ++SIL
Sbjct: 1 SCKGLKVYVYDLPRRFNLL-----EDVLPETSWYLTH---------QYAAESILHKSILN 46
Query: 407 SPHRTLNGEEADFFFVPVLDSCIITRADDAPHLSAQEHRGLRSSLTLEFYKKAYEHIIEH 466
S RTL+ +EAD FFVP S + + +E
Sbjct: 47 SRCRTLDPDEADLFFVPFYTSLSVGTNAVER----------------DLLPSELVEWLES 90
Query: 467 YPYWNRTSGRDHIWFFSWDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAYWADNWDRI 526
PYWNR+ GRDHI S G +
Sbjct: 91 LPYWNRSGGRDHIIVNSHPFGGSAFDRLP-ALNNNTILAVLAGG---------------- 133
Query: 527 SSSRRGNHSCFDPEKDLVLPAWKAPDAFVLRSKLWASPREKRKTLFYFNGNLGSAYPNGR 586
+ F P D+ LPA+ P+ V + P KRKTL +F G A
Sbjct: 134 ----GFSEDQFRPGFDVPLPAYFHPN-SVDDLESDGMPPSKRKTLLFFAGGPRPAGKGAL 188
Query: 587 PESSYSMGVRQKLAEEYGSSPNK--EGKLGKQHAEDVIVTSLRSENYHEDLSSSVFCGVL 644
+ +R L EE +SP+ EG + E NY E L SS FC V
Sbjct: 189 -----ANAIRDLLIEECKNSPDFQCEGNQSCGNPE----------NYMELLRSSRFCLVP 233
Query: 645 PGDG-WSGRMEDSILQGCIPVVIQDGIFLPYENVLNYESFVVRISEDEIPNLINILR 700
PGD S R+ D++ GCIPV+I DG LP+E+V+++ F VR+ E++IP+L ILR
Sbjct: 234 PGDTPTSPRLFDALRAGCIPVIISDGWELPFEDVIDWSKFSVRVPENDIPSLPEILR 290
|
The EXT family is a family of tumour suppressor genes. Mutations of EXT1 on 8q24.1, EXT2 on 11p11-13, and EXT3 on 19p have been associated with the autosomal dominant disorder known as hereditary multiple exostoses (HME). This is the most common known skeletal dysplasia. The chromosomal locations of other EXT genes suggest association with other forms of neoplasia. EXT1 and EXT2 have both been shown to encode a heparan sulphate polymerase with both D-glucuronyl (GlcA) and N-acetyl-D-glucosaminoglycan (GlcNAC) transferase activities. The nature of the defect in heparan sulphate biosynthesis in HME is unclear. Length = 292 |
| >gnl|CDD|219677 pfam07974, EGF_2, EGF-like domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 791 | |||
| PF03016 | 302 | Exostosin: Exostosin family; InterPro: IPR004263 H | 100.0 | |
| KOG1021 | 464 | consensus Acetylglucosaminyltransferase EXT1/exost | 100.0 | |
| KOG2264 | 907 | consensus Exostosin EXT1L [Signal transduction mec | 99.9 | |
| KOG1022 | 691 | consensus Acetylglucosaminyltransferase EXT2/exost | 99.71 | |
| KOG1225 | 525 | consensus Teneurin-1 and related extracellular mat | 99.62 | |
| KOG1225 | 525 | consensus Teneurin-1 and related extracellular mat | 99.47 | |
| KOG1226 | 783 | consensus Integrin beta subunit (N-terminal portio | 99.47 | |
| KOG1226 | 783 | consensus Integrin beta subunit (N-terminal portio | 98.95 | |
| KOG1219 | 4289 | consensus Uncharacterized conserved protein, conta | 98.91 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 98.77 | |
| KOG4289 | 2531 | consensus Cadherin EGF LAG seven-pass G-type recep | 98.68 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 98.55 | |
| KOG4289 | 2531 | consensus Cadherin EGF LAG seven-pass G-type recep | 98.22 | |
| KOG1836 | 1705 | consensus Extracellular matrix glycoprotein Lamini | 98.14 | |
| KOG1219 | 4289 | consensus Uncharacterized conserved protein, conta | 98.12 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 98.0 | |
| KOG1836 | 1705 | consensus Extracellular matrix glycoprotein Lamini | 97.65 | |
| KOG1217 | 487 | consensus Fibrillins and related proteins containi | 97.63 | |
| KOG4260 | 350 | consensus Uncharacterized conserved protein [Funct | 97.63 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 97.55 | |
| KOG3512 | 592 | consensus Netrin, axonal chemotropic factor [Signa | 97.35 | |
| KOG1214 | 1289 | consensus Nidogen and related basement membrane pr | 97.12 | |
| smart00051 | 63 | DSL delta serrate ligand. | 96.98 | |
| KOG1217 | 487 | consensus Fibrillins and related proteins containi | 96.91 | |
| KOG1214 | 1289 | consensus Nidogen and related basement membrane pr | 96.74 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 96.64 | |
| PF00852 | 349 | Glyco_transf_10: Glycosyltransferase family 10 (fu | 96.33 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 96.21 | |
| KOG1218 | 316 | consensus Proteins containing Ca2+-binding EGF-lik | 95.59 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 95.58 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 95.4 | |
| PF00053 | 49 | Laminin_EGF: Laminin EGF-like (Domains III and V); | 95.36 | |
| smart00051 | 63 | DSL delta serrate ligand. | 95.25 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 94.9 | |
| KOG4260 | 350 | consensus Uncharacterized conserved protein [Funct | 94.74 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 94.57 | |
| cd00055 | 50 | EGF_Lam Laminin-type epidermal growth factor-like | 94.48 | |
| PF01414 | 63 | DSL: Delta serrate ligand; InterPro: IPR001774 Lig | 94.48 | |
| cd03820 | 348 | GT1_amsD_like This family is most closely related | 94.44 | |
| cd03814 | 364 | GT1_like_2 This family is most closely related to | 94.42 | |
| KOG1218 | 316 | consensus Proteins containing Ca2+-binding EGF-lik | 94.37 | |
| cd03801 | 374 | GT1_YqgM_like This family is most closely related | 94.08 | |
| PF00534 | 172 | Glycos_transf_1: Glycosyl transferases group 1; In | 93.88 | |
| smart00180 | 46 | EGF_Lam Laminin-type epidermal growth factor-like | 93.87 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 93.67 | |
| cd03819 | 355 | GT1_WavL_like This family is most closely related | 93.66 | |
| cd03823 | 359 | GT1_ExpE7_like This family is most closely related | 93.62 | |
| cd03822 | 366 | GT1_ecORF704_like This family is most closely rela | 93.32 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 93.12 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 93.04 | |
| PLN02871 | 465 | UDP-sulfoquinovose:DAG sulfoquinovosyltransferase | 92.7 | |
| cd03818 | 396 | GT1_ExpC_like This family is most closely related | 92.59 | |
| PRK09814 | 333 | beta-1,6-galactofuranosyltransferase; Provisional | 92.42 | |
| cd04962 | 371 | GT1_like_5 This family is most closely related to | 92.35 | |
| KOG2619 | 372 | consensus Fucosyltransferase [Carbohydrate transpo | 92.3 | |
| cd03800 | 398 | GT1_Sucrose_synthase This family is most closely r | 92.27 | |
| cd03794 | 394 | GT1_wbuB_like This family is most closely related | 92.12 | |
| cd03808 | 359 | GT1_cap1E_like This family is most closely related | 92.11 | |
| cd05844 | 367 | GT1_like_7 Glycosyltransferases catalyze the trans | 92.01 | |
| TIGR03088 | 374 | stp2 sugar transferase, PEP-CTERM/EpsH1 system ass | 91.7 | |
| KOG3607 | 716 | consensus Meltrins, fertilins and related Zn-depen | 91.49 | |
| cd03809 | 365 | GT1_mtfB_like This family is most closely related | 91.33 | |
| PF04863 | 56 | EGF_alliinase: Alliinase EGF-like domain; InterPro | 91.17 | |
| TIGR03449 | 405 | mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino | 90.74 | |
| PRK15427 | 406 | colanic acid biosynthesis glycosyltransferase WcaL | 90.11 | |
| PF05686 | 395 | Glyco_transf_90: Glycosyl transferase family 90; I | 89.68 | |
| PF13524 | 92 | Glyco_trans_1_2: Glycosyl transferases group 1 | 89.65 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 89.42 | |
| cd03795 | 357 | GT1_like_4 This family is most closely related to | 89.35 | |
| TIGR03087 | 397 | stp1 sugar transferase, PEP-CTERM/EpsH1 system ass | 89.2 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 89.2 | |
| KOG3607 | 716 | consensus Meltrins, fertilins and related Zn-depen | 88.67 | |
| cd03821 | 375 | GT1_Bme6_like This family is most closely related | 88.67 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 88.6 | |
| KOG3512 | 592 | consensus Netrin, axonal chemotropic factor [Signa | 87.97 | |
| cd03804 | 351 | GT1_wbaZ_like This family is most closely related | 87.56 | |
| PF13692 | 135 | Glyco_trans_1_4: Glycosyl transferases group 1; PD | 87.47 | |
| cd03798 | 377 | GT1_wlbH_like This family is most closely related | 87.43 | |
| PRK15484 | 380 | lipopolysaccharide 1,2-N-acetylglucosaminetransfer | 87.42 | |
| PF12955 | 103 | DUF3844: Domain of unknown function (DUF3844); Int | 87.39 | |
| PF01414 | 63 | DSL: Delta serrate ligand; InterPro: IPR001774 Lig | 87.34 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 87.22 | |
| cd00055 | 50 | EGF_Lam Laminin-type epidermal growth factor-like | 87.13 | |
| cd03816 | 415 | GT1_ALG1_like This family is most closely related | 87.01 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 86.86 | |
| TIGR02472 | 439 | sucr_P_syn_N sucrose-phosphate synthase, putative, | 86.81 | |
| cd03807 | 365 | GT1_WbnK_like This family is most closely related | 86.76 | |
| PRK10307 | 412 | putative glycosyl transferase; Provisional | 86.24 | |
| cd04951 | 360 | GT1_WbdM_like This family is most closely related | 86.12 | |
| cd03802 | 335 | GT1_AviGT4_like This family is most closely relate | 86.07 | |
| PF00053 | 49 | Laminin_EGF: Laminin EGF-like (Domains III and V); | 85.91 | |
| PF12955 | 103 | DUF3844: Domain of unknown function (DUF3844); Int | 85.3 | |
| PF04863 | 56 | EGF_alliinase: Alliinase EGF-like domain; InterPro | 84.96 | |
| cd03792 | 372 | GT1_Trehalose_phosphorylase Trehalose phosphorylas | 84.63 | |
| cd04949 | 372 | GT1_gtfA_like This family is most closely related | 84.44 | |
| TIGR02149 | 388 | glgA_Coryne glycogen synthase, Corynebacterium fam | 83.8 | |
| cd03805 | 392 | GT1_ALG2_like This family is most closely related | 83.75 | |
| cd03806 | 419 | GT1_ALG11_like This family is most closely related | 82.06 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 81.4 | |
| cd03817 | 374 | GT1_UGDG_like This family is most closely related | 80.86 | |
| smart00180 | 46 | EGF_Lam Laminin-type epidermal growth factor-like | 80.73 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 80.33 |
| >PF03016 Exostosin: Exostosin family; InterPro: IPR004263 Hereditary multiple exostoses (EXT) is an autosomal dominant disorder that is characterised by the appearance of multiple outgrowths of the long bones (exostoses) at their epiphyses [] | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.7e-52 Score=448.00 Aligned_cols=298 Identities=36% Similarity=0.638 Sum_probs=220.7
Q ss_pred cCCCeEEEecCChhhhHHhhhcccccccccccccCCCCcccccccchhhHHHHHHHhhcCCcccCCcCCccEEEEeccce
Q 003853 348 KKRPLLYVYDLPPEFNSLLLEGRHYKLECVNRIYNEKNETLWTDMLYGSQMAFYESILASPHRTLNGEEADFFFVPVLDS 427 (791)
Q Consensus 348 ~~~p~IYVYdLP~~fn~~ll~~~~~~~~c~~~~~~~~~~~~w~~~~y~~e~~~~e~l~~s~~rT~dP~eAd~FyVP~~~~ 427 (791)
.+++||||||||++||.+++.... ........+.+|++|.+||++|++|++||.||+|||+||||+|.+
T Consensus 2 ~~~lkVYVY~lp~~~~~~~~~~~~-----------~~~~~~~~~~~~~~e~~l~~~l~~s~~~T~dp~eAdlF~vP~~~~ 70 (302)
T PF03016_consen 2 HRGLKVYVYPLPPKFNKDLLDPRE-----------DEQCSWYETSQYALEVILHEALLNSPFRTDDPEEADLFFVPFYSS 70 (302)
T ss_pred CCCCEEEEEeCCccccccceeccc-----------cccCCCcccccchHHHHHHHHHHhCCcEeCCHHHCeEEEEEcccc
Confidence 467899999999999999883211 112222345689999999999999999999999999999999998
Q ss_pred eeeeecCCCCCccccccccccchhhHHHHHHHHHHHHhhCccccccCCCCeEEEeccCCCCCCCchh--cccceeeeccc
Q 003853 428 CIITRADDAPHLSAQEHRGLRSSLTLEFYKKAYEHIIEHYPYWNRTSGRDHIWFFSWDEGACYAPKE--IWNSMMLVHWG 505 (791)
Q Consensus 428 ~~~~~~~~~p~~~~~~~~~~r~~~~~~~~~~~~~~i~~~~PyWnRs~GrDH~~~~~~D~g~~~~~~~--~~~s~~l~~~g 505 (791)
+........+ ......+.+..++.++.+++|||||++|+||||++++|+|.|..... +.+..+
T Consensus 71 ~~~~~~~~~~----------~~~~~~~~~~~~~~~~~~~~p~w~r~~G~dH~~~~~~~~g~~~~~~~~~~~~~~~----- 135 (302)
T PF03016_consen 71 CYFHHWWGSP----------NSGADRDSLSDALRHLLASYPYWNRSGGRDHFFVNSHDRGGCSFDRNPRLMNNSI----- 135 (302)
T ss_pred cccccccCCc----------cchhhHHHHHHHHHHHHhcCchhhccCCCCeEEEeccccccccccccHhhhccch-----
Confidence 8741111110 11122344556677777899999999999999999999988874321 111111
Q ss_pred CCcccccccccccccCCccccCCCCCCCCCcccCCCceeecCcccCCchhhcccccCCCccCCceEEEeecCCCCCCCCC
Q 003853 506 NTNSKHNHSTTAYWADNWDRISSSRRGNHSCFDPEKDLVLPAWKAPDAFVLRSKLWASPREKRKTLFYFNGNLGSAYPNG 585 (791)
Q Consensus 506 ~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~f~p~kDvviP~~~~~~~~~~~~~l~~~~~~~R~~L~~F~G~~~~~~~~~ 585 (791)
.++.... .....+|+|++||++|++...............+..+|++|++|+|+....
T Consensus 136 ----------~~~~~~~--------~~~~~~~~~~~Di~~P~~~~~~~~~~~~~~~~~~~~~R~~l~~f~g~~~~~---- 193 (302)
T PF03016_consen 136 ----------RAVVAFS--------SFSSSCFRPGFDIVIPPFVPPSSLPDWRPWPQRPPARRPYLLFFAGTIRPS---- 193 (302)
T ss_pred ----------hheeccC--------CCCcCcccCCCCeeccccccccccCCccccccCCccCCceEEEEeeecccc----
Confidence 1110000 012457999999999998766543322222334678999999999997531
Q ss_pred CCCCCcchhHHHHHHHHhcCCCCCccccCcccCcceEEecCCchhHHHhhccCeEEEeCCCCCC-chhHHHHHhhCCeeE
Q 003853 586 RPESSYSMGVRQKLAEEYGSSPNKEGKLGKQHAEDVIVTSLRSENYHEDLSSSVFCGVLPGDGW-SGRMEDSILQGCIPV 664 (791)
Q Consensus 586 ~~~~~ys~~iR~~L~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~y~~~l~~S~FCl~p~G~~~-s~R~~dal~~GCIPV 664 (791)
...|++++|+.|++.+++.++.....+ ........+|.+.|++|+|||+|+|++. +.||+|||++|||||
T Consensus 194 --~~~~~~~~r~~l~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~l~~S~FCL~p~G~~~~s~Rl~eal~~GcIPV 264 (302)
T PF03016_consen 194 --SNDYSGGVRQRLLDECKSDPDFRCSDG-------SETCPSPSEYMELLRNSKFCLCPRGDGPWSRRLYEALAAGCIPV 264 (302)
T ss_pred --ccccchhhhhHHHHhcccCCcceeeec-------ccccccchHHHHhcccCeEEEECCCCCcccchHHHHhhhceeeE
Confidence 111678999999999977654321110 0112345679999999999999999985 899999999999999
Q ss_pred EEecccccCCcccCCCCcEEEEecCCChhhHHHHHhcC
Q 003853 665 VIQDGIFLPYENVLNYESFVVRISEDEIPNLINILRGL 702 (791)
Q Consensus 665 ii~d~~~lPf~~~idw~~~sv~i~~~~~~~l~~~L~~i 702 (791)
||+|+++|||+++|||++|||+|+++++++|++||++|
T Consensus 265 ii~d~~~lPf~~~ldw~~fsv~v~~~~~~~l~~iL~~i 302 (302)
T PF03016_consen 265 IISDDYVLPFEDVLDWSRFSVRVPEADLPELPEILRSI 302 (302)
T ss_pred EecCcccCCcccccCHHHEEEEECHHHHHHHHHHHhcC
Confidence 99999999999999999999999999999999999987
|
Mutations in two homologous genes, EXT1 and EXT2, are responsible for the EXT syndrome. The human and mouse EXT genes have at least two homologs in the invertebrate Caenorhabditis elegans, indicating that they do not function exclusively as regulators of bone growth. EXT1 and EXT2 have both been shown to encode glycosyltransferases involved in the chain elongation step of heparan sulphate biosynthesis [].; GO: 0016020 membrane |
| >KOG1021 consensus Acetylglucosaminyltransferase EXT1/exostosin 1 [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Extracellular structures] | Back alignment and domain information |
|---|
| >KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1022 consensus Acetylglucosaminyltransferase EXT2/exostosin 2 [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1225 consensus Teneurin-1 and related extracellular matrix proteins, contain EGF-like repeats [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1225 consensus Teneurin-1 and related extracellular matrix proteins, contain EGF-like repeats [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1226 consensus Integrin beta subunit (N-terminal portion of extracellular region) [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1226 consensus Integrin beta subunit (N-terminal portion of extracellular region) [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1836 consensus Extracellular matrix glycoprotein Laminin subunits alpha and gamma [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG1836 consensus Extracellular matrix glycoprotein Laminin subunits alpha and gamma [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4260 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG3512 consensus Netrin, axonal chemotropic factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF00852 Glyco_transf_10: Glycosyltransferase family 10 (fucosyltransferase); InterPro: IPR001503 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >KOG1218 consensus Proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG4260 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates | Back alignment and domain information |
|---|
| >cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >KOG1218 consensus Proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known | Back alignment and domain information |
|---|
| >PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase | Back alignment and domain information |
|---|
| >cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK09814 beta-1,6-galactofuranosyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >KOG2619 consensus Fucosyltransferase [Carbohydrate transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds | Back alignment and domain information |
|---|
| >TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated | Back alignment and domain information |
|---|
| >KOG3607 consensus Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PF04863 EGF_alliinase: Alliinase EGF-like domain; InterPro: IPR006947 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species | Back alignment and domain information |
|---|
| >TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase | Back alignment and domain information |
|---|
| >PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional | Back alignment and domain information |
|---|
| >PF05686 Glyco_transf_90: Glycosyl transferase family 90; InterPro: IPR006598 Cryptococcus neoformans is a pathogenic fungus which most commonly affects the central nervous system and causes fatal meningoencephalitis primarily in patients with AIDS | Back alignment and domain information |
|---|
| >PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >KOG3607 consensus Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >KOG3512 consensus Netrin, axonal chemotropic factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A | Back alignment and domain information |
|---|
| >cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional | Back alignment and domain information |
|---|
| >PF12955 DUF3844: Domain of unknown function (DUF3844); InterPro: IPR024382 This presumed domain is found in fungal species | Back alignment and domain information |
|---|
| >PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain | Back alignment and domain information |
|---|
| >cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK10307 putative glycosyl transferase; Provisional | Back alignment and domain information |
|---|
| >cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli | Back alignment and domain information |
|---|
| >cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation | Back alignment and domain information |
|---|
| >PF12955 DUF3844: Domain of unknown function (DUF3844); InterPro: IPR024382 This presumed domain is found in fungal species | Back alignment and domain information |
|---|
| >PF04863 EGF_alliinase: Alliinase EGF-like domain; InterPro: IPR006947 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species | Back alignment and domain information |
|---|
| >cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose | Back alignment and domain information |
|---|
| >cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding | Back alignment and domain information |
|---|
| >TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family | Back alignment and domain information |
|---|
| >cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 791 | |||
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 3e-14 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 1e-08 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 2e-06 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 1e-05 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 3e-11 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 2e-06 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 4e-11 | |
| 2ddu_A | 387 | Reelin; beta-jelly-roll, signaling protein; 2.05A | 7e-10 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 2e-09 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 6e-09 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 2e-08 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 2e-08 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 3e-08 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 3e-08 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 8e-08 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 9e-08 | |
| 2uvo_A | 171 | Agglutinin isolectin 1; carbohydrate-binding prote | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 | |
| 2p26_A | 280 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 2e-06 | |
| 2p26_A | 280 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 6e-04 | |
| 3t3p_B | 472 | Integrin beta-3; integrin, cell adhesion, blood cl | 2e-06 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 2e-06 | |
| 3v4v_B | 503 | Integrin beta-7; cell adhesion, madcam-1, membrane | 7e-06 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 7e-06 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 4e-05 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 1e-04 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 2e-04 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 2e-04 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 1e-04 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 5e-04 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 8e-04 |
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
Score = 75.5 bits (185), Expect = 3e-14
Identities = 40/191 (20%), Positives = 58/191 (30%), Gaps = 36/191 (18%)
Query: 123 CKSDCSGQGVCNHELGQCRCFHGFRGKGCSERIHFQCNFPKTPELPYGRWVVSICPTHCD 182
+S C G+G G CRC G+ GK C + + + IC D
Sbjct: 433 DRSLCHGKGFLEC--GICRCDTGYIGKNCECQTQGRSSQELEGSCRKD-NNSIICSGLGD 489
Query: 183 TTRAMCFCGEGTKYPNRPVAEACGFQVNLPSQPGAPKSTDWAKADLDNIFTTNGSKPGWC 242
C CG+ + + + G D + N G G C
Sbjct: 490 -----CVCGQCLCHTSDVPGKLIY---------GQYCECDTINCERYNGQVCGGPGRGLC 535
Query: 243 NVDPEEAYALKVQFKEECDCKYDGLLGQFCEVPVS-----STCVNQCSGHGHCRGGFCQC 297
+C C G G C+ + + +CSG G CR C+C
Sbjct: 536 FCG-------------KCRCH-PGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNVCEC 581
Query: 298 DSGWYGVDCSI 308
SG+ C
Sbjct: 582 HSGYQLPLCQE 592
|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Length = 217 | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Length = 217 | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Length = 725 | Back alignment and structure |
|---|
| >2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} Length = 387 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2uvo_A Agglutinin isolectin 1; carbohydrate-binding protein, hevein domain, chitin-binding, GERM agglutinin, chitin-binding protein; HET: NDG NAG GOL; 1.40A {Triticum aestivum} PDB: 1wgc_A* 2cwg_A* 2uwg_A* 2x3t_A* 4aml_A* 7wga_A 9wga_A 2wgc_A 1wgt_A 1k7t_A* 1k7v_A* 1k7u_A 2uwz_A* 2x52_A* 1t0w_A* Length = 171 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Length = 280 | Back alignment and structure |
|---|
| >2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Length = 280 | Back alignment and structure |
|---|
| >3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Length = 472 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* Length = 503 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Length = 188 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 791 | |||
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.72 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.56 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 99.54 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.43 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.36 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 99.34 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.29 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 99.28 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.23 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.18 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.16 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.1 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.08 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 98.97 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 98.96 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 98.93 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 98.61 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 98.55 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 98.46 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 98.32 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 98.24 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 98.23 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.23 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 98.21 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.06 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 98.04 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 98.02 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 98.0 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 97.94 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 97.88 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 97.85 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 97.85 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 97.84 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 97.72 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 97.7 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.67 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 97.64 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 97.56 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 97.52 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 97.5 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 97.49 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 97.43 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 97.37 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 97.36 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 97.33 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 97.31 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 97.28 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 97.27 | |
| 2p26_A | 280 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 97.26 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 97.21 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 97.2 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 97.18 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.1 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 97.09 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 97.08 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 97.06 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 97.05 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 96.99 | |
| 2p26_A | 280 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 96.98 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 96.96 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 96.94 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 96.93 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 96.81 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 96.69 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 96.65 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 96.65 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 96.63 | |
| 3qhp_A | 166 | Type 1 capsular polysaccharide biosynthesis prote | 96.6 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 96.57 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 96.42 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 96.29 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 96.25 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 96.16 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 96.05 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 95.97 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 95.96 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 95.95 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 95.94 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 95.88 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 95.87 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 95.82 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 95.74 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 95.7 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 95.66 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 95.65 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 95.46 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 95.41 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 95.22 | |
| 2ddu_A | 387 | Reelin; beta-jelly-roll, signaling protein; 2.05A | 95.16 | |
| 2ddu_A | 387 | Reelin; beta-jelly-roll, signaling protein; 2.05A | 95.1 | |
| 2bfw_A | 200 | GLGA glycogen synthase; glycosyltransferase family | 95.0 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 94.8 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 94.71 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 94.43 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 94.36 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 94.14 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 94.1 | |
| 2gek_A | 406 | Phosphatidylinositol mannosyltransferase (PIMA); G | 93.96 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 93.86 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 93.77 | |
| 2jjm_A | 394 | Glycosyl transferase, group 1 family protein; anth | 93.64 | |
| 3okp_A | 394 | GDP-mannose-dependent alpha-(1-6)-phosphatidylino | 93.45 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 93.27 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 93.18 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 92.91 | |
| 3c48_A | 438 | Predicted glycosyltransferases; retaining glycosyl | 92.69 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 92.68 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 92.42 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 92.3 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 92.18 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 91.84 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 91.48 | |
| 2f9f_A | 177 | First mannosyl transferase (WBAZ-1); alpha-beta pr | 91.4 | |
| 2iw1_A | 374 | Lipopolysaccharide core biosynthesis protein RFAG; | 91.31 | |
| 1f0k_A | 364 | MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe | 90.82 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 90.79 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 89.94 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 89.85 | |
| 2nzw_A | 371 | Alpha1,3-fucosyltransferase; FUCT, GT 10; 1.90A {H | 89.68 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 89.39 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 89.24 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 88.97 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 88.91 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 88.84 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 88.84 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 87.94 | |
| 3fro_A | 439 | GLGA glycogen synthase; glycosyltransferase family | 87.36 | |
| 3t3p_B | 472 | Integrin beta-3; integrin, cell adhesion, blood cl | 87.19 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 87.1 | |
| 3rhz_A | 339 | GTF3, nucleotide sugar synthetase-like protein; gl | 86.18 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 86.03 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 85.96 | |
| 3t3p_B | 472 | Integrin beta-3; integrin, cell adhesion, blood cl | 85.13 | |
| 3oy2_A | 413 | Glycosyltransferase B736L; rossmann fold, GDP-mann | 85.04 | |
| 2r60_A | 499 | Glycosyl transferase, group 1; rossmann-fold; 1.80 | 84.28 | |
| 2x6q_A | 416 | Trehalose-synthase TRET; biosynthetic protein; 2.2 | 84.23 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 83.69 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 83.57 | |
| 3g5c_A | 510 | ADAM 22; alpha/beta fold, cross-linked domain, cel | 83.49 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 82.91 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 81.78 | |
| 3v4v_B | 503 | Integrin beta-7; cell adhesion, madcam-1, membrane | 81.17 | |
| 3g5c_A | 510 | ADAM 22; alpha/beta fold, cross-linked domain, cel | 80.85 | |
| 2qzs_A | 485 | Glycogen synthase; glycosyl-transferase, GT-B fold | 80.09 |
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.72 E-value=4.2e-18 Score=184.64 Aligned_cols=160 Identities=26% Similarity=0.561 Sum_probs=65.9
Q ss_pred cccCCCCCCCCCCCCEEecCCCeeeeCCCCcCCCCCccccCCCCCCCCCCCCCCCcccccCCCCCCCC-CCeeeeCCCcc
Q 003853 117 MIGGKSCKSDCSGQGVCNHELGQCRCFHGFRGKGCSERIHFQCNFPKTPELPYGRWVVSICPTHCDTT-RAMCFCGEGTK 195 (791)
Q Consensus 117 ~~~~~~C~~~Cs~~G~C~~~~G~C~C~~G~~G~~Ce~~~~~~C~~~~~~~~~~g~~~~~~C~g~C~~~-~g~C~C~~G~~ 195 (791)
.+....|++.|+++|+|+. .+.|.|++||+|++|+.. .|.. .|.+...|. .+.|.|++||+
T Consensus 145 ~C~~~~C~~~C~~~G~C~~-~~~C~C~~G~~G~~C~~~---~C~~--------------~C~~~G~C~~~~~C~C~~G~~ 206 (324)
T 2ygq_A 145 TCQQAECPGGCRNGGFCNE-RRICECPDGFHGPHCEKA---LCTP--------------RCMNGGLCVTPGFCICPPGFY 206 (324)
T ss_dssp EECCCCCSSCCCSSCEECT-TSCEECCTTEESSSSCEE---SSSS--------------CCCTTCEECSSCCEECCTTCB
T ss_pred cccCCCCCCCCCCCCEECC-CCeEECCCCCcCCCCCCC---CCCC--------------CCCCCCEEcCCCEEeCCCCcc
Confidence 3445789999999999985 789999999999999974 3432 344222222 57999999999
Q ss_pred cCCCCCCCcCCCcc-cCCCC---CCCCCCCCCcccCcCc-ccCCCCCCCccccCCcchhhcccccccCccccCCCCCCCc
Q 003853 196 YPNRPVAEACGFQV-NLPSQ---PGAPKSTDWAKADLDN-IFTTNGSKPGWCNVDPEEAYALKVQFKEECDCKYDGLLGQ 270 (791)
Q Consensus 196 G~~c~~~~~C~~~~-~~~~~---~~~~c~~gw~g~~c~~-~~~~~C~~~G~C~~~~~~~~~~~~c~~g~C~C~~~G~~G~ 270 (791)
|..|+.. .|.... ....| ..+.|.+||.|..|+. .....|.++|.|.. .++|.|. +||+|.
T Consensus 207 G~~C~~~-~C~~~C~~~G~C~~~~~C~C~~G~~G~~C~~~~C~~~C~~~g~C~~------------~~~C~C~-~G~~G~ 272 (324)
T 2ygq_A 207 GVNCDKA-NCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIG------------KSKCKCS-KGYQGD 272 (324)
T ss_dssp TTTTCBC-CCSSCCCSSCCBSCSSCBCCCTTCCTTTTC------------------------------------------
T ss_pred CCCcccC-cCCCCCCCCCeeCCCCeeeCCCCccCCCCCcCcCCCcCCCCCEECC------------CCEEECC-CCCcCC
Confidence 9998643 232111 01111 2456899999999973 22356778888853 4799999 999999
Q ss_pred ccccccccCcCCCCCCCceec-CCeeecCCCcccCCCCCccc
Q 003853 271 FCEVPVSSTCVNQCSGHGHCR-GGFCQCDSGWYGVDCSIPSV 311 (791)
Q Consensus 271 ~Ce~~~~~~C~~~Cs~~G~C~-~G~C~C~~G~~G~~C~~~~~ 311 (791)
.|+.. .|.++|+++|+|+ .+.|.|.+||+|.+|+....
T Consensus 273 ~C~~~---~C~~~C~~~g~C~~~~~C~C~~G~~G~~C~~~~~ 311 (324)
T 2ygq_A 273 LCSKP---VCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYE 311 (324)
T ss_dssp ------------------------------------------
T ss_pred CCcCC---CCCCCCCCCCEECCCCEeECCCCCcCCCCCCCCc
Confidence 99965 6888999999998 78999999999999998753
|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* | Back alignment and structure |
|---|
| >3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 | Back alignment and structure |
|---|
| >2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* | Back alignment and structure |
|---|
| >1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >2nzw_A Alpha1,3-fucosyltransferase; FUCT, GT 10; 1.90A {Helicobacter pylori} SCOP: c.87.1.11 PDB: 2nzx_A* 2nzy_A* | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* | Back alignment and structure |
|---|
| >3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* | Back alignment and structure |
|---|
| >3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* | Back alignment and structure |
|---|
| >2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* | Back alignment and structure |
|---|
| >2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* | Back alignment and structure |
|---|
| >3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} | Back alignment and structure |
|---|
| >2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 791 | ||||
| d1l3ya_ | 41 | g.3.11.6 (A:) Integrin beta EGF-like domains {Huma | 4e-06 | |
| d1jv2b4 | 31 | g.3.11.6 (B:532-562) Integrin beta EGF-like domain | 2e-05 | |
| d1jv2b5 | 43 | g.3.11.6 (B:563-605) Integrin beta EGF-like domain | 2e-04 |
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: Integrin beta EGF-like domains domain: Integrin beta EGF-like domains species: Human (Homo sapiens) [TaxId: 9606]
Score = 42.1 bits (99), Expect = 4e-06
Identities = 9/24 (37%), Positives = 11/24 (45%)
Query: 284 CSGHGHCRGGFCQCDSGWYGVDCS 307
G G C G C+C G+ G C
Sbjct: 17 GPGRGLCFCGKCRCHPGFEGSACQ 40
|
| >d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 31 | Back information, alignment and structure |
|---|
| >d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 791 | |||
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 97.88 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.86 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 97.82 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.77 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 97.77 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.73 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.65 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.58 | |
| d1jv2b4 | 31 | Integrin beta EGF-like domains {Human (Homo sapien | 97.56 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 97.55 | |
| d1jv2b4 | 31 | Integrin beta EGF-like domains {Human (Homo sapien | 97.47 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 97.39 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.35 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 97.31 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 97.28 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 97.27 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 97.26 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 97.21 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 97.06 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 97.04 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.02 | |
| d1jv2b5 | 43 | Integrin beta EGF-like domains {Human (Homo sapien | 97.0 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 96.94 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 96.87 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 96.81 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 96.77 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 96.75 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 96.72 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.68 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 96.66 | |
| d1jv2b5 | 43 | Integrin beta EGF-like domains {Human (Homo sapien | 96.59 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 96.48 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 96.46 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 96.09 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 96.04 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 95.84 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 95.72 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 94.99 | |
| d2nzwa1 | 349 | Alpha1,3-fucosyltransferase FucT {Helicobacter pyl | 94.65 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 94.32 | |
| d2bisa1 | 437 | Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI | 94.18 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 93.81 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 93.44 | |
| d1kloa3 | 51 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 92.6 | |
| d1kloa2 | 56 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 92.18 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 91.19 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 90.71 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 90.46 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 90.09 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 89.79 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 89.73 | |
| d2iw1a1 | 370 | Lipopolysaccharide core biosynthesis protein RfaG | 89.35 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 89.3 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 88.95 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 88.87 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 87.31 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 83.72 | |
| d1kloa3 | 51 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 83.22 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 82.92 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 82.56 | |
| d2bfwa1 | 196 | Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI | 81.28 |
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Factor IX (IXa) species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.88 E-value=5.3e-06 Score=58.53 Aligned_cols=34 Identities=35% Similarity=1.023 Sum_probs=29.5
Q ss_pred CCCC-CCCCCCCCEEecCCC--eeeeCCCCcCCCCCc
Q 003853 120 GKSC-KSDCSGQGVCNHELG--QCRCFHGFRGKGCSE 153 (791)
Q Consensus 120 ~~~C-~~~Cs~~G~C~~~~G--~C~C~~G~~G~~Ce~ 153 (791)
.++| +++|.++|+|....+ +|.|++||+|++||.
T Consensus 3 ~d~C~~~PC~ngg~C~~~~~~y~C~C~~g~~G~~Cei 39 (39)
T d1edmb_ 3 GDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCEL 39 (39)
T ss_dssp CCTTTTCCCCTTCEEEEETTEEEEECCTTCCSTTSCC
T ss_pred cccCCCCCCCCCcEEEcCCCCEEEECCCCCCCCCCCC
Confidence 4788 789999999986555 799999999999984
|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nzwa1 c.87.1.11 (A:1-349) Alpha1,3-fucosyltransferase FucT {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|