Citrus Sinensis ID: 003861

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-
MLESLACYHHSPKVYDIFGQTSSIRAYGHDSYGVLYLCKQKIHVQSHVENFKVYHRSFAFVNSFEGRKLLAPSISGWRCLSFSNNNRPQTRWEGFRTYAAAEVAGAVDVINDLGLDTLTFLAVTVIVVPVFKIARASPILGFFFAGIVLNQLGIIRNLTDVKVLSEWGILFLLFEMGLELSLARLKALAKFAFGMGLTQVVLSTLAFTAFELPPNGAVGTRILEFLFHSRSDLVNIRSIDEAVVIGAALSLSSSAFVLQLLAEKGELPTRFGSATLGILLLQDIAVVPLLVILPVLESQVSESVWPMLVKESLKALAGLGLLSLGGKYLLRRVFEVVAEARSSEAFVALCLLTVAGTSLLTQKLGFSDTLGAFLAGAILAETNFRTQIEADIRPFRGLLLGLFFVTTGSSIDIELLFREWPNVLALLAGLIIIKTLIISAIGPRVGLTLQESVRIGLLLSQGGEFAFVVFSLANRLGVLPLELNKLLIIVVVLSMALTPLLNEIGRWAADFIDDKFGSEDKVEEMVNYEGSEPVVIVGFGQMGQVLANLLSAPLASGSDGNTVGWPFVAFDLNPSVVKESRKLGFPILYGDASRPAVLLSAGITSPKAVMIMYTDKKRTIEAVQRLRLAFPAIPIYARAQDMMHLLDLKKAGATDAILENAETSLQLGSKLLKGFGVMSDDVTFLRQLVRNSMEIQAQEVLSQKDDQEFDIMKPLQVRVADIVEAEKTIPSTSNDDKLSREDNTDTAGEDAKGVLYCELNGTNNFLDQTKGAGEMNTVNPSMPLITTTEES
ccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHccccccHHHHHHHHHHHHcccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHccccccccEEEEccccccHHHHHHHHcccccccccccccccEEEEEccHHHHHHHHHccccEEEcccccHHHHHHcccccccEEEEEEccHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHccccEEEcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccc
ccHHHHHHHccccEEEcccccccHHHEccccEEEEEEccccccccccccccccEEEEEccHHHcccccccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHEEEccccccccHHHHHHHHHHHHHHHHHHEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEccHHHHHHHHHHHHHcccccccccccccEEEEEccHHHHHHHHHccccEEEccccHHHHHHHccccccEEEEEEcccHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHccccEcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccHccccccccccccccccccccccccccEEEEEEccccccHHccccccccccccccccEEEccccc
mleslacyhhspkvydifgqtssirayghdsyGVLYLCKQKIHVQSHVENFKVYHRSFAFVNSfegrkllapsisgwrclsfsnnnrpqtrwEGFRTYAAAEVAGAVDVINDLGLDTLTFLAVTVIVVPVFkiaraspilgFFFAGIVLNQLGIIRNLTDVKVLSEWGILFLLFEMGLELSLARLKALAKFAFGMGLTQVVLSTLAftafelppngavgTRILEFLFHSrsdlvnirsiDEAVVIGAALSLSSSAFVLQLLAEkgelptrfgsaTLGILLLQDIAVVPLLVILPVlesqvsesvWPMLVKESLKALAGLGLLSLGGKYLLRRVFEVVAEARSSEAFVALCLLTVAGTslltqklgfsDTLGAFLAGAILAETNFRTQIEADIRPFRGLLLGLFFVTTGSSIDIELLFREWPNVLALLAGLIIIKTLIIsaigprvgltLQESVRIGLLLSQGGEFAFVVFSLANrlgvlpleLNKLLIIVVVLSMALTPLLNEIGRWAADfiddkfgsedKVEEMVNYEGSEPVVIVGFGQMGQVLANLlsaplasgsdgntvgwpfvafdlnpsvvkesrklgfpilygdasrpavllsagitspkAVMIMYTDKKRTIEAVQRLRLAFPAIPIYARAQDMMHLLDLKKAGATDAILENAETSLQLGSKLLkgfgvmsddVTFLRQLVRNSMEIQAQEVlsqkddqefdimkplQVRVADIVEAektipstsnddklsredntdtagedakGVLYCelngtnnfldqtkgagemntvnpsmplitttees
MLESLACYHHSPKVYDIFGQTSSIRAYGHDSYGVLYLCKQKIHVQSHVENFKVYHRSFAFVNSFEGRKLLAPSISGWRCLSFSNNNRPQTRWEGFRTYAAAEVAGAVDVINDLGLDTLTFLAVTVIVVPVFKIARASPILGFFFAGIVLNQLGIIRNLTDVKVLSEWGILFLLFEMGLELSLARLKALAKFAFGMGLTQVVLSTLAFTAFELPPNGAVGTRILEFLFHSRSDLVNIRSIDEAVVIGAALSLSSSAFVLQLLAEKGELPTRFGSATLGILLLQDIAVVPLLVILPVLESQVSESVWPMLVKESLKALAGLGLLSLGGKYLLRRVFEVVAEARSSEAFVALCLLTVAGTSLLTQKLGFSDTLGAFLAGAILAETNFRTQIEADIRPFRGLLLGLFFVTTGSSIDIELLFREWPNVLALLAGLIIIKTLIISAIGPRVGLTLQESVRIGLLLSQGGEFAFVVFSLANRLGVLPLELNKLLIIVVVLSMALTPLLNEIGRWAADFIDDKFGSEDKVEEMVNYEGSEPVVIVGFGQMGQVLANLLSAPLASGSDGNTVGWPFVAFDLNPSVVKESRKLGFPILYGDASRPAVLLsagitspkaVMIMYTDKKRTIEAVQRLRLAFPAIPIYARAQDMMHLLDLKKAGATDAILENAETSLQLGSKLLKGFGVMSDDVTFLRQLVRNSMEIQAQEvlsqkddqefDIMKPLQVRVADIVEAektipstsnddklsrednTDTAGEDAKGVLYCELNGTNNFLDqtkgagemntvnpsmplitttees
MLESLACYHHSPKVYDIFGQTSSIRAYGHDSYGVLYLCKQKIHVQSHVENFKVYHRSFAFVNSFEGRKLLAPSISGWRCLSFSNNNRPQTRWEGFRTYAAAEVAGAVDVINDLGLDTLTFLAVTVIVVPVFKIARASPILGFFFAGIVLNQLGIIRNLTDVKVLSEWGILFLLFEMGLElslarlkalakfafGMGLTQVVLSTLAFTAFELPPNGAVGTRILEFLFHSRSDLVNIRSIDEAVVIGaalslsssafvlqllaEKGELPTRFGSATLGILLLQDIAvvpllvilpvlESQVSESVWPMLVKEslkalaglgllslggkyllRRVFEVVAEARSSEAFVALCLLTVAGTSLLTQKLGFSDTLGAFLAGAILAETNFRTQIEADIRPFRglllglffVTTGSSIDIELLFREWPNVlallagliiiktliisaiGPRVGLTLQESVRIGLLLSQGGEFAFVVFSLANRLGVLPLELNKLLIIVVVLSMALTPLLNEIGRWAADFIDDKFGSEDKVEEMVNYEGSEPVVIVGFGQMGQVLANLLSAPLASGSDGNTVGWPFVAFDLNPSVVKESRKLGFPILYGDASRPAVLLSAGITSPKAVMIMYTDKKRTIEAVQRLRLAFPAIPIYARAQDMMHLLDLKKAGATDAILENAETSLQLGSKLLKGFGVMSDDVTFLRQLVRNSMEIQAQEVLSQKDDQEFDIMKPLQVRVADIVEAEKTIPSTSNDDKLSREDNTDTAGEDAKGVLYCELNGTNNFLDQTKGAGEMNTVNPSMPLITTTEES
****LACYHHSPKVYDIFGQTSSIRAYGHDSYGVLYLCKQKIHVQSHVENFKVYHRSFAFVNSFEGRKLLAPSISGWRCLSFSNNNRPQTRWEGFRTYAAAEVAGAVDVINDLGLDTLTFLAVTVIVVPVFKIARASPILGFFFAGIVLNQLGIIRNLTDVKVLSEWGILFLLFEMGLELSLARLKALAKFAFGMGLTQVVLSTLAFTAFELPPNGAVGTRILEFLFHSRSDLVNIRSIDEAVVIGAALSLSSSAFVLQLLAEKGELPTRFGSATLGILLLQDIAVVPLLVILPVLESQVSESVWPMLVKESLKALAGLGLLSLGGKYLLRRVFEVVAEARSSEAFVALCLLTVAGTSLLTQKLGFSDTLGAFLAGAILAETNFRTQIEADIRPFRGLLLGLFFVTTGSSIDIELLFREWPNVLALLAGLIIIKTLIISAIGPRVGLTLQESVRIGLLLSQGGEFAFVVFSLANRLGVLPLELNKLLIIVVVLSMALTPLLNEIGRWAADFIDDKFGSEDKVEEMVNYEGSEPVVIVGFGQMGQVLANLLSAPLASGSDGNTVGWPFVAFDLNPSVVKESRKLGFPILYGDASRPAVLLSAGITSPKAVMIMYTDKKRTIEAVQRLRLAFPAIPIYARAQDMMHLLDLKKAGATDAILENAETSLQLGSKLLKGFGVMSDDVTFLRQLVRNSMEIQ************FDIMKPLQVRVADIV*****************************GVLYCELNGTNNFL*************************
*********HSP*VYDIFGQTSSIRAYGHDSYGVLYLCKQKIHVQSHVENFKVYHRSFAFVNSFEGRKLLAPSISGWRCLSF**********EG*************DVINDLGLDTLTFLAVTVIVVPVFKIARASPILGFFFAGIVLNQLGIIRNLTDVKVLSEWGILFLLFEMGLELSLARLKALAKFAFGMGLTQVVLSTLAFTAFELPPNGAVGTRILEFLFHSRSDLVNIRSIDEAVVIGAALSLSSSAFVLQLLA**********SATLGILLLQDIAVVPLLVILPVLESQVSESVWPMLVKESLKALAGLGLLSLGGKYLLRRVFEVVAEARSSEAFVALCLLTVAGTSLLTQKLGFSDTLGAFLAGAILAETNFRTQIEADIRPFRGLLLGLFFVTTGSSIDIELLFREWPNVLALLAGLIIIKTLIISAIGPRVGLTLQESVRIGLLLSQGGEFAFVVFSLANRLGVLPLELNKLLIIVVVLSMALTPLLNEIGRWAADFI********************PVVIVGFGQMGQVLANLLSAPLASGSDGNTVGWPFVAFDLNPSVVKESRKLGFPILYGDASRPAVLLSAGITSPKAVMIMYTDKKRTIEAVQRLRLAFPAIPIYARAQDMMHLLDLKKAGATDAILENAETSLQLGSKLLKGFGVMSDDVTFLRQLVRNSMEIQAQE********************************************************************************************
MLESLACYHHSPKVYDIFGQTSSIRAYGHDSYGVLYLCKQKIHVQSHVENFKVYHRSFAFVNSFEGRKLLAPSISGWRCLSFSNNNRPQTRWEGFRTYAAAEVAGAVDVINDLGLDTLTFLAVTVIVVPVFKIARASPILGFFFAGIVLNQLGIIRNLTDVKVLSEWGILFLLFEMGLELSLARLKALAKFAFGMGLTQVVLSTLAFTAFELPPNGAVGTRILEFLFHSRSDLVNIRSIDEAVVIGAALSLSSSAFVLQLLAEKGELPTRFGSATLGILLLQDIAVVPLLVILPVLESQVSESVWPMLVKESLKALAGLGLLSLGGKYLLRRVFEVVAEARSSEAFVALCLLTVAGTSLLTQKLGFSDTLGAFLAGAILAETNFRTQIEADIRPFRGLLLGLFFVTTGSSIDIELLFREWPNVLALLAGLIIIKTLIISAIGPRVGLTLQESVRIGLLLSQGGEFAFVVFSLANRLGVLPLELNKLLIIVVVLSMALTPLLNEIGRWAADFIDDKFGSEDKVEEMVNYEGSEPVVIVGFGQMGQVLANLLSAPLASGSDGNTVGWPFVAFDLNPSVVKESRKLGFPILYGDASRPAVLLSAGITSPKAVMIMYTDKKRTIEAVQRLRLAFPAIPIYARAQDMMHLLDLKKAGATDAILENAETSLQLGSKLLKGFGVMSDDVTFLRQLVRNSMEIQAQEVLSQKDDQEFDIMKPLQVRVADIVEAEKTIP****************AGEDAKGVLYCELNGTNNFLDQTKGAGEMNTVNPSMPLITTTEES
MLESLACYHHSPKVYDIFGQTSSIRAYGHDSYGVLYLCKQKIHVQSHVENFKVYHRSFAFVNSFEGRKLLAPSISGWRCLSFSNNNRPQTRWEGFRTYAAAEVAGAVDVINDLGLDTLTFLAVTVIVVPVFKIARASPILGFFFAGIVLNQLGIIRNLTDVKVLSEWGILFLLFEMGLELSLARLKALAKFAFGMGLTQVVLSTLAFTAFELPPNGAVGTRILEFLFHSRSDLVNIRSIDEAVVIGAALSLSSSAFVLQLLAEKGELPTRFGSATLGILLLQDIAVVPLLVILPVLESQVSESVWPMLVKESLKALAGLGLLSLGGKYLLRRVFEVVAEARSSEAFVALCLLTVAGTSLLTQKLGFSDTLGAFLAGAILAETNFRTQIEADIRPFRGLLLGLFFVTTGSSIDIELLFREWPNVLALLAGLIIIKTLIISAIGPRVGLTLQESVRIGLLLSQGGEFAFVVFSLANRLGVLPLELNKLLIIVVVLSMALTPLLNEIGRWAADFIDDKF********MVNYEGSEPVVIVGFGQMGQVLANLLSAPLASGSDGNTVGWPFVAFDLNPSVVKESRKLGFPILYGDASRPAVLLSAGITSPKAVMIMYTDKKRTIEAVQRLRLAFPAIPIYARAQDMMHLLDLKKAGATDAILENAETSLQLGSKLLKGFGVMSDDVTFLRQLVRNSMEIQAQEVLSQKDDQEFDIMKPLQVRVADIVEAE***********************DAKGVLYCELNGTNNFLDQTKGAGEMNTVNPSMPLIT*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLESLACYHHSPKVYDIFGQTSSIRAYGHDSYGVLYLCKQKIHVQSHVENFKVYHRSFAFVNSFEGRKLLAPSISGWRCLSFSNNNRPQTRWEGFRTYAAAEVAGAVDVINDLGLDTLTFLAVTVIVVPVFKIARASPILGFFFAGIVLNQLGIIRNLTDVKVLSEWGILFLLFEMGLELSLARLKALAKFAFGMGLTQVVLSTLAFTAFELPPNGAVGTRILEFLFHSRSDLVNIRSIDEAVVIGAALSLSSSAFVLQLLAEKGELPTRFGSATLGILLLQDIAVVPLLVILPVLESQVSESVWPMLVKESLKALAGLGLLSLGGKYLLRRVFEVVAEARSSEAFVALCLLTVAGTSLLTQKLGFSDTLGAFLAGAILAETNFRTQIEADIRPFRGLLLGLFFVTTGSSIDIELLFREWPNVLALLAGLIIIKTLIISAIGPRVGLTLQESVRIGLLLSQGGEFAFVVFSLANRLGVLPLELNKLLIIVVVLSMALTPLLNEIGRWAADFIDDKFGSEDKVEEMVNYEGSEPVVIVGFGQMGQVLANLLSAPLASGSDGNTVGWPFVAFDLNPSVVKESRKLGFPILYGDASRPAVLLSAGITSPKAVMIMYTDKKRTIEAVQRLRLAFPAIPIYARAQDMMHLLDLKKAGATDAILENAETSLQLGSKLLKGFGVMSDDVTFLRQLVRNSMEIQAQEVLSQKDDQEFDIMKPLQVRVADIVEAEKTIPSTSNDDKLSREDNTDTAGEDAKGVLYCELNGTNNFLDQTKGAGEMNTVNPSMPLITTTEES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query791 2.2.26 [Sep-21-2011]
Q9M0Z3776 K(+) efflux antiporter 3, yes no 0.917 0.935 0.711 0.0
O652721174 K(+) efflux antiporter 2, no no 0.638 0.430 0.393 5e-84
Q9ZTZ71193 K(+) efflux antiporter 1, no no 0.649 0.430 0.384 5e-84
A8AQP0601 Glutathione-regulated pot yes no 0.668 0.880 0.336 5e-71
B1JIU4602 Glutathione-regulated pot yes no 0.726 0.955 0.329 3e-69
Q664Q5602 Glutathione-regulated pot yes no 0.726 0.955 0.329 3e-69
A4TGX5602 Glutathione-regulated pot yes no 0.726 0.955 0.329 3e-69
Q1CCS7602 Glutathione-regulated pot yes no 0.726 0.955 0.329 3e-69
A9R473602 Glutathione-regulated pot yes no 0.726 0.955 0.329 3e-69
Q8ZJC4602 Glutathione-regulated pot yes no 0.726 0.955 0.329 3e-69
>sp|Q9M0Z3|KEA3_ARATH K(+) efflux antiporter 3, chloroplastic OS=Arabidopsis thaliana GN=KEA3 PE=1 SV=2 Back     alignment and function desciption
 Score =  993 bits (2566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/760 (71%), Positives = 614/760 (80%), Gaps = 34/760 (4%)

Query: 1   MLESLACYHHSPKVYDIFGQTSSIRAYGHDSYGVLYLCKQKIHVQSHVENFKVYHRSFAF 60
           ML S++C   SPK Y++  Q  S+R   H     ++  K  + V S   N  +   SF  
Sbjct: 6   MLGSISCCP-SPKGYEMVKQ-HSVR-LKH----CVFTVKSSVPVYSEGVNDGIKLHSFG- 57

Query: 61  VNSFEGRKLLAPSISGWRCLSFSNNNRPQTRWE---GFR--TYAAAEVAGAVDVINDLGL 115
             +   +K+          L  S     Q RW    G R  TYA  +VA AVDVINDLG 
Sbjct: 58  --NLVKKKVF---------LDTSKRFYFQGRWSESSGRRVETYAGVDVASAVDVINDLGF 106

Query: 116 DTLTFLAVTVIVVPVFKIARASPILGFFFAGIVLNQLGIIRNLTDVKVLSEWGILFLLFE 175
           DTLTFL VTVI+VP F+I +ASPILGFFFAG+VLNQ G+IRNLTDVKVLSEWGILFLLFE
Sbjct: 107 DTLTFLMVTVIIVPAFRILKASPILGFFFAGVVLNQFGLIRNLTDVKVLSEWGILFLLFE 166

Query: 176 MGLELSLARLKALAKFAFGMGLTQVVLSTLAFTAFELPPNGAVGTRILEFLFHSRSDLVN 235
           MGLELSLARLKALAKFAFGMGLTQV+L T AFTAFELPPNGA+GT+ILEFLFHSR DLVN
Sbjct: 167 MGLELSLARLKALAKFAFGMGLTQVLLCTAAFTAFELPPNGAIGTKILEFLFHSRPDLVN 226

Query: 236 IRSIDEAVVIGAALSLSSSAFVLQLLAEKGELPTRFGSATLGILLLQDIAVVPLLVILPV 295
           IRSIDEAVVIGAALSLSSSAFVLQLLAEKGELPTRFGSATLGILLLQDIAVVPLLVILPV
Sbjct: 227 IRSIDEAVVIGAALSLSSSAFVLQLLAEKGELPTRFGSATLGILLLQDIAVVPLLVILPV 286

Query: 296 LESQV--SESVWPMLVKESLKALAGLGLLSLGGKYLLRRVFEVVAEARSSEAFVALCLLT 353
           LESQ    ES+WPML KES KAL GLG+LSLGGK+ LRR+FEVVAE RSSEAFVALCLLT
Sbjct: 287 LESQDIGGESIWPMLAKESAKALGGLGILSLGGKFFLRRIFEVVAETRSSEAFVALCLLT 346

Query: 354 VAGTSLLTQKLGFSDTLGAFLAGAILAETNFRTQIEADIRPFRGLLLGLFFVTTGSSIDI 413
           VAGTSL+TQ LGFSDTLGAFLAGA+LAETNFRTQIEADIRPFRGLLLGLFFVTTG+SID+
Sbjct: 347 VAGTSLVTQWLGFSDTLGAFLAGALLAETNFRTQIEADIRPFRGLLLGLFFVTTGTSIDM 406

Query: 414 ELLFREWPNVLALLAGLIIIKTLIISAIGPRVGLTLQESVRIGLLLSQGGEFAFVVFSLA 473
           E+LFREWPNVL+LL GLI+IKTLII+AIGPRVGLT+QESVR+G LLSQGGEFAFVVFSLA
Sbjct: 407 EVLFREWPNVLSLLGGLIVIKTLIITAIGPRVGLTIQESVRVGFLLSQGGEFAFVVFSLA 466

Query: 474 NRLGVLPLELNKLLIIVVVLSMALTPLLNEIGRWAADFIDDKFGSEDKVEEMVNYEGSEP 533
           NRLGVLP ELNKLLIIVVVLSMALTP LN++GR AADF+D++    +K+ E VN++ SE 
Sbjct: 467 NRLGVLPNELNKLLIIVVVLSMALTPYLNQLGRKAADFLDERLDPGEKIGEDVNFDVSES 526

Query: 534 VVIVGFGQMGQVLANLLSAPLASGSDGNTVGWPFVAFDLNPSVVKESRKLGFPILYGDAS 593
           +VI+GFGQMGQVLAN LS PL S SD   VGWP++ FDLNP+VVKESRKLGFPILYGD S
Sbjct: 527 IVIIGFGQMGQVLANFLSTPLVSDSD--LVGWPYIGFDLNPAVVKESRKLGFPILYGDGS 584

Query: 594 RPAVLLSAGITSPKAVMIMYTDKKRTIEAVQRLRLAFPAIPIYARAQDMMHLLDLKKAGA 653
           RP+VL SAG++SPKA+MIMY  KKRT EAVQRLRLAFP  PIYARAQD+ HLL+LKKAGA
Sbjct: 585 RPSVLQSAGVSSPKAIMIMYKGKKRTTEAVQRLRLAFPGSPIYARAQDLPHLLELKKAGA 644

Query: 654 TDAILENAETSLQLGSKLLKGFGVMSDDVTFLRQLVRNSMEIQAQEVLSQKDDQEFDIMK 713
           TDAILENAETSLQLGSKLL GFGVMSDDV+FL ++ R+SMEIQAQE ++  +      +K
Sbjct: 645 TDAILENAETSLQLGSKLLTGFGVMSDDVSFLSKVFRDSMEIQAQEEITASETNAG--LK 702

Query: 714 PLQVRVADI----VEAEKTIPSTSNDDKLSREDNTDTAGE 749
           P+Q++ +DI       +K +         + + N+D+A E
Sbjct: 703 PMQMKASDINVVSAATQKQVQLMKPMQMKASDSNSDSAAE 742
May operate as a K(+)/H(+) antiporter.
Arabidopsis thaliana (taxid: 3702)
>sp|O65272|KEA2_ARATH K(+) efflux antiporter 2, chloroplastic OS=Arabidopsis thaliana GN=KEA2 PE=1 SV=2 Back     alignment and function description
>sp|Q9ZTZ7|KEA1_ARATH K(+) efflux antiporter 1, chloroplastic OS=Arabidopsis thaliana GN=KEA1 PE=1 SV=2 Back     alignment and function description
>sp|A8AQP0|KEFB_CITK8 Glutathione-regulated potassium-efflux system protein KefB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=kefB PE=3 SV=1 Back     alignment and function description
>sp|B1JIU4|KEFB_YERPY Glutathione-regulated potassium-efflux system protein KefB OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=kefB PE=3 SV=1 Back     alignment and function description
>sp|Q664Q5|KEFB_YERPS Glutathione-regulated potassium-efflux system protein KefB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=kefB PE=3 SV=1 Back     alignment and function description
>sp|A4TGX5|KEFB_YERPP Glutathione-regulated potassium-efflux system protein KefB OS=Yersinia pestis (strain Pestoides F) GN=kefB PE=3 SV=1 Back     alignment and function description
>sp|Q1CCS7|KEFB_YERPN Glutathione-regulated potassium-efflux system protein KefB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=kefB PE=3 SV=1 Back     alignment and function description
>sp|A9R473|KEFB_YERPG Glutathione-regulated potassium-efflux system protein KefB OS=Yersinia pestis bv. Antiqua (strain Angola) GN=kefB PE=3 SV=1 Back     alignment and function description
>sp|Q8ZJC4|KEFB_YERPE Glutathione-regulated potassium-efflux system protein KefB OS=Yersinia pestis GN=kefB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query791
255554533760 Glutathione-regulated potassium-efflux s 0.926 0.964 0.766 0.0
449511271879 PREDICTED: K(+) efflux antiporter 3, chl 0.978 0.880 0.703 0.0
449438594869 PREDICTED: K(+) efflux antiporter 3, chl 0.962 0.875 0.709 0.0
307136449788 glutathione-regulated potassium-efflux s 0.954 0.958 0.706 0.0
356521253807 PREDICTED: K(+) efflux antiporter 3, chl 0.982 0.962 0.702 0.0
356524770806 PREDICTED: K(+) efflux antiporter 3, chl 0.927 0.910 0.740 0.0
297809661756 predicted protein [Arabidopsis lyrata su 0.830 0.869 0.779 0.0
334186362776 K+ efflux antiporter 3 [Arabidopsis thal 0.917 0.935 0.711 0.0
115489604791 Os12g0617800 [Oryza sativa Japonica Grou 0.849 0.849 0.731 0.0
7267243756 putative potassium transporter [Arabidop 0.830 0.869 0.773 0.0
>gi|255554533|ref|XP_002518305.1| Glutathione-regulated potassium-efflux system protein kefB, putative [Ricinus communis] gi|223542525|gb|EEF44065.1| Glutathione-regulated potassium-efflux system protein kefB, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1091 bits (2822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/758 (76%), Positives = 640/758 (84%), Gaps = 25/758 (3%)

Query: 42  IHVQSHVENFKVYHRSFAFVNSFEGRKLLAPSISGWRCLSFSNNNRPQTRWEGFRTYAAA 101
           +HV S   +  + H SF     FEGR LL+ S+ G    S S +     +    R +A+ 
Sbjct: 1   MHVPSRALSCGIIHCSFLSGKIFEGRPLLSSSVLGGEGFSLSKHRLRHLKRS--RIHASV 58

Query: 102 EVAGAVDVINDLGLDTLTFLAVTVIVVPVFKIARASPILGFFFAGIVLNQLGIIRNLTDV 161
           +VA AVD INDLG+DTLTFLAVTV+VVPVFKI RASPILGFFFAG+VLNQ G+IRNLTDV
Sbjct: 59  DVASAVDAINDLGMDTLTFLAVTVVVVPVFKILRASPILGFFFAGVVLNQFGLIRNLTDV 118

Query: 162 KVLSEWGILFLLFEMGLELSLARLKALAKFAFGMGLTQVVLSTLAFTAFELPPNGAVGTR 221
           KVLSEWGILFLLFEMGLELSLARLKALAKFAFGMGLTQV+LSTLAFTAFELPPNGA+GTR
Sbjct: 119 KVLSEWGILFLLFEMGLELSLARLKALAKFAFGMGLTQVILSTLAFTAFELPPNGAIGTR 178

Query: 222 ILEFLFHSRSDLVNIRSIDEAVVIGAALSLSSSAFVLQLLAEKGELPTRFGSATLGILLL 281
           ILEFLFHSRSDLVNIRSIDEAVVIGAALSLSSSAFVLQLLAEKGELPTRFGSATLGILLL
Sbjct: 179 ILEFLFHSRSDLVNIRSIDEAVVIGAALSLSSSAFVLQLLAEKGELPTRFGSATLGILLL 238

Query: 282 QDIAVVPLLVILPVLESQ--VSESVWPMLVKESLKALAGLGLLSLGGKYLLRRVFEVVAE 339
           QDIAVVPLLVILPVLESQ  + ES+WPML KESLKAL GLGLLSLGGKY+LRRVFEVVAE
Sbjct: 239 QDIAVVPLLVILPVLESQNLIEESIWPMLAKESLKALGGLGLLSLGGKYILRRVFEVVAE 298

Query: 340 ARSSEAFVALCLLTVAGTSLLTQKLGFSDTLGAFLAGAILAETNFRTQIEADIRPFRGLL 399
            RSSEAF+ALCLLTV GTSL TQ LGFSDTLGAFLAGA+LAETNFRTQIEADIRPFRGLL
Sbjct: 299 TRSSEAFIALCLLTVTGTSLSTQMLGFSDTLGAFLAGALLAETNFRTQIEADIRPFRGLL 358

Query: 400 LGLFFVTTGSSIDIELLFREWPNVLALLAGLIIIKTLIISAIGPRVGLTLQESVRIGLLL 459
           LGLFFVTTG+SID++LLFREWPNVL+LLAGLI+IKTLIISAIGPRVGLT++ESVRIG LL
Sbjct: 359 LGLFFVTTGTSIDMQLLFREWPNVLSLLAGLIVIKTLIISAIGPRVGLTIRESVRIGFLL 418

Query: 460 SQGGEFAFVVFSLANRLGVLPLELNKLLIIVVVLSMALTPLLNEIGRWAADFIDDKFGSE 519
           SQGGEFAFVVFSLANRLGVLPLELNKLLIIVVVLSMALTPLLNE+GR AADFIDDKF  E
Sbjct: 419 SQGGEFAFVVFSLANRLGVLPLELNKLLIIVVVLSMALTPLLNEVGRRAADFIDDKFDKE 478

Query: 520 DKVEEMVNYEGSEPVVIVGFGQMGQVLANLLSAPLASGSDGNTVGWPFVAFDLNPSVVKE 579
           DK  E+VN++GSEPV+I+GFGQMGQVLAN LSAPLASG D +  GWP+VAFDLNPSVVK 
Sbjct: 479 DKAAELVNFDGSEPVIILGFGQMGQVLANFLSAPLASGIDADLAGWPYVAFDLNPSVVKA 538

Query: 580 SRKLGFPILYGDASRPAVLLSAGITSPKAVMIMYTDKKRTIEAVQRLRLAFPAIPIYARA 639
           SR+LGFP+LYGD SRPAVL +AGI+SPKA MIM+T KKRTIEAVQRLRLAFP IPIYARA
Sbjct: 539 SRRLGFPVLYGDGSRPAVLQTAGISSPKAFMIMHTGKKRTIEAVQRLRLAFPGIPIYARA 598

Query: 640 QDMMHLLDLKKAGATDAILENAETSLQLGSKLLKGFGVMSDDVTFLRQLVRNSMEIQAQE 699
           QD++HLLDLKKAGATDAILENAETSLQLGS+LLKG GVMSDDV F+ QLVR+SME+QAQ+
Sbjct: 599 QDLVHLLDLKKAGATDAILENAETSLQLGSRLLKGLGVMSDDVDFVSQLVRDSMELQAQD 658

Query: 700 VLSQKDDQEFDIMKPLQVRVADIVEAEKTIPSTSNDDKLSREDNTD-------------- 745
            LS+ DD+  ++MKPLQVRV D V  +   P +S  DKLSR +  D              
Sbjct: 659 ALSKTDDRGLNVMKPLQVRVVDSVATQVPPPPSSPQDKLSRREQMDDRTHILRSREETSH 718

Query: 746 -------TAGEDAKGVLYCELNGTNNFLDQTKGAGEMN 776
                   + +  KGV+YCELN  N FL +   A   N
Sbjct: 719 MDDSGLQQSDDHDKGVIYCELNTENGFLGKADDATPEN 756

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449511271|ref|XP_004163911.1| PREDICTED: K(+) efflux antiporter 3, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449438594|ref|XP_004137073.1| PREDICTED: K(+) efflux antiporter 3, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|307136449|gb|ADN34254.1| glutathione-regulated potassium-efflux system protein kefb [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|356521253|ref|XP_003529271.1| PREDICTED: K(+) efflux antiporter 3, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|356524770|ref|XP_003531001.1| PREDICTED: K(+) efflux antiporter 3, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|297809661|ref|XP_002872714.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297318551|gb|EFH48973.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|334186362|ref|NP_001190675.1| K+ efflux antiporter 3 [Arabidopsis thaliana] gi|298351841|sp|Q9M0Z3.2|KEA3_ARATH RecName: Full=K(+) efflux antiporter 3, chloroplastic; Short=AtKEA3 gi|332657033|gb|AEE82433.1| K+ efflux antiporter 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|115489604|ref|NP_001067289.1| Os12g0617800 [Oryza sativa Japonica Group] gi|108862969|gb|ABA99872.2| Potassium transporter, putative, expressed [Oryza sativa Japonica Group] gi|113649796|dbj|BAF30308.1| Os12g0617800 [Oryza sativa Japonica Group] gi|215697125|dbj|BAG91119.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|7267243|emb|CAB80850.1| putative potassium transporter [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query791
TAIR|locus:21982151193 KEA1 "K+ efflux antiporter 1" 0.663 0.440 0.325 5.8e-60
TIGR_CMR|ECH_0146568 ECH_0146 "putative glutathione 0.554 0.772 0.271 2.7e-57
TIGR_CMR|APH_1305571 APH_1305 "glutathione-regulate 0.573 0.795 0.279 1.1e-56
TIGR_CMR|SO_1481589 SO_1481 "glutathione-regulated 0.417 0.560 0.317 2.4e-52
TIGR_CMR|CPS_1593655 CPS_1593 "putative glutathione 0.562 0.679 0.286 8e-51
TIGR_CMR|CPS_3340610 CPS_3340 "glutathione-regulate 0.724 0.939 0.275 1.5e-49
TIGR_CMR|SO_1647648 SO_1647 "glutathione-regulated 0.536 0.654 0.299 2.2e-45
UNIPROTKB|Q9KNX4656 VC_2606 "Glutathione-regulated 0.479 0.577 0.291 1.6e-44
TIGR_CMR|VC_2606656 VC_2606 "glutathione-regulated 0.479 0.577 0.291 1.6e-44
TIGR_CMR|SPO_1424626 SPO_1424 "glutathione-regulate 0.443 0.560 0.276 3.9e-43
TAIR|locus:2198215 KEA1 "K+ efflux antiporter 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 624 (224.7 bits), Expect = 5.8e-60, P = 5.8e-60
 Identities = 185/568 (32%), Positives = 269/568 (47%)

Query:   116 DTLTFLAVTVIVVPVF-KIARASPILGFFFAGIVLNQLG--IIRNLTDVKVLSEWGILFL 172
             D L  L  +VI VP+F KI   SP+LG+  AGI++   G  IIRN+   + ++E+G++FL
Sbjct:   591 DFLWLLLASVIFVPLFQKIPGGSPVLGYLAAGILIGPYGLSIIRNVHGTRAIAEFGVVFL 650

Query:   173 LFEMGLEXXXXXXXXXXXXXXGMGLTQVVLSTLAFTAFELPPNGAVGTRILEFLFHSRSD 232
             LF +GLE              G+G  QV++     TA        VG      L H    
Sbjct:   651 LFNIGLELSVERLSSMKKYVFGLGSAQVLV-----TA------AVVG-----LLAH---- 690

Query:   233 LVNIRSIDEAVVIGXXXXXXXXXXXXXXXXEKGELPTRFGSATLGILLLQDIAXXXXXXX 292
              V  ++   A+VIG                E+GE  +R G A+  +LL QD+A       
Sbjct:   691 YVAGQAGPAAIVIGNGLALSSTAVVLQVLQERGESTSRHGRASFSVLLFQDLAVVVLLIL 750

Query:   293 XXXXESQVSES-VWPMLVKEXXXXXXXXXXXXXXXXXXXRR-----VFEVVAEARSSEAF 346
                     S+  +    + E                    R     +++ +AE R++E F
Sbjct:   751 IPLISPNSSKGGIGFQAIAEALGLAAVKAAVAITAIIAGGRLLLRPIYKQIAENRNAEIF 810

Query:   347 VALCLLTVAGTSLLTQKLGFSDTLGAFLAGAILAETNFRTQIEADIRPFRXXXXXXXXVT 406
              A  LL + GTSLLT + G S  LGAFLAG +LAET F  Q+E+DI P+R        +T
Sbjct:   811 SANTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMT 870

Query:   407 TGSSIDIELLFREWPNVXXXXXXXXXXXXXXXXXXGPRVGLTLQESVRIGLLLSQGGEFA 466
              G SID +LL   +P +                  G   G+++  ++R+GLLL+ GGEFA
Sbjct:   871 VGMSIDPKLLLSNFPVIVGTLGLLIVGKTMLVVIMGKLFGISIISAIRVGLLLAPGGEFA 930

Query:   467 FVVFSLANRLGVLPLELNKLLIIVVVLSMALTPLLNEIGRWAADFID-DKFGSEDKVE-E 524
             FV F  A   G++  +L+ LL +VV +SMA+TP L   G+  A   +     S   VE E
Sbjct:   931 FVAFGEAVNQGIMSPQLSSLLFLVVGISMAITPWLAAGGQLIASRFELHDVRSLLPVESE 990

Query:   525 MVNYEGSEPVVIVGFGQMGQVLANLLSAPLASGSDGNTVGWPFVAFDLNPSVVKESRKLG 584
               + +G   ++I GFG++GQ++A LLS  L           PFVA D++   V   R L 
Sbjct:   991 TDDLQGH--IIICGFGRVGQIIAQLLSERLI----------PFVALDVSSDRVTIGRSLD 1038

Query:   585 FPILYGDASRPAVLLSAGITSPKAVMIMYTDKKRTIEAVQRLRLAFPAIPIYARAQDMMH 644
              P+ +GDA    VL   G     A ++           V  L   +P +  + RA D++H
Sbjct:  1039 LPVYFGDAGSKEVLHKIGAGRACAAVVALDAPGANYRCVWALSKFYPNVKTFVRAHDVVH 1098

Query:   645 LLDLKKAGATDAILENAETSLQLGSKLL 672
              L+L+KAGAT  + E  E SLQL + +L
Sbjct:  1099 GLNLEKAGATAVVPETLEPSLQLAAAVL 1126
GO:0000166 "nucleotide binding" evidence=IEA
GO:0006812 "cation transport" evidence=IEA
GO:0006813 "potassium ion transport" evidence=IEA
GO:0008324 "cation transmembrane transporter activity" evidence=IEA
GO:0015079 "potassium ion transmembrane transporter activity" evidence=ISS
GO:0015299 "solute:hydrogen antiporter activity" evidence=IEA
GO:0015386 "potassium:hydrogen antiporter activity" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
TIGR_CMR|ECH_0146 ECH_0146 "putative glutathione-regulated potassium-efflux system protein KefB" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
TIGR_CMR|APH_1305 APH_1305 "glutathione-regulated potassium-efflux system protein" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1481 SO_1481 "glutathione-regulated potassium-efflux system protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_1593 CPS_1593 "putative glutathione-regulated potassium-efflux system protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3340 CPS_3340 "glutathione-regulated potassium-efflux system protein KefC" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1647 SO_1647 "glutathione-regulated potassium-efflux system protein KefB, putative" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KNX4 VC_2606 "Glutathione-regulated potassium-efflux system protein KefB" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2606 VC_2606 "glutathione-regulated potassium-efflux system protein KefB" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1424 SPO_1424 "glutathione-regulated potassium-efflux system protein KefC" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M0Z3KEA3_ARATHNo assigned EC number0.71180.91780.9355yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query791
PRK03562621 PRK03562, PRK03562, glutathione-regulated potassiu 1e-108
PRK03659601 PRK03659, PRK03659, glutathione-regulated potassiu 4e-99
COG0475397 COG0475, KefB, Kef-type K+ transport systems, memb 7e-67
pfam00999370 pfam00999, Na_H_Exchanger, Sodium/hydrogen exchang 4e-59
TIGR00932273 TIGR00932, 2a37, transporter, monovalent cation:pr 2e-54
COG4651408 COG4651, RosB, Kef-type K+ transport system, predi 7e-34
PRK10669558 PRK10669, PRK10669, putative cation:proton antipor 4e-27
pfam02254116 pfam02254, TrkA_N, TrkA-N domain 2e-20
COG1226212 COG1226, Kch, Kef-type K+ transport systems, predi 2e-15
PLN03159 832 PLN03159, PLN03159, cation/H(+) antiporter 15; Pro 5e-11
COG0569225 COG0569, TrkA, K+ transport systems, NAD-binding c 5e-07
COG0025429 COG0025, NhaP, NhaP-type Na+/H+ and K+/H+ antiport 2e-05
>gnl|CDD|235131 PRK03562, PRK03562, glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information 
 Score =  342 bits (880), Expect = e-108
 Identities = 185/565 (32%), Positives = 290/565 (51%), Gaps = 46/565 (8%)

Query: 118 LTFLAVTVIVVPVFKIARA---SPILGFFFAGIVLNQ--LGIIRNLTDVKVLSEWGILFL 172
           L +L   V++VP   IA       +LG+  AG ++    L ++ ++  +   +E+G++ +
Sbjct: 11  LIYLGAAVLIVP---IAVRLGLGSVLGYLIAGCIIGPWGLRLVTDVESILHFAEFGVVLM 67

Query: 173 LFEMGLELSLARLKALAKFAFGMGLTQVVLSTLAFTAFELPPNGAVGTRILEFLFHSRSD 232
           LF +GLEL   RL  L +  FG G  Q+V        F +     +G             
Sbjct: 68  LFVIGLELDPQRLWKLRRSIFGGGALQMVACGGLLGLFCM----LLG------------- 110

Query: 233 LVNIRSIDEAVVIGAALSLSSSAFVLQLLAEKGELPTRFGSATLGILLLQDIAVVPLLVI 292
            +  +    A++IG  L+LSS+A  +Q + E+  + T+ G +   ILL QDIA +PL+ +
Sbjct: 111 -LRWQV---ALLIGLGLALSSTAIAMQAMNERNLMVTQMGRSAFAILLFQDIAAIPLVAM 166

Query: 293 LPVLESQVSESVWPMLVKESLKALAGLGLLSLGGKYLLRRVFEVVAEARSSEAFVALCLL 352
           +P+L +  + +        +LK    L L+ LGG+Y+ R     VA +   E F A+ L 
Sbjct: 167 IPLLAASGASTTLGAFALSALKVAGALALVVLGGRYVTRPALRFVARSGLREVFTAVALF 226

Query: 353 TVAGTSLLTQKLGFSDTLGAFLAGAILAETNFRTQIEADIRPFRGLLLGLFFVTTGSSID 412
            V G  LL +++G S  LGAFLAG +LA + +R  +E+DI PF+GLLLGLFF+  G SID
Sbjct: 227 LVFGFGLLMEEVGLSMALGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIAVGMSID 286

Query: 413 IELLFREWPNVLALLAGLIIIKTLIISAIGPRVGLTLQESVRIGLLLSQGGEFAFVVFSL 472
              L      +L LL G + IK  ++  +   +G+  ++     +LL QGGEFAFVVF  
Sbjct: 287 FGTLLENPLRILILLLGFLAIKIAMLWLLARPLGVPRKQRRWFAVLLGQGGEFAFVVFGA 346

Query: 473 ANRLGVLPLELNKLLIIVVVLSMALTP-LLNEIGRWAADFIDDKFGSEDKVEEMVNYEGS 531
           A    VL  E  KLL + V LSMA TP LL  + R        +     + +E+   E  
Sbjct: 347 AQMANVLEPEWAKLLTLAVALSMAATPLLLVLLDRLEQ----SRTEEAREADEID--EQQ 400

Query: 532 EPVVIVGFGQMGQVLANLLSAPLASGSDGNTVGWPFVAFDLNPSVVKESRKLGFPILYGD 591
             V+I GFG+ GQ++  LL   L+S       G      D +P  ++  RK G  + YGD
Sbjct: 401 PRVIIAGFGRFGQIVGRLL---LSS-------GVKMTVLDHDPDHIETLRKFGMKVFYGD 450

Query: 592 ASRPAVLLSAGITSPKAVMIMYTDKKRTIEAVQRLRLAFPAIPIYARAQDMMHLLDLKKA 651
           A+R  +L SAG    + ++    D + +++ V+ ++  FP + I ARA+D+ H + L++A
Sbjct: 451 ATRMDLLESAGAAKAEVLINAIDDPQTSLQLVELVKEHFPHLQIIARARDVDHYIRLRQA 510

Query: 652 GATDAILENAETSLQLGSKLLKGFG 676
           G      E  E +L+ G  +L+  G
Sbjct: 511 GVEKPERETFEGALKSGRLVLESLG 535

Length = 621
>gnl|CDD|179625 PRK03659, PRK03659, glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>gnl|CDD|223551 COG0475, KefB, Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|216235 pfam00999, Na_H_Exchanger, Sodium/hydrogen exchanger family Back     alignment and domain information
>gnl|CDD|233195 TIGR00932, 2a37, transporter, monovalent cation:proton antiporter-2 (CPA2) family Back     alignment and domain information
>gnl|CDD|226998 COG4651, RosB, Kef-type K+ transport system, predicted NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182633 PRK10669, PRK10669, putative cation:proton antiport protein; Provisional Back     alignment and domain information
>gnl|CDD|216949 pfam02254, TrkA_N, TrkA-N domain Back     alignment and domain information
>gnl|CDD|224147 COG1226, Kch, Kef-type K+ transport systems, predicted NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|215608 PLN03159, PLN03159, cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>gnl|CDD|223643 COG0569, TrkA, K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223104 COG0025, NhaP, NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 791
PRK03562621 glutathione-regulated potassium-efflux system prot 100.0
PRK03659601 glutathione-regulated potassium-efflux system prot 100.0
PRK10669558 putative cation:proton antiport protein; Provision 100.0
COG0475397 KefB Kef-type K+ transport systems, membrane compo 100.0
PLN03159 832 cation/H(+) antiporter 15; Provisional 100.0
COG4651408 RosB Kef-type K+ transport system, predicted NAD-b 100.0
PRK05326562 potassium/proton antiporter; Reviewed 100.0
TIGR00932273 2a37 transporter, monovalent cation:proton antipor 100.0
PF00999380 Na_H_Exchanger: Sodium/hydrogen exchanger family; 100.0
COG3263574 NhaP-type Na+/H+ and K+/H+ antiporters with a uniq 100.0
TIGR00844 810 c_cpa1 na(+)/h(+) antiporter. This model is specif 100.0
KOG1650769 consensus Predicted K+/H+-antiporter [Inorganic io 99.97
TIGR00831525 a_cpa1 Na+/H+ antiporter, bacterial form. This mod 99.96
COG0025429 NhaP NhaP-type Na+/H+ and K+/H+ antiporters [Inorg 99.96
TIGR00840559 b_cpa1 sodium/hydrogen exchanger 3. This model is 99.93
COG0569225 TrkA K+ transport systems, NAD-binding component [ 99.92
PRK10537393 voltage-gated potassium channel; Provisional 99.91
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 99.87
PRK09496453 trkA potassium transporter peripheral membrane com 99.83
PRK09496 453 trkA potassium transporter peripheral membrane com 99.77
KOG1965575 consensus Sodium/hydrogen exchanger protein [Inorg 99.74
KOG4505467 consensus Na+/H+ antiporter [Inorganic ion transpo 99.71
PRK14853423 nhaA pH-dependent sodium/proton antiporter; Provis 99.62
COG1226212 Kch Kef-type K+ transport systems, predicted NAD-b 99.54
TIGR00773373 NhaA Na+/H+ antiporter NhaA. These proteins are me 99.23
PRK14856438 nhaA pH-dependent sodium/proton antiporter; Provis 99.02
KOG1966670 consensus Sodium/hydrogen exchanger protein [Inorg 98.9
PRK14854383 nhaA pH-dependent sodium/proton antiporter; Provis 98.82
PRK09561388 nhaA pH-dependent sodium/proton antiporter; Review 98.8
PRK09560389 nhaA pH-dependent sodium/proton antiporter; Review 98.76
PRK14855423 nhaA pH-dependent sodium/proton antiporter; Provis 98.63
COG3004390 NhaA Na+/H+ antiporter [Inorganic ion transport an 98.52
PF06965378 Na_H_antiport_1: Na+/H+ antiporter 1; InterPro: IP 98.45
PF05684378 DUF819: Protein of unknown function (DUF819); Inte 98.14
PRK06719157 precorrin-2 dehydrogenase; Validated 98.07
PRK04148134 hypothetical protein; Provisional 97.88
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 97.79
PRK12460312 2-keto-3-deoxygluconate permease; Provisional 97.77
PF03812314 KdgT: 2-keto-3-deoxygluconate permease; InterPro: 97.58
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.58
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.51
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 97.29
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 97.26
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 97.23
TIGR00698335 conserved hypothetical integral membrane protein. 97.19
PF03601305 Cons_hypoth698: Conserved hypothetical protein 698 97.04
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.03
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 96.95
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 96.91
COG3400 471 Uncharacterized protein conserved in bacteria [Fun 96.86
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 96.79
TIGR00793314 kdgT 2-keto-3-deoxygluconate transporter. This fam 96.75
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 96.75
PF06241206 DUF1012: Protein of unknown function (DUF1012); In 96.73
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 96.72
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 96.71
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 96.7
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.63
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.58
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.55
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 96.51
CHL00194317 ycf39 Ycf39; Provisional 96.5
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.5
PRK05562223 precorrin-2 dehydrogenase; Provisional 96.48
PRK03562621 glutathione-regulated potassium-efflux system prot 96.43
PRK03659601 glutathione-regulated potassium-efflux system prot 96.43
PF03601305 Cons_hypoth698: Conserved hypothetical protein 698 96.42
TIGR00932273 2a37 transporter, monovalent cation:proton antipor 96.4
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 96.4
PLN02494477 adenosylhomocysteinase 96.4
COG0786404 GltS Na+/glutamate symporter [Amino acid transport 96.38
PTZ00075476 Adenosylhomocysteinase; Provisional 96.36
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 96.32
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 96.31
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 96.26
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.22
PRK12921305 2-dehydropantoate 2-reductase; Provisional 96.22
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.16
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.15
PLN02688266 pyrroline-5-carboxylate reductase 96.1
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 96.09
PRK05225 487 ketol-acid reductoisomerase; Validated 96.09
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 96.04
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 96.03
PRK07417279 arogenate dehydrogenase; Reviewed 96.01
PRK10669 558 putative cation:proton antiport protein; Provision 96.01
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 96.0
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 95.93
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 95.92
PRK03818552 putative transporter; Validated 95.9
PF03956191 DUF340: Membrane protein of unknown function (DUF3 95.9
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 95.84
PRK15059292 tartronate semialdehyde reductase; Provisional 95.82
TIGR00698335 conserved hypothetical integral membrane protein. 95.81
TIGR00210398 gltS sodium--glutamate symport carrier (gltS). 95.8
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 95.79
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 95.78
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 95.76
COG2855334 Predicted membrane protein [Function unknown] 95.71
PRK05708305 2-dehydropantoate 2-reductase; Provisional 95.71
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.69
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 95.69
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 95.69
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 95.68
COG2855334 Predicted membrane protein [Function unknown] 95.68
COG0475397 KefB Kef-type K+ transport systems, membrane compo 95.54
PRK08229341 2-dehydropantoate 2-reductase; Provisional 95.53
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 95.52
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 95.5
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 95.49
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 95.43
PRK05993277 short chain dehydrogenase; Provisional 95.42
COG0385319 Predicted Na+-dependent transporter [General funct 95.42
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 95.38
PRK13302271 putative L-aspartate dehydrogenase; Provisional 95.38
PRK08017256 oxidoreductase; Provisional 95.38
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 95.33
PLN02256304 arogenate dehydrogenase 95.32
PRK13403335 ketol-acid reductoisomerase; Provisional 95.31
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.29
PLN03209 576 translocon at the inner envelope of chloroplast su 95.24
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 95.24
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 95.2
PRK07502307 cyclohexadienyl dehydrogenase; Validated 95.18
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.11
PRK05326 562 potassium/proton antiporter; Reviewed 95.05
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.04
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 95.02
TIGR03802 562 Asp_Ala_antiprt aspartate-alanine antiporter. All 95.0
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 95.0
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 95.0
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 95.0
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 94.99
PRK00048257 dihydrodipicolinate reductase; Provisional 94.98
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.98
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 94.98
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 94.94
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 94.94
PRK03818552 putative transporter; Validated 94.89
PRK04972558 putative transporter; Provisional 94.81
PRK08507275 prephenate dehydrogenase; Validated 94.8
PRK06182273 short chain dehydrogenase; Validated 94.75
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.75
PRK06545 359 prephenate dehydrogenase; Validated 94.74
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 94.73
cd01483143 E1_enzyme_family Superfamily of activating enzymes 94.69
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 94.67
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 94.64
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 94.63
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 94.59
PF03616368 Glt_symporter: Sodium/glutamate symporter; InterPr 94.56
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 94.56
TIGR00831525 a_cpa1 Na+/H+ antiporter, bacterial form. This mod 94.55
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 94.54
PRK10637 457 cysG siroheme synthase; Provisional 94.52
PLN03159 832 cation/H(+) antiporter 15; Provisional 94.51
PRK06249313 2-dehydropantoate 2-reductase; Provisional 94.48
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.47
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.41
PF01758187 SBF: Sodium Bile acid symporter family; InterPro: 94.39
PRK06953222 short chain dehydrogenase; Provisional 94.32
PLN02712667 arogenate dehydrogenase 94.31
TIGR00210398 gltS sodium--glutamate symport carrier (gltS). 94.31
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.28
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 94.21
TIGR00844 810 c_cpa1 na(+)/h(+) antiporter. This model is specif 94.14
TIGR03802562 Asp_Ala_antiprt aspartate-alanine antiporter. All 94.13
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 94.12
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 94.11
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 94.09
PRK09291257 short chain dehydrogenase; Provisional 94.05
PRK05274326 2-keto-3-deoxygluconate permease; Provisional 94.02
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 93.99
PRK05693274 short chain dehydrogenase; Provisional 93.97
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.89
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.86
PRK08655 437 prephenate dehydrogenase; Provisional 93.86
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.84
PRK07680273 late competence protein ComER; Validated 93.77
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.65
PRK08219227 short chain dehydrogenase; Provisional 93.63
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.59
TIGR03025445 EPS_sugtrans exopolysaccharide biosynthesis polypr 93.54
PLN00106323 malate dehydrogenase 93.52
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 93.48
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 93.46
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 93.46
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 93.46
PRK08264238 short chain dehydrogenase; Validated 93.44
PRK07060245 short chain dehydrogenase; Provisional 93.44
TIGR03082156 Gneg_AbrB_dup membrane protein AbrB duplication. T 93.43
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 93.41
PRK05884223 short chain dehydrogenase; Provisional 93.41
PRK07326237 short chain dehydrogenase; Provisional 93.41
PLN02427 386 UDP-apiose/xylose synthase 93.41
PLN02712 667 arogenate dehydrogenase 93.37
PRK15116268 sulfur acceptor protein CsdL; Provisional 93.36
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 93.33
PRK05479330 ketol-acid reductoisomerase; Provisional 93.33
TIGR00036266 dapB dihydrodipicolinate reductase. 93.27
PLN02896353 cinnamyl-alcohol dehydrogenase 93.27
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 93.26
PLN02858 1378 fructose-bisphosphate aldolase 93.24
PRK06482276 short chain dehydrogenase; Provisional 93.23
KOG1370434 consensus S-adenosylhomocysteine hydrolase [Coenzy 93.21
PLN02858 1378 fructose-bisphosphate aldolase 93.17
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 93.17
PF13593313 DUF4137: SBF-like CPA transporter family (DUF4137) 93.15
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 93.15
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 93.04
KOG1420 1103 consensus Ca2+-activated K+ channel Slowpoke, alph 93.03
PRK06101240 short chain dehydrogenase; Provisional 93.02
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 92.98
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 92.98
PRK13304265 L-aspartate dehydrogenase; Reviewed 92.94
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 92.94
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 92.88
PRK06914280 short chain dehydrogenase; Provisional 92.81
PRK07024257 short chain dehydrogenase; Provisional 92.78
COG2910211 Putative NADH-flavin reductase [General function p 92.77
PRK07454241 short chain dehydrogenase; Provisional 92.74
PRK13243333 glyoxylate reductase; Reviewed 92.73
PLN02353 473 probable UDP-glucose 6-dehydrogenase 92.71
PRK09414445 glutamate dehydrogenase; Provisional 92.69
PF03616368 Glt_symporter: Sodium/glutamate symporter; InterPr 92.68
PLN00016378 RNA-binding protein; Provisional 92.67
TIGR00832328 acr3 arsenical-resistance protein. The first prote 92.67
PRK06019 372 phosphoribosylaminoimidazole carboxylase ATPase su 92.56
PLN02695370 GDP-D-mannose-3',5'-epimerase 92.54
PLN02650351 dihydroflavonol-4-reductase 92.53
PLN03139386 formate dehydrogenase; Provisional 92.52
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.48
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 92.47
PRK02318 381 mannitol-1-phosphate 5-dehydrogenase; Provisional 92.36
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 92.34
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 92.33
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 92.29
PRK01581374 speE spermidine synthase; Validated 92.25
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.13
PRK08265261 short chain dehydrogenase; Provisional 92.13
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 92.12
PTZ00117319 malate dehydrogenase; Provisional 92.11
PRK09072263 short chain dehydrogenase; Provisional 92.11
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 92.1
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 92.07
TIGR00841286 bass bile acid transporter. Functionally character 92.02
PRK06180277 short chain dehydrogenase; Provisional 92.02
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 92.0
PRK11908347 NAD-dependent epimerase/dehydratase family protein 91.98
COG2985544 Predicted permease [General function prediction on 91.97
COG2085211 Predicted dinucleotide-binding enzymes [General fu 91.93
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 91.92
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 91.9
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 91.89
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 91.88
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 91.84
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 91.83
PRK12480330 D-lactate dehydrogenase; Provisional 91.74
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 91.72
PRK08267260 short chain dehydrogenase; Provisional 91.68
PRK06949258 short chain dehydrogenase; Provisional 91.57
PRK08177225 short chain dehydrogenase; Provisional 91.55
PLN02686367 cinnamoyl-CoA reductase 91.52
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 91.52
PRK10538248 malonic semialdehyde reductase; Provisional 91.51
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 91.45
PRK07574385 formate dehydrogenase; Provisional 91.44
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 91.42
PRK06940275 short chain dehydrogenase; Provisional 91.39
PRK06483236 dihydromonapterin reductase; Provisional 91.39
PF06826169 Asp-Al_Ex: Predicted Permease Membrane Region; Int 91.28
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 91.26
PRK12939250 short chain dehydrogenase; Provisional 91.25
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.24
PF00072112 Response_reg: Response regulator receiver domain; 91.22
PRK07774250 short chain dehydrogenase; Provisional 91.22
PRK07067257 sorbitol dehydrogenase; Provisional 91.22
PRK07074257 short chain dehydrogenase; Provisional 91.18
PRK06924251 short chain dehydrogenase; Provisional 91.08
PRK12829264 short chain dehydrogenase; Provisional 91.08
PRK06138252 short chain dehydrogenase; Provisional 91.07
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 91.01
PRK06194287 hypothetical protein; Provisional 90.99
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 90.97
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 90.95
COG3180352 AbrB Putative ammonia monooxygenase [General funct 90.93
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.92
PRK07523255 gluconate 5-dehydrogenase; Provisional 90.88
TIGR00783347 ccs citrate carrier protein, CCS family. These pro 90.87
PRK06057255 short chain dehydrogenase; Provisional 90.86
PRK08643256 acetoin reductase; Validated 90.86
PRK06179270 short chain dehydrogenase; Provisional 90.85
PRK07825273 short chain dehydrogenase; Provisional 90.83
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 90.81
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 90.79
PTZ00082321 L-lactate dehydrogenase; Provisional 90.79
PRK12828239 short chain dehydrogenase; Provisional 90.77
KOG0409327 consensus Predicted dehydrogenase [General functio 90.77
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.76
PRK05086312 malate dehydrogenase; Provisional 90.74
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 90.69
COG0679311 Predicted permeases [General function prediction o 90.68
TIGR01625154 YidE_YbjL_dupl AspT/YidE/YbjL antiporter duplicati 90.66
PRK08309177 short chain dehydrogenase; Provisional 90.65
PRK06223307 malate dehydrogenase; Reviewed 90.65
PLN02602350 lactate dehydrogenase 90.62
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.61
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 90.6
PRK07102243 short chain dehydrogenase; Provisional 90.57
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 90.56
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 90.55
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 90.49
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.48
PRK05867253 short chain dehydrogenase; Provisional 90.44
TIGR03023451 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosp 90.43
PRK08339263 short chain dehydrogenase; Provisional 90.41
PRK12548289 shikimate 5-dehydrogenase; Provisional 90.39
PLN02583297 cinnamoyl-CoA reductase 90.37
PRK05866293 short chain dehydrogenase; Provisional 90.35
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 90.35
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.35
PRK07890258 short chain dehydrogenase; Provisional 90.34
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 90.32
PRK09186256 flagellin modification protein A; Provisional 90.29
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.27
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.25
KOG1251323 consensus Serine racemase [Signal transduction mec 90.24
PRK06172253 short chain dehydrogenase; Provisional 90.22
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 90.21
PRK07831262 short chain dehydrogenase; Provisional 90.18
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 90.11
PRK07814263 short chain dehydrogenase; Provisional 90.05
PRK04972558 putative transporter; Provisional 90.03
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 90.01
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 89.99
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 89.99
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 89.99
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 89.97
PRK12460312 2-keto-3-deoxygluconate permease; Provisional 89.92
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 89.84
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 89.8
PLN00203519 glutamyl-tRNA reductase 89.79
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 89.78
TIGR01142 380 purT phosphoribosylglycinamide formyltransferase 2 89.73
PLN00198338 anthocyanidin reductase; Provisional 89.72
PRK12367245 short chain dehydrogenase; Provisional 89.72
TIGR03082156 Gneg_AbrB_dup membrane protein AbrB duplication. T 89.71
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 89.7
PRK07424406 bifunctional sterol desaturase/short chain dehydro 89.69
PRK08251248 short chain dehydrogenase; Provisional 89.69
PRK06196315 oxidoreductase; Provisional 89.66
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 89.62
PRK06181263 short chain dehydrogenase; Provisional 89.58
PLN02214342 cinnamoyl-CoA reductase 89.56
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 89.5
PRK01368 454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.49
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.48
PF02310121 B12-binding: B12 binding domain; InterPro: IPR0061 89.48
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 89.46
PRK12320 699 hypothetical protein; Provisional 89.41
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 89.4
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 89.36
COG0026 375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 89.32
PRK08213259 gluconate 5-dehydrogenase; Provisional 89.28
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 89.27
PRK05875276 short chain dehydrogenase; Provisional 89.26
PLN02477410 glutamate dehydrogenase 89.26
PF00289110 CPSase_L_chain: Carbamoyl-phosphate synthase L cha 89.25
PRK06125259 short chain dehydrogenase; Provisional 89.21
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 89.21
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 89.21
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 89.2
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 89.05
PRK09880343 L-idonate 5-dehydrogenase; Provisional 89.01
COG0025429 NhaP NhaP-type Na+/H+ and K+/H+ antiporters [Inorg 89.0
PRK05717255 oxidoreductase; Validated 88.98
PRK08340259 glucose-1-dehydrogenase; Provisional 88.96
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 88.95
PLN02253280 xanthoxin dehydrogenase 88.95
TIGR02415254 23BDH acetoin reductases. One member of this famil 88.95
PRK12814 652 putative NADPH-dependent glutamate synthase small 88.94
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 88.88
PRK08605332 D-lactate dehydrogenase; Validated 88.87
PRK06500249 short chain dehydrogenase; Provisional 88.84
COG0786404 GltS Na+/glutamate symporter [Amino acid transport 88.84
PRK08277278 D-mannonate oxidoreductase; Provisional 88.83
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 88.79
PRK07677252 short chain dehydrogenase; Provisional 88.71
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 88.71
PRK12742237 oxidoreductase; Provisional 88.67
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 88.6
TIGR01161 352 purK phosphoribosylaminoimidazole carboxylase, Pur 88.59
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 88.58
PRK07576264 short chain dehydrogenase; Provisional 88.57
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 88.56
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 88.52
PRK06139330 short chain dehydrogenase; Provisional 88.44
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 88.36
PRK07109334 short chain dehydrogenase; Provisional 88.33
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 88.28
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 88.27
PRK03612521 spermidine synthase; Provisional 88.26
PLN02775286 Probable dihydrodipicolinate reductase 88.26
PRK07775274 short chain dehydrogenase; Provisional 88.25
PRK08223287 hypothetical protein; Validated 88.24
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 88.24
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 88.22
PTZ00325321 malate dehydrogenase; Provisional 88.21
PRK06436303 glycerate dehydrogenase; Provisional 88.18
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 88.14
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 88.1
TIGR01082 448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 88.05
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 88.01
PRK08300302 acetaldehyde dehydrogenase; Validated 87.78
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 87.77
PLN02928347 oxidoreductase family protein 87.75
PRK07097265 gluconate 5-dehydrogenase; Provisional 87.69
PLN02735 1102 carbamoyl-phosphate synthase 87.66
PLN02274505 inosine-5'-monophosphate dehydrogenase 87.61
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 87.6
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 87.59
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 87.5
PRK08818 370 prephenate dehydrogenase; Provisional 87.48
PRK07478254 short chain dehydrogenase; Provisional 87.46
PF05145318 AmoA: Putative ammonia monooxygenase; InterPro: IP 87.45
TIGR00946321 2a69 he Auxin Efflux Carrier (AEC) Family. 87.36
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 87.35
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 87.35
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 87.31
PRK07806248 short chain dehydrogenase; Provisional 87.31
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 87.25
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 87.24
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 87.23
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 87.23
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 87.21
PRK08085254 gluconate 5-dehydrogenase; Provisional 87.17
PRK07041230 short chain dehydrogenase; Provisional 87.15
PRK05650270 short chain dehydrogenase; Provisional 87.14
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 87.13
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 87.13
PRK06141314 ornithine cyclodeaminase; Validated 87.13
PRK08862227 short chain dehydrogenase; Provisional 87.09
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 87.08
PRK13303265 L-aspartate dehydrogenase; Provisional 87.07
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 87.0
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 86.99
PRK11730 715 fadB multifunctional fatty acid oxidation complex 86.85
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 86.84
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 86.84
PRK07063260 short chain dehydrogenase; Provisional 86.84
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 86.83
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 86.82
PRK12779 944 putative bifunctional glutamate synthase subunit b 86.8
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 86.77
COG1255129 Uncharacterized protein conserved in archaea [Func 86.77
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 86.76
PRK05865 854 hypothetical protein; Provisional 86.76
PRK06197306 short chain dehydrogenase; Provisional 86.74
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 86.64
PRK09242257 tropinone reductase; Provisional 86.59
PRK07856252 short chain dehydrogenase; Provisional 86.57
PRK10124463 putative UDP-glucose lipid carrier transferase; Pr 86.52
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 86.52
PRK07035252 short chain dehydrogenase; Provisional 86.48
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 86.46
TIGR00745293 apbA_panE 2-dehydropantoate 2-reductase. This mode 86.44
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 86.44
TIGR01087 433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 86.43
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 86.4
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 86.4
PRK09288 395 purT phosphoribosylglycinamide formyltransferase 2 86.39
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 86.35
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 86.3
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 86.27
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; R 86.25
PF03390414 2HCT: 2-hydroxycarboxylate transporter family; Int 86.18
TIGR00514 449 accC acetyl-CoA carboxylase, biotin carboxylase su 85.97
TIGR00783347 ccs citrate carrier protein, CCS family. These pro 85.96
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 85.94
PRK07062265 short chain dehydrogenase; Provisional 85.94
PRK07904253 short chain dehydrogenase; Provisional 85.92
PRK08263275 short chain dehydrogenase; Provisional 85.91
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 85.82
PRK05600370 thiamine biosynthesis protein ThiF; Validated 85.81
PRK08324681 short chain dehydrogenase; Validated 85.77
PLN02948 577 phosphoribosylaminoimidazole carboxylase 85.77
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 85.75
PRK05294 1066 carB carbamoyl phosphate synthase large subunit; R 85.74
PRK08628258 short chain dehydrogenase; Provisional 85.73
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 85.72
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 85.72
PRK05876275 short chain dehydrogenase; Provisional 85.71
PRK08618325 ornithine cyclodeaminase; Validated 85.69
KOG1298 509 consensus Squalene monooxygenase [Lipid transport 85.67
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 85.57
PRK06487317 glycerate dehydrogenase; Provisional 85.55
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 85.54
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.45
PLN02735 1102 carbamoyl-phosphate synthase 85.44
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 85.43
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.9e-78  Score=710.96  Aligned_cols=552  Identities=33%  Similarity=0.549  Sum_probs=490.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHcCCChHHHHHHHHHhhcc--cCCcCCchhHHHHHHHHHHHHHHHHhhcCChHHHHHhh
Q 003861          112 DLGLDTLTFLAVTVIVVPVFKIARASPILGFFFAGIVLNQ--LGIIRNLTDVKVLSEWGILFLLFEMGLELSLARLKALA  189 (791)
Q Consensus       112 ~l~~~~~llL~~a~l~~~l~~rl~lP~ivg~ilaGillGp--~gli~~~~~l~~l~elgl~~lLF~~Gleldl~~Lk~~~  189 (791)
                      +++++++++++++.+++++++|+|+|+++|||++|+++||  +|++++.+.++.++|+|++++||.+|+|+|++++|+.+
T Consensus         5 ~~l~~~~~~l~~a~i~~~l~~rl~lp~vlgyilaGillGP~~lg~i~~~~~i~~laelGvv~LlF~iGLEl~~~~l~~~~   84 (621)
T PRK03562          5 HTLIQALIYLGAAVLIVPIAVRLGLGSVLGYLIAGCIIGPWGLRLVTDVESILHFAEFGVVLMLFVIGLELDPQRLWKLR   84 (621)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhCCChHHHHHHHHHHhCcccccCCCCHHHHHHHHHHHHHHHHHHHHhCcCHHHHHHHH
Confidence            3577888899999999999999999999999999999999  57788888899999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhHHHHhhcccccccccCCHHHHHHHHHHhhhccHHHHHHHHHhcCCCCC
Q 003861          190 KFAFGMGLTQVVLSTLAFTAFELPPNGAVGTRILEFLFHSRSDLVNIRSIDEAVVIGAALSLSSSAFVLQLLAEKGELPT  269 (791)
Q Consensus       190 ~~~~~la~~~~llt~~~~~~~~~p~~~~lG~~~~~~l~g~~~~~~~~~~~~~alllga~ls~TS~avv~~lL~e~~~~~~  269 (791)
                      |+++.++..++++++++++.+             .+++|        ++|..++++|++++.|||++++++++|++++++
T Consensus        85 ~~~~~~g~~qv~~~~~~~~~~-------------~~~~g--------~~~~~al~ig~~la~SStaiv~~~L~e~~~l~t  143 (621)
T PRK03562         85 RSIFGGGALQMVACGGLLGLF-------------CMLLG--------LRWQVALLIGLGLALSSTAIAMQAMNERNLMVT  143 (621)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH-------------HHHhC--------CCHHHHHHHHHHHHHHHHHHHHHHHHHhccccC
Confidence            999999999999998765543             35666        689999999999999999999999999999999


Q ss_pred             hhHHHHHHHHHHhHHHHHHHHHHHHHHhhccCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccchHHHHH
Q 003861          270 RFGSATLGILLLQDIAVVPLLVILPVLESQVSESVWPMLVKESLKALAGLGLLSLGGKYLLRRVFEVVAEARSSEAFVAL  349 (791)
Q Consensus       270 ~~g~l~l~~~~l~Di~~v~~l~i~~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~l~~~~~~~~l~~~i~~~~~~e~~~~~  349 (791)
                      +.|+.+++++++||+++++++++++.+...+............++.++++++++++++|+.+++++|+.+.+++|.+...
T Consensus       144 ~~G~~~l~~ll~~Dl~~i~ll~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~l~~~l~~~~~~~~~~e~~~~~  223 (621)
T PRK03562        144 QMGRSAFAILLFQDIAAIPLVAMIPLLAASGASTTLGAFALSALKVAGALALVVLGGRYVTRPALRFVARSGLREVFTAV  223 (621)
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHHHHHccCCCccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCchHHHHH
Confidence            99999999999999999999998876654211111112222344455555556677899999999999988889998888


Q ss_pred             HHHHHHHHHHHHHHhCChHHHHHHHHhHhcCCccchhHHHHhhhchHhHHHHHHHHHHcccCChHHHHhhhHHHHHHHHH
Q 003861          350 CLLTVAGTSLLTQKLGFSDTLGAFLAGAILAETNFRTQIEADIRPFRGLLLGLFFVTTGSSIDIELLFREWPNVLALLAG  429 (791)
Q Consensus       350 ~l~~~~~~~~la~~lGls~~LgAflaGl~l~~~~~~~~i~~~l~~~~~~f~~lFFv~vG~~l~l~~l~~~~~~~l~l~l~  429 (791)
                      +++++++++++++.+|+|+++|||+||++++++++++++++++++|+++|+|+||+++|+++|++.+..+|+.++.++++
T Consensus       224 ~l~lv~~~a~la~~~Gls~~lGAFlAGl~l~~~~~~~~le~~i~pf~~lll~lFFi~vG~~id~~~l~~~~~~il~~~~~  303 (621)
T PRK03562        224 ALFLVFGFGLLMEEVGLSMALGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIAVGMSIDFGTLLENPLRILILLLG  303 (621)
T ss_pred             HHHHHHHHHHHHHHhCccHHHHHHHHHHHhcCCccHHHHHHHHHHHHHHHHHHHHHHhhhhccHHHHHHHHHHHHHHHHH
Confidence            88889999999999999999999999999999999999999999999999999999999999999987777776667777


Q ss_pred             HHHHHHHHHHHhhhhcCCCHHHHHHHHHHHhhhhhHHHHHHHHHHHcCCcchhhhhHHHHHHHHHHHhHhHHHHHHHHHH
Q 003861          430 LIIIKTLIISAIGPRVGLTLQESVRIGLLLSQGGEFAFVVFSLANRLGVLPLELNKLLIIVVVLSMALTPLLNEIGRWAA  509 (791)
Q Consensus       430 ~ll~K~l~~~~~~~~~~~~~r~~~~~g~~l~~rG~~~lvla~~a~~~g~i~~~~~~~iv~~vvlt~iltpll~~l~~~l~  509 (791)
                      .+++|+++++..++++|+++++++.+|+.|+|+|||+++++..+.+.|+++++.++.+++++++|++++|++..+..+..
T Consensus       304 ~~~~K~~~~~~~~~~~g~~~~~a~~~gl~L~~~Gef~~vl~~~a~~~~~i~~~~~~~lv~~v~lS~~~tP~l~~~~~~~~  383 (621)
T PRK03562        304 FLAIKIAMLWLLARPLGVPRKQRRWFAVLLGQGGEFAFVVFGAAQMANVLEPEWAKLLTLAVALSMAATPLLLVLLDRLE  383 (621)
T ss_pred             HHHHHHHHHHHHHHHhCCCHhHHHHHHHHHhccccHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHhhhHHH
Confidence            88999999999999999999999999999999999999999999999999999999999999999999999988765543


Q ss_pred             hhhhhhcCCcchhhhhhcccCCCCEEEeCCChhHHHHHHHhhhhccCCCCCCCCCCcEEEEcCChhhHHHHHhcCCCEEE
Q 003861          510 DFIDDKFGSEDKVEEMVNYEGSEPVVIVGFGQMGQVLANLLSAPLASGSDGNTVGWPFVAFDLNPSVVKESRKLGFPILY  589 (791)
Q Consensus       510 ~~l~~~~~~~~~~~~~~~~~~~~~viI~G~G~~G~~la~~L~~~~~~~~~~~~~g~~vvvID~d~~~v~~~~~~~~~~v~  589 (791)
                      ..   +..+... ++.. .+.++|++||||||+|+.+++.|.          ++|+++++||.|+++++++++.|.++++
T Consensus       384 ~~---~~~~~~~-~~~~-~~~~~~vII~G~Gr~G~~va~~L~----------~~g~~vvvID~d~~~v~~~~~~g~~v~~  448 (621)
T PRK03562        384 QS---RTEEARE-ADEI-DEQQPRVIIAGFGRFGQIVGRLLL----------SSGVKMTVLDHDPDHIETLRKFGMKVFY  448 (621)
T ss_pred             HH---Hhhhccc-cccc-ccccCcEEEEecChHHHHHHHHHH----------hCCCCEEEEECCHHHHHHHHhcCCeEEE
Confidence            21   1111101 1111 134789999999999999999998          8999999999999999999999999999


Q ss_pred             ccCCCHHHHHhcCCCCCcEEEEEeCCHHHHHHHHHHHHHhCCCCcEEEEecChhhHHHHHHCCCCeEEcCcHHHHHHHHH
Q 003861          590 GDASRPAVLLSAGITSPKAVMIMYTDKKRTIEAVQRLRLAFPAIPIYARAQDMMHLLDLKKAGATDAILENAETSLQLGS  669 (791)
Q Consensus       590 GD~t~~~~L~~agi~~a~~viv~~~~d~~n~~~~~~ar~l~p~~~iiara~~~~~~~~L~~~Gad~Vi~p~~~~~~~la~  669 (791)
                      ||++|+++|+++|+++||.+|++++||+.|..++..+|+.||+++++||++|++|.+.|+++|||+|+.+..+.+.++++
T Consensus       449 GDat~~~~L~~agi~~A~~vvv~~~d~~~n~~i~~~ar~~~p~~~iiaRa~d~~~~~~L~~~Gad~v~~e~~e~sl~l~~  528 (621)
T PRK03562        449 GDATRMDLLESAGAAKAEVLINAIDDPQTSLQLVELVKEHFPHLQIIARARDVDHYIRLRQAGVEKPERETFEGALKSGR  528 (621)
T ss_pred             EeCCCHHHHHhcCCCcCCEEEEEeCCHHHHHHHHHHHHHhCCCCeEEEEECCHHHHHHHHHCCCCEEehhhHhHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhcCCChHHHHHHHHHHhcccccceee
Q 003861          670 KLLKGFGVMSDDVTFLRQLVRNSMEIQAQE  699 (791)
Q Consensus       670 ~~l~~l~~~~~~~~~l~~~~~~~~~~~~~e  699 (791)
                      +++..+|.+++.++...+.+|+.++....+
T Consensus       529 ~~L~~lg~~~~~~~~~~~~~r~~~~~~~~~  558 (621)
T PRK03562        529 LVLESLGLGPYEARERADRFRRHNLQMVEE  558 (621)
T ss_pred             HHHHHcCCCHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999988888766555544

>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>COG0475 KefB Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>COG4651 RosB Kef-type K+ transport system, predicted NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05326 potassium/proton antiporter; Reviewed Back     alignment and domain information
>TIGR00932 2a37 transporter, monovalent cation:proton antiporter-2 (CPA2) family Back     alignment and domain information
>PF00999 Na_H_Exchanger: Sodium/hydrogen exchanger family; InterPro: IPR006153 Sodium proton exchangers (NHEs) constitute a large family of integral membrane protein transporters that are responsible for the counter-transport of protons and sodium ions across lipid bilayers [, ] Back     alignment and domain information
>COG3263 NhaP-type Na+/H+ and K+/H+ antiporters with a unique C-terminal domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00844 c_cpa1 na(+)/h(+) antiporter Back     alignment and domain information
>KOG1650 consensus Predicted K+/H+-antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00831 a_cpa1 Na+/H+ antiporter, bacterial form Back     alignment and domain information
>COG0025 NhaP NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00840 b_cpa1 sodium/hydrogen exchanger 3 Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>KOG1965 consensus Sodium/hydrogen exchanger protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4505 consensus Na+/H+ antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14853 nhaA pH-dependent sodium/proton antiporter; Provisional Back     alignment and domain information
>COG1226 Kch Kef-type K+ transport systems, predicted NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00773 NhaA Na+/H+ antiporter NhaA Back     alignment and domain information
>PRK14856 nhaA pH-dependent sodium/proton antiporter; Provisional Back     alignment and domain information
>KOG1966 consensus Sodium/hydrogen exchanger protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14854 nhaA pH-dependent sodium/proton antiporter; Provisional Back     alignment and domain information
>PRK09561 nhaA pH-dependent sodium/proton antiporter; Reviewed Back     alignment and domain information
>PRK09560 nhaA pH-dependent sodium/proton antiporter; Reviewed Back     alignment and domain information
>PRK14855 nhaA pH-dependent sodium/proton antiporter; Provisional Back     alignment and domain information
>COG3004 NhaA Na+/H+ antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF06965 Na_H_antiport_1: Na+/H+ antiporter 1; InterPro: IPR004670 NhaA is a sodium ion/proton antiporter that uses the proton electrochemical gradient to expel sodium ions from the cytoplasm and functions primarily in the adaptation to high salinity at alkaline pH Back     alignment and domain information
>PF05684 DUF819: Protein of unknown function (DUF819); InterPro: IPR008537 This family contains proteins of unknown function from archaeal, bacterial and plant species Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK12460 2-keto-3-deoxygluconate permease; Provisional Back     alignment and domain information
>PF03812 KdgT: 2-keto-3-deoxygluconate permease; InterPro: IPR004684 This family includes the characterised 2-Keto-3-Deoxygluconate transporters from Bacillus subtilis and Erwinia chrysanthemi Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>TIGR00698 conserved hypothetical integral membrane protein Back     alignment and domain information
>PF03601 Cons_hypoth698: Conserved hypothetical protein 698; InterPro: IPR018383 This entry represents a family of uncharacterised multi-pass membrane proteins Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>COG3400 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR00793 kdgT 2-keto-3-deoxygluconate transporter Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PF06241 DUF1012: Protein of unknown function (DUF1012); InterPro: IPR010420 This entry represents the CASTOR/POLLUX/SYM8 family of ion channels, which are found in plants Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PF03601 Cons_hypoth698: Conserved hypothetical protein 698; InterPro: IPR018383 This entry represents a family of uncharacterised multi-pass membrane proteins Back     alignment and domain information
>TIGR00932 2a37 transporter, monovalent cation:proton antiporter-2 (CPA2) family Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>COG0786 GltS Na+/glutamate symporter [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK03818 putative transporter; Validated Back     alignment and domain information
>PF03956 DUF340: Membrane protein of unknown function (DUF340); InterPro: IPR005642 Members of this family contain a conserved core of four predicted transmembrane segments Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR00698 conserved hypothetical integral membrane protein Back     alignment and domain information
>TIGR00210 gltS sodium--glutamate symport carrier (gltS) Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>COG2855 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>COG2855 Predicted membrane protein [Function unknown] Back     alignment and domain information
>COG0475 KefB Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0385 Predicted Na+-dependent transporter [General function prediction only] Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05326 potassium/proton antiporter; Reviewed Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>TIGR03802 Asp_Ala_antiprt aspartate-alanine antiporter Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK03818 putative transporter; Validated Back     alignment and domain information
>PRK04972 putative transporter; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PF03616 Glt_symporter: Sodium/glutamate symporter; InterPro: IPR004445 This is a family of sodium/glutamate symporters (glutamate permeases), which catalyse the sodium-dependent uptake of extracellular glutamate Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR00831 a_cpa1 Na+/H+ antiporter, bacterial form Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF01758 SBF: Sodium Bile acid symporter family; InterPro: IPR002657 This family of proteins are found both in prokaryotes and eukaryotes Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>TIGR00210 gltS sodium--glutamate symport carrier (gltS) Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR00844 c_cpa1 na(+)/h(+) antiporter Back     alignment and domain information
>TIGR03802 Asp_Ala_antiprt aspartate-alanine antiporter Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05274 2-keto-3-deoxygluconate permease; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03025 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03082 Gneg_AbrB_dup membrane protein AbrB duplication Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PF13593 DUF4137: SBF-like CPA transporter family (DUF4137) Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PF03616 Glt_symporter: Sodium/glutamate symporter; InterPro: IPR004445 This is a family of sodium/glutamate symporters (glutamate permeases), which catalyse the sodium-dependent uptake of extracellular glutamate Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>TIGR00832 acr3 arsenical-resistance protein Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR00841 bass bile acid transporter Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>COG2985 Predicted permease [General function prediction only] Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PF06826 Asp-Al_Ex: Predicted Permease Membrane Region; InterPro: IPR006512 These sequences contain a domain that is duplicated in HI0035 of Haemophilus influenzae, in YidE and YbjL of Escherichia coli, and in a number of other putative transporters Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG3180 AbrB Putative ammonia monooxygenase [General function prediction only] Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR00783 ccs citrate carrier protein, CCS family Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>COG0679 Predicted permeases [General function prediction only] Back     alignment and domain information
>TIGR01625 YidE_YbjL_dupl AspT/YidE/YbjL antiporter duplication domain Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03023 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1251 consensus Serine racemase [Signal transduction mechanisms; Amino acid transport and metabolism] Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK04972 putative transporter; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK12460 2-keto-3-deoxygluconate permease; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03082 Gneg_AbrB_dup membrane protein AbrB duplication Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PF00289 CPSase_L_chain: Carbamoyl-phosphate synthase L chain, N-terminal domain; InterPro: IPR005481 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG0025 NhaP NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0786 GltS Na+/glutamate symporter [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF05145 AmoA: Putative ammonia monooxygenase; InterPro: IPR007820 This family contains sequences annotated as ammonia monooxygenase Back     alignment and domain information
>TIGR00946 2a69 he Auxin Efflux Carrier (AEC) Family Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>COG1255 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10124 putative UDP-glucose lipid carrier transferase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PF03390 2HCT: 2-hydroxycarboxylate transporter family; InterPro: IPR004679 The 2-hydroxycarboxylate transporter family is a family of secondary transporters found exclusively in the bacterial kingdom Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>TIGR00783 ccs citrate carrier protein, CCS family Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query791
3eyw_A 413 Crystal Structure Of The C-terminal Domain Of E. Co 2e-13
>pdb|3EYW|A Chain A, Crystal Structure Of The C-terminal Domain Of E. Coli Kefc In Complex With Keff Length = 413 Back     alignment and structure 
Iteration: 1

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 74/144 (51%), Gaps = 10/144 (6%)
Query: 534 VVIVGFGQMGQVLANLLSAPLASGSDGNTVGWPFVAFDLNPSVVKESRKLGFPILYGDAS 593
           V+I GFG+ GQ+   LL   L+SG          V  D +P  ++  RK G  + YGDA+
Sbjct: 7   VIIAGFGRFGQITGRLL---LSSGVK-------MVVLDHDPDHIETLRKFGMKVFYGDAT 56
Query: 594 RPAVLLSAGITSPKAVMIMYTDKKRTIEAVQRLRLAFPAIPIYARAQDMMHLLDLKKAGA 653
           R  +L SAG    + ++    D +  ++  + ++  FP + I ARA+D+ H + L++AG 
Sbjct: 57  RMDLLESAGAAKAEVLINAIDDPQTNLQLTEMVKEHFPHLQIIARARDVDHYIRLRQAGV 116
Query: 654 TDAILENAETSLQLGSKLLKGFGV 677
                E  E +L+ G   L+  G+
Sbjct: 117 EKPERETFEGALKTGRLALESLGL 140

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query791
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 6e-39
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 1e-33
3c85_A183 Putative glutathione-regulated potassium-efflux S 8e-28
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 3e-26
1id1_A153 Putative potassium channel protein; RCK domain, E. 2e-20
1lnq_A336 MTHK channels, potassium channel related protein; 2e-20
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 4e-18
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 3e-14
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 5e-04
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Length = 413 Back     alignment and structure
 Score =  148 bits (376), Expect = 6e-39
 Identities = 53/226 (23%), Positives = 97/226 (42%), Gaps = 14/226 (6%)

Query: 530 GSE--PVVIVGFGQMGQVLANLLSAPLASGSDGNTVGWPFVAFDLNPSVVKESRKLGFPI 587
           GS    V+I GFG+ GQ+   LL +           G   V  D +P  ++  RK G  +
Sbjct: 1   GSHGMRVIIAGFGRFGQITGRLLLS----------SGVKMVVLDHDPDHIETLRKFGMKV 50

Query: 588 LYGDASRPAVLLSAGITSPKAVMIMYTDKKRTIEAVQRLRLAFPAIPIYARAQDMMHLLD 647
            YGDA+R  +L SAG    + ++    D +  ++  + ++  FP + I ARA+D+ H + 
Sbjct: 51  FYGDATRMDLLESAGAAKAEVLINAIDDPQTNLQLTEMVKEHFPHLQIIARARDVDHYIR 110

Query: 648 LKKAGATDAILENAETSLQLGSKLLKGFGVMSDDVTFLRQLVRNSMEIQAQEVLSQKDDQ 707
           L++AG      E  E +L+ G   L+  G+   +      + R       +E+   ++D 
Sbjct: 111 LRQAGVEKPERETFEGALKTGRLALESLGLGPYEARERADVFRRFNIQMVEEMAMVENDT 170

Query: 708 E--FDIMKPLQVRVADIVEAEKTIPSTSNDDKLSREDNTDTAGEDA 751
           +    + K     +++I+  ++   S          +     G  A
Sbjct: 171 KARAAVYKRTSAMLSEIITEDREHLSLIQRHGWQGTEEGKHTGNMA 216
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Length = 140 Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Length = 183 Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Length = 234 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Length = 153 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Length = 141 Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Length = 144 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Length = 155 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query791
1lnq_A336 MTHK channels, potassium channel related protein; 99.93
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 99.93
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 99.92
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 99.91
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 99.91
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 99.9
4g65_A 461 TRK system potassium uptake protein TRKA; structur 99.88
4gx0_A565 TRKA domain protein; membrane protein, ION channel 99.88
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 99.85
1id1_A153 Putative potassium channel protein; RCK domain, E. 99.84
4g65_A461 TRK system potassium uptake protein TRKA; structur 99.82
3c85_A183 Putative glutathione-regulated potassium-efflux S 99.82
1zcd_A388 Na(+)/H(+) antiporter 1; membrane protein; 3.45A { 99.78
3naf_A 798 Calcium-activated potassium channel subunit alpha; 99.73
3mt5_A 726 Potassium large conductance calcium-activated CHA 99.69
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 99.67
1lss_A140 TRK system potassium uptake protein TRKA homolog; 99.66
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 99.66
4hpf_A 722 Potassium channel subfamily U member 1; PH-gated, 99.35
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.13
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 97.46
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 97.31
3naf_A798 Calcium-activated potassium channel subunit alpha; 97.28
1vct_A205 Hypothetical protein PH0236; helix rich, structura 97.27
4hpf_A722 Potassium channel subfamily U member 1; PH-gated, 97.17
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 97.13
3zux_A332 Transporter, ASBTNM; transport protein, membrane p 97.07
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 96.96
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 96.96
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 96.94
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 96.89
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 96.84
3qha_A296 Putative oxidoreductase; seattle structural genomi 96.83
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 96.83
2rir_A300 Dipicolinate synthase, A chain; structural genomic 96.79
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 96.75
3l6d_A306 Putative oxidoreductase; structural genomics, prot 96.7
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 96.67
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 96.66
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 96.66
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 96.66
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 96.61
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 96.59
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 96.58
3ius_A286 Uncharacterized conserved protein; APC63810, silic 96.54
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 96.51
2wm3_A299 NMRA-like family domain containing protein 1; unkn 96.51
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 96.51
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 96.51
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 96.51
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 96.45
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 96.43
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 96.42
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 96.39
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 96.39
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 96.38
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.38
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 96.35
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 96.35
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.34
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 96.34
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 96.25
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 96.25
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 96.25
1vpd_A299 Tartronate semialdehyde reductase; structural geno 96.24
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 96.23
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 96.2
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 96.2
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 96.19
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 96.17
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 96.15
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 96.14
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 96.08
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 96.08
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 96.02
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 96.0
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 95.99
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 95.96
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 95.91
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 95.88
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 95.88
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 95.86
2we8_A386 Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc 95.85
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 95.84
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 95.82
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 95.81
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 95.81
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 95.81
4ezb_A317 Uncharacterized conserved protein; structural geno 95.8
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 95.77
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 95.67
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 95.67
3on5_A362 BH1974 protein; structural genomics, joint center 95.59
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 95.53
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 95.51
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 95.44
1xq6_A253 Unknown protein; structural genomics, protein stru 95.43
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 95.42
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 95.4
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 95.38
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 95.36
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 95.35
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 95.31
1yb4_A295 Tartronic semialdehyde reductase; structural genom 95.31
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 95.31
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 95.3
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 95.27
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 95.26
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 95.25
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 95.24
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 95.22
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 95.21
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 95.17
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 95.14
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 95.13
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 95.13
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 95.11
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 95.07
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 95.05
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 95.05
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 95.04
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 95.02
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 95.01
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 95.01
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 94.98
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 94.96
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 94.95
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 94.93
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 94.93
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 94.79
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 94.78
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 94.77
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 94.77
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 94.77
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 94.72
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 94.71
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 94.7
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 94.67
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 94.63
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 94.59
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 94.54
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 94.51
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 94.49
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 94.48
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 94.48
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 94.47
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 94.44
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 94.44
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 94.44
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 94.43
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 94.39
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 94.31
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 94.29
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 94.23
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 94.2
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 94.14
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 94.1
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 94.03
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 94.01
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 94.0
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 93.99
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 93.96
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 93.94
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 93.94
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 93.93
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 93.85
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 93.84
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 93.83
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 93.82
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 93.81
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 93.77
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 93.74
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 93.68
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 93.62
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 93.57
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 93.56
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 93.54
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 93.51
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 93.5
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 93.5
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 93.49
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 93.43
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 93.43
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 93.43
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 93.38
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 93.37
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 93.35
2qxy_A142 Response regulator; regulation of transcription, N 93.3
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 93.19
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 93.17
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 93.09
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 93.04
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 93.0
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 92.98
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 92.97
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 92.95
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 92.93
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 92.91
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 92.82
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 92.82
3euw_A344 MYO-inositol dehydrogenase; protein structure init 92.78
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 92.72
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 92.72
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 92.7
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 92.68
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 92.67
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 92.67
3kto_A136 Response regulator receiver protein; PSI-II,struct 92.62
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 92.61
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 92.6
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 92.6
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 92.55
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 92.55
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 92.54
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 92.52
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 92.52
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 92.49
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 92.47
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 92.45
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 92.43
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 92.43
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 92.41
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 92.37
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 92.36
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 92.33
4had_A350 Probable oxidoreductase protein; structural genomi 92.31
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 92.31
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 92.28
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 92.27
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 92.26
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 92.25
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 92.23
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 92.2
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 92.19
3gem_A260 Short chain dehydrogenase; structural genomics, AP 92.19
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 92.17
3f6c_A134 Positive transcription regulator EVGA; structural 92.15
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 92.15
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 92.14
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 92.14
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 92.13
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 92.11
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 92.07
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 92.02
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 92.01
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 92.0
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 91.99
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 91.98
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 91.97
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 91.96
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 91.96
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 91.94
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 91.93
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 91.92
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 91.89
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 91.88
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 91.87
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 91.86
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 91.84
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 91.83
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 91.82
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 91.81
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 91.8
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 91.8
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 91.77
4ffl_A 363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 91.76
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 91.76
3mt5_A726 Potassium large conductance calcium-activated CHA 91.76
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 91.75
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 91.73
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 91.71
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 91.71
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 91.7
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 91.69
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 91.66
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 91.63
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 91.63
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 91.63
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 91.63
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 91.59
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 91.58
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 91.57
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 91.56
4dad_A146 Putative pilus assembly-related protein; response 91.54
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 91.54
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 91.51
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 91.49
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 91.47
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 91.47
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 91.46
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 91.46
3cnb_A143 DNA-binding response regulator, MERR family; signa 91.46
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 91.44
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 91.43
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 91.43
3lua_A140 Response regulator receiver protein; two-component 91.41
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 91.41
2rjn_A154 Response regulator receiver:metal-dependent phosph 91.4
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 91.4
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 91.39
3imf_A257 Short chain dehydrogenase; structural genomics, in 91.39
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 91.38
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 91.38
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 91.38
3slg_A372 PBGP3 protein; structural genomics, seattle struct 91.38
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 91.37
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 91.35
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 91.35
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 91.34
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 91.34
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 91.31
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 91.3
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 91.3
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 91.29
1xkq_A280 Short-chain reductase family member (5D234); parra 91.29
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 91.27
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 91.27
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 91.25
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 91.25
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 91.25
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 91.21
3hdg_A137 Uncharacterized protein; two-component sensor acti 91.2
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 91.18
1nff_A260 Putative oxidoreductase RV2002; directed evolution 91.17
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 91.17
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 91.17
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 91.16
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 91.15
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 91.15
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 91.11
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 91.1
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 91.1
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 91.09
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 91.09
1xq1_A266 Putative tropinone reducatse; structural genomics, 91.08
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 91.07
3jte_A143 Response regulator receiver protein; structural ge 91.06
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 91.03
2qr3_A140 Two-component system response regulator; structura 91.0
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 91.0
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 90.99
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 90.36
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 90.99
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 90.97
4eso_A255 Putative oxidoreductase; NADP, structural genomics 90.95
3cxt_A291 Dehydrogenase with different specificities; rossma 90.95
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 90.93
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 90.93
3gt7_A154 Sensor protein; structural genomics, signal receiv 90.92
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 90.9
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 90.89
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 90.87
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 90.85
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 90.8
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 90.79
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 90.77
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 90.75
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 90.75
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 90.74
3tl2_A315 Malate dehydrogenase; center for structural genomi 90.73
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 90.71
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 90.7
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 90.7
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 90.7
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 90.7
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 90.68
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 90.66
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 90.65
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 90.62
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 90.61
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 90.6
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 90.53
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 90.53
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 90.5
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 90.5
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 90.5
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 90.49
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 90.48
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 90.46
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 90.45
1xhl_A297 Short-chain dehydrogenase/reductase family member 90.44
2qv0_A143 Protein MRKE; structural genomics, transcription, 90.43
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 90.42
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 90.41
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 90.38
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 90.37
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 90.37
2l0e_A33 Sodium/hydrogen exchanger 1; transmembrane helix, 90.36
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 90.36
3eul_A152 Possible nitrate/nitrite response transcriptional 90.33
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 90.33
4dqx_A277 Probable oxidoreductase protein; structural genomi 90.33
3tjr_A301 Short chain dehydrogenase; structural genomics, se 90.32
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 90.27
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 90.27
3cz5_A153 Two-component response regulator, LUXR family; str 90.26
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 90.26
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 90.25
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 90.25
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 90.23
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 90.17
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 90.17
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 90.11
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 90.11
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 90.08
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 90.07
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 90.05
1spx_A278 Short-chain reductase family member (5L265); paral 90.01
2pln_A137 HP1043, response regulator; signaling protein; 1.8 89.97
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 89.96
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 89.96
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 89.95
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 89.93
4f6c_A427 AUSA reductase domain protein; thioester reductase 89.93
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 89.91
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 89.91
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 89.91
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 89.88
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 89.87
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 89.87
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 89.81
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 89.79
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 89.78
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 89.78
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 89.76
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 89.76
3hdv_A136 Response regulator; PSI-II, structural genomics, P 89.74
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 89.72
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 89.72
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 89.71
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 89.69
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 89.68
2dwc_A 433 PH0318, 433AA long hypothetical phosphoribosylglyc 89.67
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 89.66
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 89.6
3rih_A293 Short chain dehydrogenase or reductase; structural 89.58
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 89.58
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 89.58
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 89.52
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 89.51
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 89.51
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 89.49
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 89.48
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 89.39
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 89.38
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 89.37
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 89.37
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 89.34
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 89.34
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 89.31
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 89.3
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 89.28
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 89.27
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 89.27
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 89.26
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 89.24
1ydw_A 362 AX110P-like protein; structural genomics, protein 89.24
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 89.23
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 89.23
3ax6_A 380 Phosphoribosylaminoimidazole carboxylase, ATPase; 89.21
3cg0_A140 Response regulator receiver modulated diguanylate 89.19
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 89.18
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 89.17
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 89.15
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 89.14
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 89.09
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 89.07
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 89.04
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 89.03
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 89.01
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 89.01
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 88.98
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 88.88
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 88.86
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 88.84
3aw8_A 369 PURK, phosphoribosylaminoimidazole carboxylase, AT 88.82
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 88.81
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 88.72
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 88.69
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 88.69
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 88.66
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 88.66
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 88.65
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 88.64
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 88.64
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 88.63
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 88.49
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 88.45
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 88.41
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 88.38
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 88.38
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 88.34
1kjq_A 391 GART 2, phosphoribosylglycinamide formyltransferas 88.28
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 88.27
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 88.25
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 88.25
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 88.24
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 88.24
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 88.19
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 88.13
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
Probab=99.93  E-value=4.4e-26  Score=249.30  Aligned_cols=205  Identities=18%  Similarity=0.160  Sum_probs=174.0

Q ss_pred             CCCEEEeCCChhHHHHHHHhhhhccCCCCCCCCCCcEEEEcCChhhHHHHHhcCCCEEEccCCCHHHHHhcCCCCCcEEE
Q 003861          531 SEPVVIVGFGQMGQVLANLLSAPLASGSDGNTVGWPFVAFDLNPSVVKESRKLGFPILYGDASRPAVLLSAGITSPKAVM  610 (791)
Q Consensus       531 ~~~viI~G~G~~G~~la~~L~~~~~~~~~~~~~g~~vvvID~d~~~v~~~~~~~~~~v~GD~t~~~~L~~agi~~a~~vi  610 (791)
                      ++|++|||+|++|+.+++.|.          +.|+ |+++|.|+++++ +++.+.++++||++|+++|+++|+++||+++
T Consensus       115 ~~~viI~G~G~~g~~l~~~L~----------~~g~-v~vid~~~~~~~-~~~~~~~~i~gd~~~~~~L~~a~i~~a~~vi  182 (336)
T 1lnq_A          115 SRHVVICGWSESTLECLRELR----------GSEV-FVLAEDENVRKK-VLRSGANFVHGDPTRVSDLEKANVRGARAVI  182 (336)
T ss_dssp             -CEEEEESCCHHHHHHHTTGG----------GSCE-EEEESCGGGHHH-HHHTTCEEEESCTTSHHHHHHTCSTTEEEEE
T ss_pred             cCCEEEECCcHHHHHHHHHHH----------hCCc-EEEEeCChhhhh-HHhCCcEEEEeCCCCHHHHHhcChhhccEEE
Confidence            679999999999999999998          7899 999999999999 9889999999999999999999999999999


Q ss_pred             EEeCCHHHHHHHHHHHHHhCCCCcEEEEecChhhHHHHHHCCCCeEEcCcHHHHHHHHHHHHhhcCCChHHHHHHHHHHh
Q 003861          611 IMYTDKKRTIEAVQRLRLAFPAIPIYARAQDMMHLLDLKKAGATDAILENAETSLQLGSKLLKGFGVMSDDVTFLRQLVR  690 (791)
Q Consensus       611 v~~~~d~~n~~~~~~ar~l~p~~~iiara~~~~~~~~L~~~Gad~Vi~p~~~~~~~la~~~l~~l~~~~~~~~~l~~~~~  690 (791)
                      +++++|+.|+.+++.+|+++|+.+++||++++++.+.++++|+|.|++|+.+++.++++.+..     |+..+.++++++
T Consensus       183 ~~~~~d~~n~~~~~~ar~~~~~~~iiar~~~~~~~~~l~~~G~d~vi~~~~~~~~~l~~~~~~-----~~~~~~~~~~~~  257 (336)
T 1lnq_A          183 VDLESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAGADQVISPFVISGRLMSRSIDD-----GYEAMFVQDVLA  257 (336)
T ss_dssp             ECCSSHHHHHHHHHHHHTTCTTSEEEEECSSGGGHHHHHHTTCSEEECHHHHHHHHHHHTSSC-----SHHHHHHHHHTS
T ss_pred             EcCCccHHHHHHHHHHHHHCCCCeEEEEECCHHHHHHHHHcCCCEEEChhHhHHHHHHHHHhC-----ccHHHHHHHHHc
Confidence            999999999999999999999999999999999999999999999999999999999998877     665555545656


Q ss_pred             cccccceeeeecCCCc-hhhcccccCCcc------hhhhhhccCCCCCCCCccccccCCCCCCCCCCCCceeeeeccCC
Q 003861          691 NSMEIQAQEVLSQKDD-QEFDIMKPLQVR------VADIVEAEKTIPSTSNDDKLSREDNTDTAGEDAKGVLYCELNGT  762 (791)
Q Consensus       691 ~~~~~~~~e~~~~~~~-~~~~~~~~~~i~------~~~l~~~~~~~~~~~~~~~~~~~p~~~~~~~~gd~~l~~~~~~~  762 (791)
                      ..++..+.|+.++.+. ..++++++++.+      +..+.|          +++....|++++++++||++.+.+.+..
T Consensus       258 ~~~~~~l~e~~v~~~s~~~Gk~l~el~l~~~~~~~ii~i~r----------~~~~~~~P~~~~~l~~gD~liv~g~~~~  326 (336)
T 1lnq_A          258 EESTRRMVEVPIPEGSKLEGVSVLDADIHDVTGVIIIGVGR----------GDELIIDPPRDYSFRAGDIILGIGKPEE  326 (336)
T ss_dssp             SCSSCEEEEEECCSSCSSTTCBHHHHCHHHHHCCEEEEEEC----------SSCEESSCCTTCBCCSSCEEEEEECHHH
T ss_pred             CcCCceEEEEEeCCCCCcCCCCHHHcccccccCeEEEEEEE----------CCEEEECcCCCcEEcCCCEEEEEECHHH
Confidence            5557888888876542 355666555433      222332          2334445999999999999999987654
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1zcd_A Na(+)/H(+) antiporter 1; membrane protein; 3.45A {Escherichia coli} PDB: 3fi1_A Back     alignment and structure
>3naf_A Calcium-activated potassium channel subunit alpha; ION channel, gating ring, rossman fold, transport, ION trans; 3.10A {Homo sapiens} Back     alignment and structure
>3mt5_A Potassium large conductance calcium-activated CHA subfamily M, alpha member 1; potassium channel, membrane protein, transport protein; 3.00A {Homo sapiens} PDB: 3u6n_A Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>4hpf_A Potassium channel subfamily U member 1; PH-gated, membrane protein, transport Pro; 3.40A {Homo sapiens} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3naf_A Calcium-activated potassium channel subunit alpha; ION channel, gating ring, rossman fold, transport, ION trans; 3.10A {Homo sapiens} Back     alignment and structure
>1vct_A Hypothetical protein PH0236; helix rich, structural genomics, riken structural genomics/P initiative, RSGI, NPPSFA; 1.85A {Pyrococcus horikoshii} SCOP: a.7.12.1 d.286.1.1 PDB: 2bkn_A 2bko_A 2bkp_A Back     alignment and structure
>4hpf_A Potassium channel subfamily U member 1; PH-gated, membrane protein, transport Pro; 3.40A {Homo sapiens} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3zux_A Transporter, ASBTNM; transport protein, membrane protein; HET: TCH LDA PTY; 2.20A {Neisseria meningitidis} PDB: 3zuy_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3on5_A BH1974 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, oxidoreductase; 2.80A {Bacillus halodurans} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3mt5_A Potassium large conductance calcium-activated CHA subfamily M, alpha member 1; potassium channel, membrane protein, transport protein; 3.00A {Homo sapiens} PDB: 3u6n_A Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2l0e_A Sodium/hydrogen exchanger 1; transmembrane helix, membrane protein, NHE1; NMR {Homo sapiens} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 791
d1id1a_153 c.2.1.9 (A:) Rck domain from putative potassium ch 4e-12
d2hmva1134 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [T 6e-12
d2fy8a1129 c.2.1.9 (A:116-244) Potassium channel-related prot 9e-12
d1lssa_132 c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus ja 3e-06
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Length = 153 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Potassium channel NAD-binding domain
domain: Rck domain from putative potassium channel Kch
species: Escherichia coli [TaxId: 562]

 Score = 62.6 bits (151), Expect = 4e-12
 Identities = 21/150 (14%), Positives = 51/150 (34%), Gaps = 7/150 (4%)

Query: 534 VVIVGFGQMGQVLANLLSAPLASGSDGNTVGWPFVAFDLNPSVVKESRKLGFPILYGDAS 593
            ++ G   +       L+        G  V       + +   +++       ++ GD++
Sbjct: 6   FIVCGHSILAINTILQLNQ------RGQNVTVISNLPEDDIKQLEQRLGDNADVIPGDSN 59

Query: 594 RPAVLLSAGITSPKAVMIMYTDKKRTIEAVQRLRLAFPAIPIYARAQDMMHLLDLKKAGA 653
             +VL  AGI   +A++ +  +       V   +     +       D  +L  +K    
Sbjct: 60  DSSVLKKAGIDRCRAILALSDNDADNAFVVLSAKDMSSDVKTVLAVSDSKNLNKIKMVHP 119

Query: 654 TDAILENAETSLQLGSKLLKGFGVMSDDVT 683
              +      S  L +++L G  + +D + 
Sbjct: 120 DIILSPQLFGSEIL-ARVLNGEEINNDMLV 148
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Length = 134 Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 129 Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 132 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query791
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 99.91
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 99.91
d1id1a_153 Rck domain from putative potassium channel Kch {Es 99.91
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 99.9
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.77
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.61
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.48
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.47
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.33
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.29
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 97.29
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 97.22
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 96.94
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 96.88
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.82
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.69
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 96.63
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 96.6
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 96.37
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 96.33
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.04
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 95.8
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 95.75
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 95.75
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 95.73
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 95.72
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.67
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.66
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 95.58
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 95.44
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.26
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 95.22
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 95.17
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 95.09
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.06
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.05
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.04
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.01
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 94.83
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 94.82
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 94.71
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.69
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 94.6
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 94.59
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.38
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 94.36
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 94.33
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 94.32
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.31
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 94.3
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 94.27
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.23
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 94.12
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 94.1
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.0
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 93.82
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 93.78
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 93.71
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 93.68
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 93.62
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 93.6
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 93.54
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 93.52
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 93.45
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 93.43
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 93.41
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 93.27
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.15
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 93.05
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 93.03
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 92.93
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 92.93
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 92.9
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 92.9
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 92.89
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 92.89
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.82
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 92.81
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.72
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 92.67
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 92.63
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 92.62
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 92.54
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 92.53
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 92.49
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 92.47
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 92.46
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 92.38
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 92.35
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 92.35
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 92.34
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 92.16
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 92.13
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 92.09
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 91.96
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 91.89
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 91.83
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 91.8
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 91.71
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 91.66
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 91.64
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 91.59
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 91.56
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 91.48
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 91.36
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 91.35
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 91.34
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 91.32
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 91.3
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 91.27
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 91.24
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 91.21
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 91.19
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 91.16
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 91.05
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 91.02
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 90.93
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 90.85
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 90.77
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 90.77
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 90.76
d2fy8a292 Potassium channel-related protein MthK, C-terminal 90.7
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 90.7
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 90.67
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 90.62
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 90.6
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 90.55
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 90.52
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 90.4
d7reqb2163 Methylmalonyl-CoA mutase beta subunit, C-terminal 90.24
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 90.23
d1qkka_140 Transcriptional regulatory protein DctD, receiver 90.23
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 90.21
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 90.2
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 90.19
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 90.13
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 90.01
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 89.94
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 89.93
d1qo0d_189 Positive regulator of the amidase operon AmiR {Pse 89.87
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 89.64
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 89.61
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 89.58
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 89.53
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 89.51
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 89.5
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 89.48
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 89.42
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 89.24
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 89.11
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 89.07
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 88.96
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 88.94
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 88.81
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 88.6
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 88.56
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 88.52
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 88.48
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 88.46
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 88.45
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 88.42
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 88.31
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 87.95
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 87.54
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 87.48
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 87.41
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 87.39
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 87.34
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 87.23
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 87.2
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 87.17
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 87.16
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 87.16
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 87.03
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 86.83
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 86.69
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 86.69
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 86.67
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 86.61
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 86.48
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 86.41
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 86.22
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 86.18
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 86.11
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 86.1
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 86.06
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 85.99
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 85.92
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 85.74
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 85.74
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 85.54
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 85.44
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 85.34
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 85.29
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 85.02
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 84.95
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 84.87
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 84.79
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 84.59
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 84.52
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 84.5
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 84.43
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 84.41
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 84.28
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 84.23
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 84.21
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 84.0
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 83.91
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 83.91
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 83.88
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 83.76
d1yioa2128 Response regulatory protein StyR, N-terminal domai 83.67
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 83.66
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 83.6
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 83.44
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 82.81
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 82.65
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 82.51
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 82.44
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 82.24
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 82.21
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 82.13
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 82.08
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 81.95
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 81.89
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 81.88
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 81.87
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 81.82
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 81.8
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 81.62
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 81.33
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 81.24
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 80.88
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 80.83
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 80.82
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 80.72
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 80.7
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 80.52
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 80.38
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 80.27
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Potassium channel NAD-binding domain
domain: Ktn bsu222
species: Bacillus subtilis [TaxId: 1423]

Probab=99.91  E-value=1.1e-24  Score=204.01  Aligned_cols=132  Identities=20%  Similarity=0.303  Sum_probs=125.0

Q ss_pred             CCEEEeCCChhHHHHHHHhhhhccCCCCCCCCCCcEEEEcCChhhHHHHHhcCCCEEEccCCCHHHHHhcCCCCCcEEEE
Q 003861          532 EPVVIVGFGQMGQVLANLLSAPLASGSDGNTVGWPFVAFDLNPSVVKESRKLGFPILYGDASRPAVLLSAGITSPKAVMI  611 (791)
Q Consensus       532 ~~viI~G~G~~G~~la~~L~~~~~~~~~~~~~g~~vvvID~d~~~v~~~~~~~~~~v~GD~t~~~~L~~agi~~a~~viv  611 (791)
                      ++++|||+|++|+.+++.|.          +.|++|++||.|+++++++++.+.++++||++++++|+++|+++||.+++
T Consensus         1 k~~iIiG~G~~G~~la~~L~----------~~g~~vvvid~d~~~~~~~~~~~~~~~~gd~~~~~~l~~a~i~~a~~vi~   70 (134)
T d2hmva1           1 KQFAVIGLGRFGGSIVKELH----------RMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIV   70 (134)
T ss_dssp             CCEEEECCSHHHHHHHHHHH----------HTTCCCEEEESCHHHHHHTTTTCSEEEECCTTCTTHHHHHTGGGCSEEEE
T ss_pred             CEEEEECCCHHHHHHHHHHH----------HCCCeEEEecCcHHHHHHHHHhCCcceeeecccchhhhccCCccccEEEE
Confidence            47999999999999999998          89999999999999999999999999999999999999999999999999


Q ss_pred             EeCCHHHHHHHHHHHHHhCCCCcEEEEecChhhHHHHHHCCCCeEEcCcHHHHHHHHHHHHh
Q 003861          612 MYTDKKRTIEAVQRLRLAFPAIPIYARAQDMMHLLDLKKAGATDAILENAETSLQLGSKLLK  673 (791)
Q Consensus       612 ~~~~d~~n~~~~~~ar~l~p~~~iiara~~~~~~~~L~~~Gad~Vi~p~~~~~~~la~~~l~  673 (791)
                      ++++|+.|..++..+++.+|..++++|++++++.+.|+++|+|+||.|+.++|.++++.+.+
T Consensus        71 ~~~~~~~~~~~~~~~~~~~~~~~iiar~~~~~~~~~l~~~Gad~vi~p~~~~a~~la~~l~~  132 (134)
T d2hmva1          71 AIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSD  132 (134)
T ss_dssp             CCCSCHHHHHHHHHHHHHTTCSEEEEECCSHHHHHHHHHHTCSEEECHHHHHHHHHHHHHHH
T ss_pred             EcCchHHhHHHHHHHHHHcCCCcEEeecccHhHHHHHHHCCCCEEEChHHHHHHHHHHHHhC
Confidence            99988777777788888888889999999999999999999999999999999999988876
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2fy8a2 d.286.1.1 (A:245-336) Potassium channel-related protein MthK, C-terminal domain {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d7reqb2 c.23.6.1 (B:476-638) Methylmalonyl-CoA mutase beta subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure