Citrus Sinensis ID: 003933
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 785 | 2.2.26 [Sep-21-2011] | |||||||
| Q96I24 | 572 | Far upstream element-bind | yes | no | 0.202 | 0.277 | 0.335 | 2e-19 | |
| Q96AE4 | 644 | Far upstream element-bind | no | no | 0.2 | 0.243 | 0.350 | 2e-18 | |
| Q91WJ8 | 651 | Far upstream element-bind | no | no | 0.2 | 0.241 | 0.350 | 3e-18 | |
| Q32PX7 | 639 | Far upstream element-bind | no | no | 0.2 | 0.245 | 0.350 | 4e-18 | |
| Q99PF5 | 721 | Far upstream element-bind | no | no | 0.225 | 0.245 | 0.318 | 1e-16 | |
| Q3U0V1 | 748 | Far upstream element-bind | no | no | 0.225 | 0.236 | 0.318 | 1e-16 | |
| Q92945 | 711 | Far upstream element-bind | no | no | 0.225 | 0.248 | 0.313 | 2e-16 | |
| Q8UVD9 | 769 | Far upstream element-bind | no | no | 0.2 | 0.204 | 0.320 | 4e-16 | |
| Q80WA4 | 474 | RNA-binding protein Nova- | no | no | 0.205 | 0.339 | 0.329 | 6e-13 | |
| Q2PFW9 | 483 | RNA-binding protein Nova- | N/A | no | 0.205 | 0.333 | 0.329 | 8e-13 |
| >sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 98.2 bits (243), Expect = 2e-19, Method: Compositional matrix adjust.
Identities = 58/173 (33%), Positives = 99/173 (57%), Gaps = 14/173 (8%)
Query: 198 STMSRKIEVPNNKVGVLIGKAGDTIRYLQYNSGAKIQITRDADADPHAATRPVEIIGTLS 257
+ ++ + +VP+ VG +IG+ G+ I +Q SG KIQI ++ P RP + GT
Sbjct: 76 TVITEEFKVPDKMVGFIIGRGGEQISRIQAESGCKIQIASESSGIPE---RPCVLTGTPE 132
Query: 258 NIDKAEKLINAVIAEADAGGSPSLVARGLATAQASGAAEQVEIKVPNEKVGLIIGRGGET 317
+I++A++L+ ++ G G S + Q EI +P KVGL+IGRGGET
Sbjct: 133 SIEQAKRLLGQIVDRCRNG-------PGFHNDIDSNSTIQ-EILIPASKVGLVIGRGGET 184
Query: 318 IKGLQTRSGARIQVLIPQHLPEGDGSKERIVRVTGDMRQIEIAQEMIKEVLSQ 370
IK LQ R+G ++ ++ LP G ++ +R+TGD +++ A+EM+ E++ +
Sbjct: 185 IKQLQERTGVKMVMIQDGPLPTG---ADKPLRITGDAFKVQQAREMVLEIIRE 234
|
May interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression. Homo sapiens (taxid: 9606) |
| >sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q80WA4|NOVA1_RAT RNA-binding protein Nova-1 (Fragment) OS=Rattus norvegicus GN=Nova1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q2PFW9|NOVA1_MACFA RNA-binding protein Nova-1 OS=Macaca fascicularis GN=NOVA1 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 785 | ||||||
| 359495228 | 772 | PREDICTED: uncharacterized protein LOC10 | 0.954 | 0.970 | 0.591 | 0.0 | |
| 255569106 | 798 | nucleic acid binding protein, putative [ | 0.943 | 0.928 | 0.597 | 0.0 | |
| 356495760 | 793 | PREDICTED: uncharacterized protein LOC10 | 0.965 | 0.955 | 0.546 | 0.0 | |
| 357481253 | 807 | Far upstream element-binding protein [Me | 0.949 | 0.923 | 0.539 | 0.0 | |
| 356538917 | 794 | PREDICTED: uncharacterized protein LOC10 | 0.943 | 0.933 | 0.536 | 0.0 | |
| 224145055 | 581 | predicted protein [Populus trichocarpa] | 0.715 | 0.967 | 0.670 | 0.0 | |
| 449447567 | 787 | PREDICTED: uncharacterized protein LOC10 | 0.963 | 0.960 | 0.517 | 1e-173 | |
| 145336377 | 763 | far upstream element-binding protein [Ar | 0.870 | 0.895 | 0.444 | 1e-129 | |
| 22328551 | 725 | KH domain-containing protein [Arabidopsi | 0.886 | 0.96 | 0.444 | 1e-129 | |
| 297813443 | 730 | KH domain-containing protein [Arabidopsi | 0.881 | 0.947 | 0.458 | 1e-127 |
| >gi|359495228|ref|XP_002277528.2| PREDICTED: uncharacterized protein LOC100253453 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 745 bits (1923), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 478/808 (59%), Positives = 554/808 (68%), Gaps = 59/808 (7%)
Query: 1 MAEEEVL--APASAAAADLKRKLDDLEPDEALEHAEGMRDDEAKNSDEVEKNVDGFAEAH 58
MAEEEV+ A AS A +D KRKL+DLEP EA E AE A D V +
Sbjct: 1 MAEEEVVVVAGASPAPSDHKRKLEDLEP-EAPEQAEPDGVQGADAGDYVANDE------- 52
Query: 59 GSEVKRPRLDDDKTEKPDGPVNVNGLKEEKPDEVVDAEQLTEDTTKEEELESAEVKTEQH 118
SE KRPR++D D NG + EK DEV+ E +E+A+ + H
Sbjct: 53 -SEAKRPRVEDQD----DDLATENGYQREKEDEVIK-------ENVELTVENAQSQEAPH 100
Query: 119 SSVEEQASVDNQQISVKEETKEVLFSTEEAFIDVKEETKEVTVKEEETVKEEESVEPSNV 178
+ E +V+++Q S E KE T+E I E ++ ++ T +E E +P+
Sbjct: 101 PTEEAPEAVNDEQPSTDNEQKE---DTQEPSI----ENPQLENPQQPTGEEFE--KPAEE 151
Query: 179 VPQQVVDNSKSDDPS---STDDSTMSRKIEVPNNKVGVLIGKAGDTIRYLQYNSGAKIQI 235
+PQQ V + S + +++ TMSRK+EVPNNKVGVLIGKAGDTIR+LQYNSGAKIQI
Sbjct: 152 IPQQEVGDVPSAEVQQQPTSETQTMSRKMEVPNNKVGVLIGKAGDTIRFLQYNSGAKIQI 211
Query: 236 TRDADADPHAATRPVEIIGTLSNIDKAEKLINAVIAEADAGGSPSLVARGLATAQASGAA 295
TRDADADP++A+RPVE+IG+L NI+KAEKLI VIAEADAGGSPSLVARG ATAQA GAA
Sbjct: 212 TRDADADPYSASRPVELIGSLENINKAEKLIKDVIAEADAGGSPSLVARGFATAQAVGAA 271
Query: 296 EQVEIKVPNEKVGLIIGRGGETIKGLQTRSGARIQVLIPQHLPEGDGSKERIVRVTGDMR 355
EQV+I+VPNEKVGLIIG+GGETIK LQTRSGARIQ LIPQHLPEGD SKER VRVTGD +
Sbjct: 272 EQVQIQVPNEKVGLIIGKGGETIKSLQTRSGARIQ-LIPQHLPEGDQSKERTVRVTGDKK 330
Query: 356 QIEIAQEMIKEVLSQTVRPSTLSGGFNQQAYRPRVPTGPPQWGPRGSHPSQPMAYDYPQR 415
QIE+A+EMIKEV++Q VR ST G +NQQ YRPR PTGP QWGPRG HP QP YDY QR
Sbjct: 331 QIEMAREMIKEVMNQPVRSSTYPGSYNQQGYRPRGPTGPSQWGPRGPHPGQPTGYDY-QR 389
Query: 416 GPYPSQNPHYPHLPYGNYPPQQMAPRSNYGG------PPNMQG--AAGGYDYYGGQGGHV 467
G YPSQN Y YG YPPQQMAPRS++G P NMQG +GGYD+YGGQGGH
Sbjct: 390 GAYPSQNQQYAPPSYGGYPPQQMAPRSSFGSGWEQRPPANMQGPPQSGGYDFYGGQGGHG 449
Query: 468 SDRPVSVSHSTSIPGHPSVPAQAPAGGPPPSQANYNYGQPHTSEYGHQQPYAHAA-PQQG 526
D P + HS S+ H P+ +P GPPPSQ NYNYGQP +YG Q Y+ PQQG
Sbjct: 450 PDAPAAAPHSASMSIHAPGPSPSPGMGPPPSQGNYNYGQPQGPDYGQQAQYSQTGPPQQG 509
Query: 527 YGHGYD----DNHAPVQHPYGGHSNSQPVYSQGGLQSGY-HQHQYGKP-PYGMPAQGTQP 580
YGHGYD + AP PYGGH SQPVY QGG QSGY Q YGKP YGM +Q
Sbjct: 510 YGHGYDEPKYEGQAPTHPPYGGH-GSQPVYPQGGAQSGYPPQQPYGKPQSYGMASQAPAA 568
Query: 581 QSYGPPRPGQPGDIPPYQSQVPSAQSYGPNVPHQQQYPYATSGPTQQTYPSYGSAPAPDS 640
QSYGPPR QPGD+ PYQ + S QSYGPNVP QQYPYA+SGP QQ+YP+YGS PA D
Sbjct: 569 QSYGPPRASQPGDV-PYQGPMSSNQSYGPNVPP-QQYPYASSGPMQQSYPAYGSQPAADG 626
Query: 641 YNQP-PASAPGYPQQAGQAVPNYPQPGGQQAPSYGQVAPTAGYGQYTNTQQAYPEQPATS 699
YNQP PAS PGYPQQ GQ + Y QPGGQQAP Y QV P GYG Y +Q Y EQ +
Sbjct: 627 YNQPQPASGPGYPQQGGQPMSGYSQPGGQQAPGYAQVGPQGGYGPYP-SQPGYAEQQTAN 685
Query: 700 NAGYGYQGTQDPSYGSSAPGSAYAA-PTGQPGYAQPAATQPSYDQSA-SQSTAYGVAQGT 757
NA YGYQG+ DP+Y +S P SAY A P+GQPGY QP TQPSYDQS +QS YG T
Sbjct: 686 NAAYGYQGSADPTY-NSGPASAYGAQPSGQPGYVQPTPTQPSYDQSIPAQSGGYGAVPAT 744
Query: 758 AAAGYGKTVSPQPGYPQYDSTQMYAAPR 785
A GYGK++SPQPGYPQYD+TQMY A R
Sbjct: 745 APVGYGKSLSPQPGYPQYDATQMYGAHR 772
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255569106|ref|XP_002525522.1| nucleic acid binding protein, putative [Ricinus communis] gi|223535201|gb|EEF36880.1| nucleic acid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356495760|ref|XP_003516741.1| PREDICTED: uncharacterized protein LOC100800173 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357481253|ref|XP_003610912.1| Far upstream element-binding protein [Medicago truncatula] gi|355512247|gb|AES93870.1| Far upstream element-binding protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356538917|ref|XP_003537947.1| PREDICTED: uncharacterized protein LOC100786134 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224145055|ref|XP_002325510.1| predicted protein [Populus trichocarpa] gi|222862385|gb|EEE99891.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449447567|ref|XP_004141539.1| PREDICTED: uncharacterized protein LOC101203078 [Cucumis sativus] gi|449481514|ref|XP_004156205.1| PREDICTED: uncharacterized LOC101203078 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|145336377|ref|NP_174629.3| far upstream element-binding protein [Arabidopsis thaliana] gi|110739541|dbj|BAF01679.1| putative single-strand nucleic acid-binding protein [Arabidopsis thaliana] gi|110739658|dbj|BAF01737.1| putative single-strand nucleic acid-binding protein [Arabidopsis thaliana] gi|110739944|dbj|BAF01877.1| putative single-strand nucleic acid-binding protein [Arabidopsis thaliana] gi|332193492|gb|AEE31613.1| far upstream element-binding protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|22328551|ref|NP_192745.2| KH domain-containing protein [Arabidopsis thaliana] gi|332657435|gb|AEE82835.1| KH domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297813443|ref|XP_002874605.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297320442|gb|EFH50864.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 785 | ||||||
| TAIR|locus:2140513 | 725 | AT4G10070 "AT4G10070" [Arabido | 0.307 | 0.332 | 0.661 | 5.1e-122 | |
| TAIR|locus:2012713 | 763 | AT1G33680 "AT1G33680" [Arabido | 0.298 | 0.306 | 0.640 | 2.1e-103 | |
| TAIR|locus:2043530 | 632 | AT2G25970 "AT2G25970" [Arabido | 0.6 | 0.745 | 0.357 | 4.2e-63 | |
| UNIPROTKB|F6Y140 | 602 | KHSRP "Uncharacterized protein | 0.280 | 0.365 | 0.285 | 5.5e-24 | |
| UNIPROTKB|E2QVT3 | 743 | KHSRP "Uncharacterized protein | 0.280 | 0.296 | 0.285 | 1.3e-23 | |
| RGD|621828 | 721 | Khsrp "KH-type splicing regula | 0.280 | 0.305 | 0.289 | 4.2e-24 | |
| UNIPROTKB|F1MHR6 | 708 | LOC505564 "Uncharacterized pro | 0.280 | 0.310 | 0.285 | 1.7e-21 | |
| UNIPROTKB|Q92945 | 711 | KHSRP "Far upstream element-bi | 0.280 | 0.309 | 0.285 | 1.7e-21 | |
| UNIPROTKB|F1SBT6 | 747 | KHSRP "Uncharacterized protein | 0.280 | 0.294 | 0.285 | 2e-21 | |
| ZFIN|ZDB-GENE-040426-2159 | 642 | fubp1 "far upstream element (F | 0.281 | 0.344 | 0.322 | 3.1e-23 |
| TAIR|locus:2140513 AT4G10070 "AT4G10070" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 830 (297.2 bits), Expect = 5.1e-122, Sum P(3) = 5.1e-122
Identities = 162/245 (66%), Positives = 195/245 (79%)
Query: 201 SRKIEVPNNKVGVLIGKAGDTIRYLQYNSGAKIQITRDADADPHAATRPVEIIGTLSNID 260
+R+I+VP++KVGVLIGK G+TIRYLQ+NSGAKIQI RD++ADP +A RPVEIIG+++ I+
Sbjct: 177 TRRIDVPSSKVGVLIGKGGETIRYLQFNSGAKIQILRDSEADPSSALRPVEIIGSVACIE 236
Query: 261 KAEKLINAVIAEADAGGSPSLVARGLATAQASGAAEQVEIKVPNEKVGLIIGRGGETIKG 320
AEKLI+AVIAEA+AGGSP+LVARG + A G EQ+EIKVPN+KVGLIIGRGGETIK
Sbjct: 237 SAEKLISAVIAEAEAGGSPALVARGHPSTHAIGIPEQIEIKVPNDKVGLIIGRGGETIKN 296
Query: 321 LQTRSGARIQVLIPQHLPEGDGSKERIVRVTGDMRQIEIAQEMIKEVLSQTVRPSTLSGG 380
+QTRSGAR Q LIPQH EGDG KER VR++GD QI+IA +MIK+V++Q RPS+ SGG
Sbjct: 297 MQTRSGARTQ-LIPQHA-EGDGLKERTVRISGDKMQIDIATDMIKDVMNQNARPSSYSGG 354
Query: 381 FNQQAYRPRVPTGPPQWGPRGSHPSQPMAYDYPQRGPYPSQNPHYPHLPYGNYPPQQMAP 440
+NQ AYRP+ P GPPQWG RG H P YDY RGPY SQ +Y +G YPPQ M P
Sbjct: 355 YNQPAYRPQGPGGPPQWGSRGPHAPHP--YDYHPRGPYSSQGSYYNSPGFGGYPPQHMPP 412
Query: 441 RSNYG 445
R YG
Sbjct: 413 RGGYG 417
|
|
| TAIR|locus:2012713 AT1G33680 "AT1G33680" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043530 AT2G25970 "AT2G25970" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6Y140 KHSRP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QVT3 KHSRP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|621828 Khsrp "KH-type splicing regulatory protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MHR6 LOC505564 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q92945 KHSRP "Far upstream element-binding protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SBT6 KHSRP "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2159 fubp1 "far upstream element (FUSE) binding protein 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 785 | |||
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 6e-18 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 1e-17 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 2e-16 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 2e-13 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 4e-13 | |
| TIGR03665 | 172 | TIGR03665, arCOG04150, arCOG04150 universal archae | 6e-13 | |
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 7e-13 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 8e-13 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 6e-11 | |
| PRK13763 | 180 | PRK13763, PRK13763, putative RNA-processing protei | 7e-11 | |
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 5e-10 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 5e-08 | |
| COG1094 | 194 | COG1094, COG1094, Predicted RNA-binding protein (c | 1e-07 | |
| cd02393 | 61 | cd02393, PNPase_KH, Polynucleotide phosphorylase ( | 2e-07 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 3e-07 | |
| cd02394 | 62 | cd02394, vigilin_like_KH, K homology RNA-binding d | 9e-07 | |
| PRK11824 | 693 | PRK11824, PRK11824, polynucleotide phosphorylase/p | 9e-07 | |
| TIGR03927 | 150 | TIGR03927, T7SS_EssA_Firm, type VII secretion prot | 1e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-06 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 7e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-06 | |
| pfam07415 | 489 | pfam07415, Herpes_LMP2, Gammaherpesvirus latent me | 3e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 4e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 4e-05 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 8e-05 | |
| TIGR03665 | 172 | TIGR03665, arCOG04150, arCOG04150 universal archae | 1e-04 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 1e-04 | |
| pfam07650 | 77 | pfam07650, KH_2, KH domain | 1e-04 | |
| pfam13083 | 71 | pfam13083, KH_4, KH domain | 1e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-04 | |
| COG1185 | 692 | COG1185, Pnp, Polyribonucleotide nucleotidyltransf | 2e-04 | |
| cd02393 | 61 | cd02393, PNPase_KH, Polynucleotide phosphorylase ( | 4e-04 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 4e-04 | |
| PRK11824 | 693 | PRK11824, PRK11824, polynucleotide phosphorylase/p | 5e-04 | |
| PRK13763 | 180 | PRK13763, PRK13763, putative RNA-processing protei | 6e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 7e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-04 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 8e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 8e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 9e-04 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 0.001 | |
| PTZ00395 | 1560 | PTZ00395, PTZ00395, Sec24-related protein; Provisi | 0.001 | |
| COG0195 | 190 | COG0195, NusA, Transcription elongation factor [Tr | 0.001 | |
| TIGR00592 | 1172 | TIGR00592, pol2, DNA polymerase (pol2) | 0.001 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.002 | |
| cd02409 | 68 | cd02409, KH-II, KH-II (K homology RNA-binding doma | 0.002 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 0.004 | |
| COG1837 | 76 | COG1837, COG1837, Predicted RNA-binding protein (c | 0.004 | |
| PRK05896 | 605 | PRK05896, PRK05896, DNA polymerase III subunits ga | 0.004 |
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
Score = 78.1 bits (193), Expect = 6e-18
Identities = 30/73 (41%), Positives = 46/73 (63%), Gaps = 7/73 (9%)
Query: 296 EQVEIKVPNEKVGLIIGRGGETIKGLQTRSGARIQVLIPQHLPEGDGSKERIVRVTGDMR 355
+E+ +P +KVGLIIG+GG TIK ++ +G +I + G GS+ER+V +TG
Sbjct: 3 VTIEVLIPADKVGLIIGKGGSTIKKIEEETGVKIDI-------PGPGSEERVVEITGPPE 55
Query: 356 QIEIAQEMIKEVL 368
+E A E+I E+L
Sbjct: 56 NVEKAAELILEIL 68
|
Length = 68 |
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|211858 TIGR03665, arCOG04150, arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|237494 PRK13763, PRK13763, putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|224019 COG1094, COG1094, Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200340 TIGR03927, T7SS_EssA_Firm, type VII secretion protein EssA | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219404 pfam07415, Herpes_LMP2, Gammaherpesvirus latent membrane protein (LMP2) protein | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|211858 TIGR03665, arCOG04150, arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|203707 pfam07650, KH_2, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|221909 pfam13083, KH_4, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237494 PRK13763, PRK13763, putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|185594 PTZ00395, PTZ00395, Sec24-related protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223273 COG0195, NusA, Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|233037 TIGR00592, pol2, DNA polymerase (pol2) | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|239092 cd02409, KH-II, KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224750 COG1837, COG1837, Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|235638 PRK05896, PRK05896, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 785 | |||
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 100.0 | |
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 99.98 | |
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 99.95 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 99.85 | |
| KOG2190 | 485 | consensus PolyC-binding proteins alphaCP-1 and rel | 99.85 | |
| KOG2192 | 390 | consensus PolyC-binding hnRNP-K protein HRB57A/hnR | 99.81 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 99.81 | |
| KOG2192 | 390 | consensus PolyC-binding hnRNP-K protein HRB57A/hnR | 99.79 | |
| KOG2190 | 485 | consensus PolyC-binding proteins alphaCP-1 and rel | 99.75 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 99.74 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 99.73 | |
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 99.38 | |
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 99.31 | |
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 99.3 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 99.28 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 99.15 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 99.11 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 99.11 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 99.07 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 99.03 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 99.03 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 99.02 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 99.01 | |
| smart00322 | 69 | KH K homology RNA-binding domain. | 98.92 | |
| KOG2279 | 608 | consensus Kinase anchor protein AKAP149, contains | 98.91 | |
| KOG2279 | 608 | consensus Kinase anchor protein AKAP149, contains | 98.81 | |
| smart00322 | 69 | KH K homology RNA-binding domain. | 98.8 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 98.78 | |
| PF13014 | 43 | KH_3: KH domain | 98.69 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 98.66 | |
| PF13014 | 43 | KH_3: KH domain | 98.64 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 98.63 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 98.58 | |
| KOG2208 | 753 | consensus Vigilin [Lipid transport and metabolism] | 98.44 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 98.41 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 98.37 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 98.34 | |
| KOG2208 | 753 | consensus Vigilin [Lipid transport and metabolism] | 98.33 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 98.28 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 98.23 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 98.12 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 97.98 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 97.96 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 97.93 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 97.88 | |
| KOG1588 | 259 | consensus RNA-binding protein Sam68 and related KH | 97.84 | |
| KOG1588 | 259 | consensus RNA-binding protein Sam68 and related KH | 97.82 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 97.74 | |
| KOG3273 | 252 | consensus Predicted RNA-binding protein Pno1p inte | 97.68 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 97.68 | |
| PF14611 | 210 | SLS: Mitochondrial inner-membrane-bound regulator | 97.64 | |
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 97.56 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 97.51 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 97.5 | |
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 97.39 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 97.39 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 97.29 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 97.17 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 97.15 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 97.09 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 97.08 | |
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 97.03 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 97.01 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 96.96 | |
| KOG2814 | 345 | consensus Transcription coactivator complex, P50 c | 96.94 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 96.94 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 96.93 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 96.85 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 96.72 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 96.65 | |
| KOG2814 | 345 | consensus Transcription coactivator complex, P50 c | 96.6 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 96.56 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 96.55 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 96.54 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 96.51 | |
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 96.44 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 96.44 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 96.38 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 96.13 | |
| KOG1960 | 531 | consensus Predicted RNA-binding protein, contains | 95.94 | |
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 95.91 | |
| COG1782 | 637 | Predicted metal-dependent RNase, consists of a met | 95.86 | |
| cd02410 | 145 | archeal_CPSF_KH The archaeal cleavage and polyaden | 95.48 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 95.19 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 94.9 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 94.82 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 94.62 | |
| PRK02821 | 77 | hypothetical protein; Provisional | 94.57 | |
| PRK02821 | 77 | hypothetical protein; Provisional | 94.5 | |
| KOG1960 | 531 | consensus Predicted RNA-binding protein, contains | 94.22 | |
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 93.94 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 93.93 | |
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 93.91 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 93.79 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 93.64 | |
| PF14611 | 210 | SLS: Mitochondrial inner-membrane-bound regulator | 93.43 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 93.4 | |
| KOG3273 | 252 | consensus Predicted RNA-binding protein Pno1p inte | 93.22 | |
| TIGR03675 | 630 | arCOG00543 arCOG00543 universal archaeal KH-domain | 93.06 | |
| PRK06418 | 166 | transcription elongation factor NusA-like protein; | 92.15 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 91.7 | |
| cd02410 | 145 | archeal_CPSF_KH The archaeal cleavage and polyaden | 91.63 | |
| KOG2874 | 356 | consensus rRNA processing protein [Translation, ri | 91.36 | |
| PF13083 | 73 | KH_4: KH domain; PDB: 3GKU_B. | 91.3 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 91.24 | |
| PF13083 | 73 | KH_4: KH domain; PDB: 3GKU_B. | 90.16 | |
| cd02413 | 81 | 40S_S3_KH K homology RNA-binding (KH) domain of th | 90.09 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 89.53 | |
| PF13184 | 69 | KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW | 89.1 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 88.96 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 88.84 | |
| PF13184 | 69 | KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW | 88.29 | |
| PRK13764 | 602 | ATPase; Provisional | 88.2 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 88.01 | |
| cd02414 | 77 | jag_KH jag_K homology RNA-binding domain. The KH d | 87.46 | |
| TIGR03802 | 562 | Asp_Ala_antiprt aspartate-alanine antiporter. All | 87.45 | |
| cd02414 | 77 | jag_KH jag_K homology RNA-binding domain. The KH d | 87.26 | |
| COG0092 | 233 | RpsC Ribosomal protein S3 [Translation, ribosomal | 86.39 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 86.23 | |
| TIGR03675 | 630 | arCOG00543 arCOG00543 universal archaeal KH-domain | 85.55 | |
| PRK03818 | 552 | putative transporter; Validated | 85.06 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 85.01 | |
| PF07650 | 78 | KH_2: KH domain syndrome, contains KH motifs.; Int | 84.87 | |
| PRK13764 | 602 | ATPase; Provisional | 84.13 | |
| cd02412 | 109 | 30S_S3_KH K homology RNA-binding (KH) domain of th | 83.71 | |
| KOG2874 | 356 | consensus rRNA processing protein [Translation, ri | 83.55 | |
| PRK06418 | 166 | transcription elongation factor NusA-like protein; | 82.53 | |
| COG1782 | 637 | Predicted metal-dependent RNase, consists of a met | 81.55 |
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.4e-41 Score=376.74 Aligned_cols=351 Identities=29% Similarity=0.434 Sum_probs=237.8
Q ss_pred CCcCceecc-cccchhhHHhhhcCCCchHHHHhhcCCcchhhccchhhhhccccccccCCccccCCCcCcCCCCCCCCCc
Q 003933 1 MAEEEVLAP-ASAAAADLKRKLDDLEPDEALEHAEGMRDDEAKNSDEVEKNVDGFAEAHGSEVKRPRLDDDKTEKPDGPV 79 (785)
Q Consensus 1 maee~~~~~-~~~~~~d~krkl~~le~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~kr~~~dd~~~~~~d~l~ 79 (785)
|+||.++++ ......++||+|+.+|.|.-+.-. +.++++-+.+++..-+|++-.+|.+|.|+.. +|.
T Consensus 1 m~~~~q~~~~~~~~~~~~~r~~~~~ele~~~~p~--------~~~~~~~~l~p~~~~s~~~~~~~~~VPd~~V----glv 68 (600)
T KOG1676|consen 1 MNEERQIAIKIYPIDGKYKRKLQSRELEDGPQPF--------KGPSEDTDLDPDMDPSDTVQTERYKVPDEAV----GLV 68 (600)
T ss_pred CCccceeeeeccCcccccccccCCccccccCccc--------cCCCCccccCcccCCcccccccccCCCchhc----eeE
Confidence 899999999 555556799999998888211111 2333342233334668899999999999984 443
Q ss_pred c-ccCccC-----CCCcc-------cc------ccccccccccchhhhhhhhccccC-------CChh----hhh----h
Q 003933 80 N-VNGLKE-----EKPDE-------VV------DAEQLTEDTTKEEELESAEVKTEQ-------HSSV----EEQ----A 125 (785)
Q Consensus 80 ~-~~~~~~-----~k~~e-------~~------~e~~~~e~v~~~s~d~See~~~~~-------~~~e----~~~----~ 125 (785)
+ +++-.. +.... .. +.+...|.|++.+. -..+..+.. .... +.+ +
T Consensus 69 IGrgG~qI~~iqq~SgCrvq~~~~~s~~~~r~~~~~G~pe~v~~aK~-li~evv~r~~~~~~~~~~q~~~~ttqeI~IPa 147 (600)
T KOG1676|consen 69 IGRGGSQIQAIQQKSGCRVQIAADPSGIGYRSVDLTGSPENVEVAKQ-LIGEVVSRGRPPGGFPDNQGSVETTQEILIPA 147 (600)
T ss_pred eeccHHHhhhhhhhcCCccccCCCCCCcccccccccCCcccHHHHHH-hhhhhhhccCCCCCccccCCccceeeeeccCc
Confidence 2 111110 00000 00 11111111110000 000000000 0000 000 0
Q ss_pred ccccccccccchhhhhcc-cchhhhhccccccccc-cccccccccchhhhhhhcccchhhhccCCCCCC------CCCCC
Q 003933 126 SVDNQQISVKEETKEVLF-STEEAFIDVKEETKEV-TVKEEETVKEEESVEPSNVVPQQVVDNSKSDDP------SSTDD 197 (785)
Q Consensus 126 ~~~~ke~~~~ee~k~~~~-s~~~~~~~~~e~~~~d-s~k~~~i~g~~esVE~A~~lI~~ii~~~~~~~p------~~~~~ 197 (785)
..+..=|.+..|+..... -++|.+.++.+....+ ..|++.|+++.+.||.|+.|+.++|.++....+ .....
T Consensus 148 ~k~GlIIGKgGETikqlqe~sg~k~i~iqd~~~~~~~~KplritGdp~~ve~a~~lV~dil~e~~~~~~g~~~~~g~~~g 227 (600)
T KOG1676|consen 148 NKCGLIIGKGGETIKQLQEQSGVKMILVQDGSIATGADKPLRITGDPDKVEQAKQLVADILREEDDEVPGSGGHAGVRGG 227 (600)
T ss_pred cceeeEeccCccHHHHHHhhcCCceEEEecCCcCCCCCCceeecCCHHHHHHHHHHHHHHHHhcccCCCccccccCcCcc
Confidence 011111333344444443 2346667777766666 689999999999999999999999974322221 22334
Q ss_pred CCeEEEEEecCCccceeecCCchHHHHHHHHhCCeEEEccCCCCCCCCCCcceEecccHHHHHHHHHHHHHHHHhhccCC
Q 003933 198 STMSRKIEVPNNKVGVLIGKAGDTIRYLQYNSGAKIQITRDADADPHAATRPVEIIGTLSNIDKAEKLINAVIAEADAGG 277 (785)
Q Consensus 198 ~~~t~~IlVP~~~VG~IIGk~G~tIK~IqeeTGAkI~I~k~~d~~p~s~eRiV~I~Gt~e~V~kA~~lI~elI~e~~~gg 277 (785)
...+++|.||++.||.||||+|+|||+|+.+||+||+|..|++ +.+.+|++.|.|+++.|.+|.+||++||++...+.
T Consensus 228 ~~~~~~V~VPr~~VG~IIGkgGE~IKklq~etG~KIQfkpDd~--p~speR~~~IiG~~d~ie~Aa~lI~eii~~~~~~~ 305 (600)
T KOG1676|consen 228 GSATREVKVPRSKVGIIIGKGGEMIKKLQNETGAKIQFKPDDD--PSSPERPAQIIGTVDQIEHAAELINEIIAEAEAGA 305 (600)
T ss_pred ccceeEEeccccceeeEEecCchHHHHHhhccCceeEeecCCC--CCCccceeeeecCHHHHHHHHHHHHHHHHHHhccC
Confidence 5569999999999999999999999999999999999998754 57889999999999999999999999999876431
Q ss_pred CCcccccccchhhccCCccEEEEEecCCccceeecCCchHHHHHHHHhCCeEEEecCCCCCCCCCCCccEEEEEcCHHHH
Q 003933 278 SPSLVARGLATAQASGAAEQVEIKVPNEKVGLIIGRGGETIKGLQTRSGARIQVLIPQHLPEGDGSKERIVRVTGDMRQI 357 (785)
Q Consensus 278 ~p~~~~~g~~~~~~~~~~~~~~i~VP~~~vG~VIGKgGetIK~Iq~~TGArIqI~i~~~lP~~~~s~er~VtIsG~~eqV 357 (785)
... ...|.. .....+.|.||.+|||+||||+|+|||.|.++|||||+ |+.+ ++..+.++|+|+|+|+..+|
T Consensus 306 ~~~-~~~G~P-----~~~~~fy~~VPa~KcGLvIGrGGEtIK~in~qSGA~~e-l~r~--~p~~~~~ektf~IrG~~~QI 376 (600)
T KOG1676|consen 306 GGG-MGGGAP-----GLVAQFYMKVPADKCGLVIGRGGETIKQINQQSGARCE-LSRQ--PPNGNPKEKTFVIRGDKRQI 376 (600)
T ss_pred CCC-cCCCCc-----cceeeEEEeccccccccccCCCccchhhhcccCCcccc-ccCC--CCCCCccceEEEEecCcccc
Confidence 111 111111 12237899999999999999999999999999999999 5655 57788999999999999999
Q ss_pred HHHHHHHHHHHhcccCCC
Q 003933 358 EIAQEMIKEVLSQTVRPS 375 (785)
Q Consensus 358 e~Ak~lI~~ll~~~~r~~ 375 (785)
++|++||+++|.....+.
T Consensus 377 dhAk~LIr~kvg~~~~n~ 394 (600)
T KOG1676|consen 377 DHAKQLIRDKVGDIAPNT 394 (600)
T ss_pred hHHHHHHHHHhcccCCCC
Confidence 999999999998765554
|
|
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2208 consensus Vigilin [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >KOG2208 consensus Vigilin [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF14611 SLS: Mitochondrial inner-membrane-bound regulator | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1960 consensus Predicted RNA-binding protein, contains KH domains [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1960 consensus Predicted RNA-binding protein, contains KH domains [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14611 SLS: Mitochondrial inner-membrane-bound regulator | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein | Back alignment and domain information |
|---|
| >PRK06418 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG2874 consensus rRNA processing protein [Translation, ribosomal structure and biogenesis; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13083 KH_4: KH domain; PDB: 3GKU_B | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF13083 KH_4: KH domain; PDB: 3GKU_B | Back alignment and domain information |
|---|
| >cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd02414 jag_KH jag_K homology RNA-binding domain | Back alignment and domain information |
|---|
| >TIGR03802 Asp_Ala_antiprt aspartate-alanine antiporter | Back alignment and domain information |
|---|
| >cd02414 jag_KH jag_K homology RNA-binding domain | Back alignment and domain information |
|---|
| >COG0092 RpsC Ribosomal protein S3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein | Back alignment and domain information |
|---|
| >PRK03818 putative transporter; Validated | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >PF07650 KH_2: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >cd02412 30S_S3_KH K homology RNA-binding (KH) domain of the prokaryotic 30S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
| >KOG2874 consensus rRNA processing protein [Translation, ribosomal structure and biogenesis; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK06418 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 785 | ||||
| 2ann_A | 178 | Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDE | 3e-13 | ||
| 2anr_A | 178 | Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TAND | 3e-13 | ||
| 2jvz_A | 164 | Solution Nmr Structure Of The Second And Third Kh D | 7e-12 | ||
| 1j4w_A | 174 | Complex Of The Kh3 And Kh4 Domains Of Fbp With A Si | 8e-09 | ||
| 1j4w_A | 174 | Complex Of The Kh3 And Kh4 Domains Of Fbp With A Si | 3e-04 | ||
| 1x4m_A | 94 | Solution Structure Of Kh Domain In Far Upstream Ele | 4e-07 | ||
| 2jzx_A | 160 | Pcbp2 Kh1-Kh2 Domains Length = 160 | 6e-06 | ||
| 1x4n_A | 92 | Solution Structure Of Kh Domain In Fuse Binding Pro | 6e-06 | ||
| 1x4n_A | 92 | Solution Structure Of Kh Domain In Fuse Binding Pro | 1e-04 | ||
| 2opu_A | 89 | Solution Nmr Structure Of The First Domain Of Ksrp | 1e-05 | ||
| 2opu_A | 89 | Solution Nmr Structure Of The First Domain Of Ksrp | 1e-05 | ||
| 2opv_A | 85 | Solution Nmr Structure Of The Second Domain Of Ksrp | 1e-05 | ||
| 1we8_A | 104 | Solution Structure Of Kh Domain In Protein Bab28342 | 1e-04 | ||
| 3krm_A | 163 | Imp1 Kh34 Length = 163 | 2e-04 | ||
| 2hh2_A | 107 | Solution Structure Of The Fourth Kh Domain Of Ksrp | 2e-04 | ||
| 2p2r_A | 76 | Crystal Structure Of The Third Kh Domain Of Human P | 2e-04 | ||
| 1wvn_A | 82 | Crsytal Structure Of Domain 3 Of Human Alpha Polyc | 4e-04 | ||
| 1j5k_A | 89 | Complex Of The Kh3 Domain Of Hnrnp K With A Single_ | 4e-04 | ||
| 2e3u_A | 219 | Crystal Structure Analysis Of Dim2p From Pyrococcus | 4e-04 | ||
| 1zzi_A | 82 | Crystal Structure Analysis Of The Third Kh Domain O | 7e-04 | ||
| 1dt4_A | 73 | Crystal Structure Of Nova-1 Kh3 K-Homology Rna-Bind | 8e-04 | ||
| 3vke_A | 76 | Contribution Of The First K-Homology Domain Of Poly | 8e-04 |
| >pdb|2ANN|A Chain A, Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25 NT RNA Hairpin Length = 178 | Back alignment and structure |
|
| >pdb|2ANR|A Chain A, Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25NT RNA Hairpin Length = 178 | Back alignment and structure |
| >pdb|2JVZ|A Chain A, Solution Nmr Structure Of The Second And Third Kh Domains Of Ksrp Length = 164 | Back alignment and structure |
| >pdb|1J4W|A Chain A, Complex Of The Kh3 And Kh4 Domains Of Fbp With A Single_stranded 29mer Dna Oligonucleotide From The Fuse Element Of The C-Myc Oncogene Length = 174 | Back alignment and structure |
| >pdb|1J4W|A Chain A, Complex Of The Kh3 And Kh4 Domains Of Fbp With A Single_stranded 29mer Dna Oligonucleotide From The Fuse Element Of The C-Myc Oncogene Length = 174 | Back alignment and structure |
| >pdb|1X4M|A Chain A, Solution Structure Of Kh Domain In Far Upstream Element Binding Protein 1 Length = 94 | Back alignment and structure |
| >pdb|2JZX|A Chain A, Pcbp2 Kh1-Kh2 Domains Length = 160 | Back alignment and structure |
| >pdb|1X4N|A Chain A, Solution Structure Of Kh Domain In Fuse Binding Protein 1 Length = 92 | Back alignment and structure |
| >pdb|1X4N|A Chain A, Solution Structure Of Kh Domain In Fuse Binding Protein 1 Length = 92 | Back alignment and structure |
| >pdb|2OPU|A Chain A, Solution Nmr Structure Of The First Domain Of Ksrp Length = 89 | Back alignment and structure |
| >pdb|2OPU|A Chain A, Solution Nmr Structure Of The First Domain Of Ksrp Length = 89 | Back alignment and structure |
| >pdb|2OPV|A Chain A, Solution Nmr Structure Of The Second Domain Of Ksrp Length = 85 | Back alignment and structure |
| >pdb|1WE8|A Chain A, Solution Structure Of Kh Domain In Protein Bab28342 Length = 104 | Back alignment and structure |
| >pdb|3KRM|A Chain A, Imp1 Kh34 Length = 163 | Back alignment and structure |
| >pdb|2HH2|A Chain A, Solution Structure Of The Fourth Kh Domain Of Ksrp Length = 107 | Back alignment and structure |
| >pdb|2P2R|A Chain A, Crystal Structure Of The Third Kh Domain Of Human Poly(C)- Binding Protein-2 In Complex With C-Rich Strand Of Human Telomeric Dna Length = 76 | Back alignment and structure |
| >pdb|1WVN|A Chain A, Crsytal Structure Of Domain 3 Of Human Alpha Polyc Binding Protein Length = 82 | Back alignment and structure |
| >pdb|1J5K|A Chain A, Complex Of The Kh3 Domain Of Hnrnp K With A Single_stranded 10mer Dna Oligonucleotide Length = 89 | Back alignment and structure |
| >pdb|2E3U|A Chain A, Crystal Structure Analysis Of Dim2p From Pyrococcus Horikoshii Ot3 Length = 219 | Back alignment and structure |
| >pdb|1ZZI|A Chain A, Crystal Structure Analysis Of The Third Kh Domain Of Hnrnp K In Complex With Ssdna Length = 82 | Back alignment and structure |
| >pdb|1DT4|A Chain A, Crystal Structure Of Nova-1 Kh3 K-Homology Rna-Binding Domain Length = 73 | Back alignment and structure |
| >pdb|3VKE|A Chain A, Contribution Of The First K-Homology Domain Of Poly(C)-Binding Protein 1 To Its Affinity And Specificity For C-Rich Oligonucleotides Length = 76 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
Score = 160 bits (405), Expect = 1e-45
Identities = 55/175 (31%), Positives = 85/175 (48%), Gaps = 5/175 (2%)
Query: 198 STMSRKIEVPNNKVGVLIGKAGDTIRYLQYNSGAKIQITRDADADPHAATRPVEIIGTLS 257
S K+ +P+ G +IGK G TI LQ +GA I++++ D P R I GT+
Sbjct: 4 SQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTIE 63
Query: 258 NIDKAEKLINAVIAEADAGGSPSLVARGLATAQASG--AAEQVEIKVPNEKVGLIIGRGG 315
++ I I E + + L A QV+I VPN GLIIG+GG
Sbjct: 64 ALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRANQVKIIVPNSTAGLIIGKGG 123
Query: 316 ETIKGLQTRSGARIQVLIPQHLPEGDGSKERIVRVTGDMRQIEIAQEMIKEVLSQ 370
T+K + +SGA +Q+ P+G + R+V V+G+ Q A E+I + + +
Sbjct: 124 ATVKAIMEQSGAWVQL---SQKPDGINLQNRVVTVSGEPEQNRKAVELIIQKIQE 175
|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Length = 630 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 102 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 102 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Length = 144 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 785 | |||
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.94 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.94 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.93 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.93 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.93 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 99.79 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 99.75 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 99.71 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 99.68 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 99.48 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 99.48 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 99.47 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 99.46 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 99.46 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 99.45 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 99.43 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 99.43 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 99.43 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 99.43 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 99.43 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 99.42 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 99.42 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 99.41 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 99.41 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 99.4 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 99.4 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 99.4 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 99.39 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 99.39 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 99.39 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 99.38 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 99.38 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 99.38 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 99.37 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 99.36 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 99.35 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.32 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 99.31 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.31 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 99.31 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 99.31 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.31 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.3 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 99.29 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.29 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.28 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 99.26 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 99.26 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 99.23 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 99.21 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 99.2 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.19 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 99.19 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 99.17 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.09 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 98.97 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 98.89 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 98.86 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 98.85 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 98.84 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 98.83 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 98.76 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 98.69 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 98.64 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 98.48 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 98.44 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 98.4 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 98.32 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 98.1 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 98.1 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 97.91 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 97.86 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 97.85 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 97.82 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 97.42 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 96.99 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 96.9 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 96.87 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 96.58 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 96.45 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 96.27 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 95.96 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 88.29 | |
| 4hhu_A | 170 | OR280; engineered protein, PSI-biology, structural | 84.32 | |
| 1wh9_A | 92 | 40S ribosomal protein S3; KH domain, structural ge | 84.03 | |
| 2pt7_G | 152 | HP1451, hypothetical protein; ATPase, protein-prot | 83.09 | |
| 3gku_A | 225 | Probable RNA-binding protein; APC21302, clostridiu | 81.56 | |
| 2pt7_G | 152 | HP1451, hypothetical protein; ATPase, protein-prot | 80.5 |
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
Probab=99.94 E-value=2.9e-27 Score=234.88 Aligned_cols=172 Identities=31% Similarity=0.461 Sum_probs=135.4
Q ss_pred CCCeEEEEEecCCccceeecCCchHHHHHHHHhCCeEEEccCCCCCCCCCCcceEecccHHHHHHHHHHHHHHHHhhccC
Q 003933 197 DSTMSRKIEVPNNKVGVLIGKAGDTIRYLQYNSGAKIQITRDADADPHAATRPVEIIGTLSNIDKAEKLINAVIAEADAG 276 (785)
Q Consensus 197 ~~~~t~~IlVP~~~VG~IIGk~G~tIK~IqeeTGAkI~I~k~~d~~p~s~eRiV~I~Gt~e~V~kA~~lI~elI~e~~~g 276 (785)
...++++|+||.+++|.||||+|++||+|+++|||+|+|.++.+..+++.+|+|+|+|+.++|.+|+.+|.++|++....
T Consensus 3 ~~~~~~~i~vp~~~ig~iIGkgG~~Ik~i~~~tg~~I~i~~~~~~~~~~~er~v~I~G~~~~v~~A~~~I~~~~~~~~~~ 82 (178)
T 2anr_A 3 GSQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTIEALNAVHGFIAEKIREMPQN 82 (178)
T ss_dssp CCCEEEEEEEEHHHHHHHHCGGGHHHHHHHHHHCCEEEECCTTCBCTTSSEEEEEEEECHHHHHHHHHHHHHHHTCCCCC
T ss_pred CCCEEEEEEEChhHeeeeECCCcHHHHHHHHHhCCeEEEecCCCCCCCCCCceEEEEeCHHHHHHHHHHHHHHHhccCCc
Confidence 34689999999999999999999999999999999999987666667788999999999999999999999999875321
Q ss_pred CCCcccccccch--hhccCCccEEEEEecCCccceeecCCchHHHHHHHHhCCeEEEecCCCCCCCCCCCccEEEEEcCH
Q 003933 277 GSPSLVARGLAT--AQASGAAEQVEIKVPNEKVGLIIGRGGETIKGLQTRSGARIQVLIPQHLPEGDGSKERIVRVTGDM 354 (785)
Q Consensus 277 g~p~~~~~g~~~--~~~~~~~~~~~i~VP~~~vG~VIGKgGetIK~Iq~~TGArIqI~i~~~lP~~~~s~er~VtIsG~~ 354 (785)
.........+.+ ........+++|+||.+++|+||||+|++||+|+++|||+|+| ..+. .+..+.+|+|+|+|+.
T Consensus 83 ~~~~~~~~~~~~~~~~~~~~~~~~~i~Vp~~~vg~iIGkgG~~Ik~i~~~tga~I~i-~~~~--~~~~~~~~~v~I~G~~ 159 (178)
T 2anr_A 83 VAKTEPVSILQPQTTVNPDRANQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQL-SQKP--DGINLQNRVVTVSGEP 159 (178)
T ss_dssp -----------------CGGGGEEEEEEEHHHHHHHHCGGGHHHHHHHHHSSCEEEE-CCCC------CCEEEEEEESSH
T ss_pred cccCCcccccCCccCCCCCCceEEEEEEchhheeeeECCCcHHHHHHHHHHCCEEEE-eCCC--CCCCCCceEEEEEcCH
Confidence 110000000000 0011234688999999999999999999999999999999995 3221 2235678999999999
Q ss_pred HHHHHHHHHHHHHHhcc
Q 003933 355 RQIEIAQEMIKEVLSQT 371 (785)
Q Consensus 355 eqVe~Ak~lI~~ll~~~ 371 (785)
++|++|++||.++|++.
T Consensus 160 ~~v~~A~~~I~~~i~e~ 176 (178)
T 2anr_A 160 EQNRKAVELIIQKIQED 176 (178)
T ss_dssp HHHHHHHHHHHHHHHSC
T ss_pred HHHHHHHHHHHHHHHhC
Confidence 99999999999999763
|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >4hhu_A OR280; engineered protein, PSI-biology, structural genomi unknown function; HET: AE4 PG4; 2.00A {Synthetic construct} | Back alignment and structure |
|---|
| >1wh9_A 40S ribosomal protein S3; KH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ribosome; NMR {Homo sapiens} SCOP: d.52.3.1 | Back alignment and structure |
|---|
| >2pt7_G HP1451, hypothetical protein; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3gku_A Probable RNA-binding protein; APC21302, clostridium symbiosum ATCC 14 structural genomics, PSI-2, protein structure initiative; 2.95A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >2pt7_G HP1451, hypothetical protein; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 785 | ||||
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 7e-21 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 7e-18 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 7e-21 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 5e-20 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 6e-19 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 1e-18 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 1e-18 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 7e-16 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 1e-18 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 1e-18 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 8e-17 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 9e-16 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 1e-16 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 5e-16 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 1e-16 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 1e-15 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 6e-16 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 8e-14 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 9e-16 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 7e-15 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 9e-16 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 3e-15 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 3e-15 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 7e-14 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 4e-15 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 1e-14 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 5e-15 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 2e-14 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 4e-13 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 4e-12 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 1e-12 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 3e-11 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 1e-11 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 5e-10 | |
| d2je6i3 | 69 | d.51.1.1 (I:153-221) Exosome complex RNA-binding p | 2e-11 | |
| d2je6i3 | 69 | d.51.1.1 (I:153-221) Exosome complex RNA-binding p | 3e-11 | |
| d2z0sa2 | 87 | d.51.1.1 (A:148-234) Exosome complex RNA-binding p | 4e-11 | |
| d2z0sa2 | 87 | d.51.1.1 (A:148-234) Exosome complex RNA-binding p | 5e-11 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 1e-08 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 2e-07 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 3e-07 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 3e-06 | |
| d1tuaa2 | 104 | d.51.1.1 (A:85-188) Hypothetical protein APE0754 { | 4e-07 | |
| d1tuaa2 | 104 | d.51.1.1 (A:85-188) Hypothetical protein APE0754 { | 1e-06 | |
| d2ctfa1 | 90 | d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T | 4e-07 | |
| d2ctfa1 | 90 | d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T | 1e-04 |
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Far upstream binding element, FBP species: Human (Homo sapiens) [TaxId: 9606]
Score = 84.9 bits (210), Expect = 7e-21
Identities = 26/73 (35%), Positives = 45/73 (61%), Gaps = 2/73 (2%)
Query: 296 EQVEIKVPNEKVGLIIGRGGETIKGLQTRSGARIQVLIPQHLPEGDGSKERIVRVTGDMR 355
++ VP K GLIIG+GGETIK + +SGARI+ + ++ P ++ + G +
Sbjct: 1 QEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIE--LQRNPPPNADPNMKLFTIRGTPQ 58
Query: 356 QIEIAQEMIKEVL 368
QI+ A+++I+E +
Sbjct: 59 QIDYARQLIEEKI 71
|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 785 | |||
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 99.55 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 99.53 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.52 | |
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 99.5 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.5 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 99.5 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 99.5 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.48 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 99.47 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 99.47 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.47 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.46 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 99.45 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 99.45 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.44 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 99.43 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 99.42 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 99.4 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.33 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.31 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.28 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.27 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.26 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.23 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.21 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 99.21 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.2 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.17 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 99.16 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.15 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.07 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 99.05 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 99.01 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.89 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 98.82 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 98.76 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 98.73 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.72 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 98.69 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.67 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 98.57 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 98.48 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 98.44 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 98.34 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.34 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 98.23 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 98.22 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 94.84 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 94.65 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 93.94 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 92.59 | |
| d1wh9a_ | 92 | Ribosomal protein S3 N-terminal domain {Mouse (Mus | 91.88 | |
| d2ja9a2 | 85 | Ribosomal RNA-processing protein 40, RRP40 {Saccha | 89.17 | |
| d2ja9a2 | 85 | Ribosomal RNA-processing protein 40, RRP40 {Saccha | 82.89 | |
| d2uubc1 | 105 | Ribosomal protein S3 N-terminal domain {Thermus th | 80.87 | |
| d1o4ua2 | 103 | Quinolinic acid phosphoribosyltransferase (Nicotin | 80.72 |
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Far upstream binding element, FBP species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.55 E-value=2.9e-15 Score=125.39 Aligned_cols=70 Identities=36% Similarity=0.632 Sum_probs=61.4
Q ss_pred EEEEEecCCccceeecCCchHHHHHHHHhCCeEEEecCCCCCCCCCCCccEEEEEcCHHHHHHHHHHHHHHH
Q 003933 297 QVEIKVPNEKVGLIIGRGGETIKGLQTRSGARIQVLIPQHLPEGDGSKERIVRVTGDMRQIEIAQEMIKEVL 368 (785)
Q Consensus 297 ~~~i~VP~~~vG~VIGKgGetIK~Iq~~TGArIqI~i~~~lP~~~~s~er~VtIsG~~eqVe~Ak~lI~~ll 368 (785)
+++|.||++++|+||||+|++||+|+++|||+|+| ..+.. ....+.+|+|+|+|++++|++|++||.++|
T Consensus 2 ~~~~~IP~~~vg~IIGk~G~~Ik~I~~~sga~I~i-~~~~~-~~~~~~~r~v~I~G~~~~v~~A~~~I~e~i 71 (71)
T d1j4wa2 2 EFNFIVPTGKTGLIIGKGGETIKSISQQSGARIEL-QRNPP-PNADPNMKLFTIRGTPQQIDYARQLIEEKI 71 (71)
T ss_dssp EEEEEEETTTHHHHHCGGGHHHHHHHHHHCCEEEE-ECCCT-TTSCTTEEEEEEECCHHHHHHHHHHHHHHC
T ss_pred EEEEEEChHhcceEECCCCcChHHHHhhcCcEEEE-eecCC-CCCCCCeEEEEEEeCHHHHHHHHHHHHhhC
Confidence 57899999999999999999999999999999995 33332 344567899999999999999999999875
|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2uubc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1o4ua2 d.41.2.1 (A:1-103) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|