Citrus Sinensis ID: 003945

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780----

MNILQISFDGLQDSEKKIFLDVACFFKRWDRDYVAKILEGCGFSPVIGIEVLIERSLLTVDDYNTLGMHNSLQELGQLIVTRQSPEEPGKRSRLWRQEEVRHVLRKNTVHLSAKAFSLMTNLGLLKINNVQLLEGLEYLSNKLRLLDWHRYPLKSLPSNLQLDKIVEFKMCYSRIEELWKGIKHLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQFLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVSDPLKDFSTVIPGSKIPKWFMYQNEGSSITVTRPSYLYNMNKIVGYAICCVFHVPRHSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSPRECYDRRWIFESNHFKLSFNDAREKYDMAGSGTGLKVKRCGFHPVYMHEVEELDQTTKQWTHFTSYNLYESDHDFLDQIWK

ccEEEEEccccccccccEEEEEEEccccccHHHHHHHHHHcccccccHHHHHcccccEEEcccccEEEcHHHHHHHHHHHHcccccccccccccccHHHHHHHHccccccccHHHHHcccccccEEEcccEEccccccccccccEEEEcccccccccccccccccEEEEccccccHHccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccccccccEEEccccccccccccccccccccEEEEccccccEEccccccccccccEEEcccccccccccccccccccccEEEEccccccccccccccccccccEEcccccccccccccccccccccEEEEccccccEEccccccccccccEEEEccccccccccccccccccccEEEccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccEEccHHHHccccccEEEccccccccccccccccccEEEEcccEEcEEEcccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccccccccEEEEEcccccccccccEEEEEEEEEEcccccccccccccEEEEEEEEccccccEEEEEccccccccccEEEEEEEcccccccccccccccEEEEEEEccccEEEccccccccEEEEEEEEEEcccccccccccccccccccccccccccccccccccc

ccEEEEEcccccHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHcEEEEEcccccEEHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHccccccccHHHHHHHcccEEEEEEccccccccccccHHcEEEEEcccccccccccccHHHEEEEEccccHHHHHccccccccccEEEEcccccccccccccccccccHEEEccccccccccccccccHHHHccccccEEEEcccccHHHcccHHHcccccccEEEccccccccccccHccccccEEEEcccccccccccccHccHHcccEEEcccccHHHHccHHHcccccccEEEccccccEEccccHHHHHcccEEEccccccHccccccHcccHcccEEEcccccHHHcccHHHccHccccEEEccccccccccccHHHHHcccEEEccccccccccccccccccEEEEEccccccccccccccccccccEEcccccHHHHccccccHcccccccEEEcccccccccccHHHHHHHccEEEccccHHHcccccccccccEEEccccccccccccccccccHHHHHccHHHHHHHccccHHHHHHHHHHHHHccccccccEEEEccccccHHEcccccccEEEEEccccccccccccEEEEEEEEEccccccccccccEEEEEEEEEcccccEEEcccccccccccccEEEEEEEccccccccccccccccEEEEEEEEEEEEEcccccccEEEEEcEEEEEEEcccccccccccccccccccccccccccHHHHHHc

MNILQISFDGLQDSEKKIFLDVACFFKRWDRDYVAKILegcgfspviGIEVLIERSlltvddyntlgmhNSLQELGQLIvtrqspeepgkrsrlWRQEEVRHVLRKNTVHLSAKAFSLMTNLGLLKINNVQLLEGLEYLSNKLRlldwhryplkslpsnlqldkIVEFKMCYSRIEELWKGIKHLNMLKVMKLshsenliktpdfteapnleelYLEGCTKLrkvhpslllhnKLIFVESLKILILSGClklrkfphvvgSMECLQELLldgtdikelplSIEHLFGLVQLTlndcknlsslpvAISSFQCLrnlklsgcsklkkfPQIVTTMEdlselnldgtsitevpssiellpglellnlndcknfarvpssinglkslktlnlsgccklenvpdtlgqvesleeldisetavrrppssvFLMKNLRtlsfsgcngppssaswhlhlpfnlmgKSSCLVALMlpslsglrsltkldlsdcglgegaipsdignlhSLNELYlsknnfvtLPASINSLLNLKELEMEDckrlqflpqlppniifVKVNGCSSLVTLLGALKLCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVsdplkdfstvipgskipkwfmyqnegssitvtrpsylynMNKIVGYAICCvfhvprhstrikkrrhsyelqccmdgsdrgffitfggkfshsgsdhlwllflsprecydrrwifesnhfklsfndarekydmagsgtglkvkrcgfhpvymhEVEELDQTTKQWTHFtsynlyesdhDFLDQIWK

mnilqisfdglqdseKKIFLDVACFFKRWDRDYVAKILEGCGFSPVIGIEVLIERSLLTVDDYNTLGMHNSLQELGQLIvtrqspeepgkrsrlwrqeeVRHVLRKNTVHLSAKAFSLMTNLGLLKINNVQLLEGLEYLSNKLRLLDWHRYPLkslpsnlqldkiVEFKMCYSRIEELWKGIKHLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESLEeldisetavrrppssVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQFLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVSDPLKDFSTVIPGSKIPKWFMYQNEGSSITVTRPSYLYNMNKIVGYAICCVFHVPRHSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSPRECYDRRWIFESnhfklsfndaREKYDMAGSGTGLKVKRCGFHPVYMHEVEELDQTTKQWTHFTSYNLYESDHDFLDQIWK

MNILQISFDGLQDSEKKIFLDVACFFKRWDRDYVAKILEGCGFSPVIGIEVLIERSLLTVDDYNTLGMHNSLQELGQLIVTRQSPEEPGKRSRLWRQEEVRHVLRKNTVHLSAKAFSLMTNLGLLKINNVQLLEGLEYLSNKLRLLDWHRYPLKSLPSNLQLDKIVEFKMCYSRIEELWKGIKHLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITEVPSSIellpglellnlnDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQFLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVSDPLKDFSTVIPGSKIPKWFMYQNEGSSITVTRPSYLYNMNKIVGYAICCVFHVPRHSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSPRECYDRRWIFESNHFKLSFNDAREKYDMAGSGTGLKVKRCGFHPVYMHEVEELDQTTKQWTHFTSYNLYESDHDFLDQIWK

*****ISFDGLQDSEKKIFLDVACFFKRWDRDYVAKILEGCGFSPVIGIEVLIERSLLTVDDYNTLGMHNSLQELGQLIV**************WRQEEVRHVLRKNTVHLSAKAFSLMTNLGLLKINNVQLLEGLEYLSNKLRLLDWHRYPLKSLPSNLQLDKIVEFKMCYSRIEELWKGIKHLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESL***************SVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQFLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVSDPLKDFSTVIPGSKIPKWFMYQNEGSSITVTRPSYLYNMNKIVGYAICCVFHVPRHSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSPRECYDRRWIFESNHFKLSFNDAREKYDMAGSGTGLKVKRCGFHPVYMHEVEELDQTTKQWTHFTSYNLYESDHDFLDQI**

MNILQISFDGLQDSEKKIFLDVACFFKRWDRDYVAKILEGCGFSPVIGIEVLIERSLLTVDDYNTLGMHNSLQELGQLIVTRQ***********WRQEEVRHVLRKNTVHLSAKAFSLMTNLGLLKINNVQLLEGLEYLSNKLRLLDWHRYPLKSLPSNLQLDKIVEFKMCYSRIEELWKGIKHLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQFLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVSDPLKDFSTVIPGSKIPKWFMYQNEGSSITVTRPSYLYNMNKIVGYAICCVFHVPRHSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSPRECYDRRWIFESNHFKLSFNDAREKYDMAGSGTGLKVKRCGFHPVYMHEVEELDQTTKQWTHFTSYNLYESDHDFLDQIWK

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		784	2.2.26 [Sep-21-2011]
Q40392		1144	TMV resistance protein N	N/A	no	0.721	0.494	0.312	2e-80
Q9SZ67		1895	Probable WRKY transcripti	no	no	0.478	0.197	0.374	1e-63
Q9FL92		1372	Probable WRKY transcripti	no	no	0.436	0.249	0.347	9e-53
Q9FH83		1288	Probable WRKY transcripti	no	no	0.534	0.325	0.313	3e-48
O23530		1301	Protein SUPPRESSOR OF npr	no	no	0.679	0.409	0.297	3e-47
Q9FKN7		1613	Protein DA1-related 4 OS=	no	no	0.446	0.216	0.298	3e-37
O82500		1095	Putative disease resistan	no	no	0.448	0.321	0.273	4e-33
Q9RBS2		1024	Protein PopC OS=Ralstonia	yes	no	0.474	0.363	0.276	2e-21
P0CB16		1201	Putative disease resistan	no	no	0.469	0.306	0.253	1e-17
A4D1F6		860	Leucine-rich repeat and d	yes	no	0.424	0.387	0.251	2e-14

>sp\|Q40392\|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1	Back alignment and function desciption

 Score =  301 bits (770), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 211/676 (31%), Positives = 332/676 (49%), Gaps = 110/676 (16%)

Query: 1    MNILQISFDGLQDSEKKIFLDVACFFKRWDRDYVAKILEGCGFSPVIGIEVLIERSLLTV 60
            ++ L+IS+DGL+  ++++FLD+ACF +  ++DY+ +ILE C      G+ +LI++SL+ +
Sbjct: 420  IDKLKISYDGLEPKQQEMFLDIACFLRGEEKDYILQILESCHIGAEYGLRILIDKSLVFI 479

Query: 61   DDYNTLGMHNSLQELGQLIVTRQSPEEPGKRSRLWRQEEVRHVLRKNT------------ 108
             +YN + MH+ +Q++G+ IV  Q  ++PG+RSRLW  +EV  V+  NT            
Sbjct: 480  SEYNQVQMHDLIQDMGKYIVNFQ--KDPGERSRLWLAKEVEEVMSNNTGTMAMEAIWVSS 537

Query: 109  ----VHLSAKAFSLMTNLGLLKINNVQLLEGLEYLSNKLRLLDWHRYPLKSLPSNLQLDK 164
                +  S +A   M  L +  +        ++YL N LR      YP +S PS  +L  
Sbjct: 538  YSSTLRFSNQAVKNMKRLRVFNMGRSSTHYAIDYLPNNLRCFVCTNYPWESFPSTFELKM 597

Query: 165  IVEFKMCYSRIEELWKGIKHLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTKLRK 224
            +V  ++ ++ +  LW   KHL  L+ + LS S+ L +TPDFT  PN              
Sbjct: 598  LVHLQLRHNSLRHLWTETKHLPSLRRIDLSWSKRLTRTPDFTGMPN-------------- 643

Query: 225  VHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEH 284
                            L+ + L  C  L +  H +G   C  ++                
Sbjct: 644  ----------------LEYVNLYQCSNLEEVHHSLG---CCSKV---------------- 668

Query: 285  LFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGT 344
                + L LNDCK+L   P    + + L  L L  C  L+K P+I   M+   ++++ G+
Sbjct: 669  ----IGLYLNDCKSLKRFPCV--NVESLEYLGLRSCDSLEKLPEIYGRMKPEIQIHMQGS 722

Query: 345  SITEVPSSI-ELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQ 403
             I E+PSSI +    +  L L + KN   +PSSI  LKSL +L++SGC KLE++P+ +G 
Sbjct: 723  GIRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLKSLVSLSVSGCSKLESLPEEIGD 782

Query: 404  VESLEELDISETAVRRPPSSVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSCLV 463
            +++L   D S+T + RPPSS+  +  L  L F G          H   P           
Sbjct: 783  LDNLRVFDASDTLILRPPSSIIRLNKLIILMFRGFKD-----GVHFEFP----------- 826

Query: 464  ALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLN 523
                P   GL SL  L+LS C L +G +P +IG+L SL +L LS+NNF  LP+SI  L  
Sbjct: 827  ----PVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGA 882

Query: 524  LKELEMEDCKRLQFLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIECIDSLKLLR 583
            L+ L+++DC+RL  LP+LPP +  + V+ C   +  +  L   +     ++  D+     
Sbjct: 883  LQSLDLKDCQRLTQLPELPPELNELHVD-CHMALKFIHYLVTKRKKLHRVKLDDAHNDTM 941

Query: 584  NNGWAILMLREYLEAVSDPLKDFS-------TVIPGS----KIPKWFMYQNEGSSITVTR 632
             N +A  M     + +S    D S       TV  G     KIP WF +Q   SS++V  
Sbjct: 942  YNLFAYTM----FQNISSMRHDISASDSLSLTVFTGQPYPEKIPSWFHHQGWDSSVSVNL 997

Query: 633  PSYLYNMNKIVGYAIC 648
            P   Y  +K +G+A+C
Sbjct: 998  PENWYIPDKFLGFAVC 1013

Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)

>sp\|Q9SZ67\|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1	Back alignment and function description

>sp\|Q9FL92\|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1	Back alignment and function description

>sp\|Q9FH83\|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3	Back alignment and function description

>sp\|O23530\|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3	Back alignment and function description

>sp\|Q9FKN7\|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2	Back alignment and function description

>sp\|O82500\|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1	Back alignment and function description

>sp\|Q9RBS2\|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2	Back alignment and function description

>sp\|P0CB16\|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2	Back alignment and function description

>sp\|A4D1F6\|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		784
359486075		1291	PREDICTED: TMV resistance protein N-like	0.920	0.559	0.402	1e-142
359486073		1296	PREDICTED: TMV resistance protein N-like	0.924	0.559	0.402	1e-140
147770134		1414	hypothetical protein VITISV_040107 [Viti	0.920	0.510	0.398	1e-140
451798988		1219	TMV resistance protein N-like protein 6	0.820	0.527	0.420	1e-138
451798990		1335	TMV resistance protein N-like protein 7	0.933	0.548	0.391	1e-136
359486071		1261	PREDICTED: TMV resistance protein N-like	0.946	0.588	0.394	1e-134
359496026		1250	PREDICTED: TMV resistance protein N-like	0.872	0.547	0.401	1e-133
224127726		1203	tir-nbs-lrr resistance protein [Populus	0.878	0.572	0.396	1e-130
225448053		1468	PREDICTED: TMV resistance protein N-like	0.938	0.501	0.373	1e-128
359493267		1417	PREDICTED: TMV resistance protein N-like	0.950	0.525	0.372	1e-128

>gi\|359486075\|ref\|XP_002273047.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  512 bits (1318), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 334/829 (40%), Positives = 460/829 (55%), Gaps = 107/829 (12%)

Query: 2    NILQISFDGLQDSEKKIFLDVACFFKRWDRDYVAKILEGCGFSPVIGIEVLIERSLLTVD 61
            ++L+ISFDGL D++K IF D+ACFFK  D+DYV K+L+ C F P IGI  LI++SL+T+ 
Sbjct: 424  DVLRISFDGLDDNQKDIFFDIACFFKGQDKDYVIKLLKSCDFFPEIGIRNLIDKSLVTIS 483

Query: 62   DYNTLGMHNSLQELGQLIVTRQSPEEPGKRSRLWRQEEVRHVLRKNT------------- 108
             YN L MH+ +QE+G  IV ++S ++PGKRSRLW  ++V  +L  NT             
Sbjct: 484  -YNKLCMHDLIQEMGWEIVRQESMKDPGKRSRLWVNDDVIDMLTTNTGTEAVEGMVLNLS 542

Query: 109  ----VHLSAKAFSLMTNLGLLKINNVQL-----------------------LEG-LEYLS 140
                +H S   F+ M  L +L+  + Q+                       L G  ++LS
Sbjct: 543  TLKELHFSVNVFTKMNKLRVLRFYDAQIWGSSWIWRRNDRYKSPYTECKFHLSGDFKFLS 602

Query: 141  NKLRLLDWHRYPLKSLPSNLQLDKIVEFKMCYSRIEELWKGIKHLNMLKVMKLSHSENLI 200
            N LR L W  YPLKSLPSN   +K++E KMC+S++E+LW+G K    LK ++LSHS++LI
Sbjct: 603  NHLRSLYWDGYPLKSLPSNFHPEKLLELKMCFSQLEQLWEGNKSFQKLKFIELSHSQHLI 662

Query: 201  KTPDFTEAPNLEELYLEGCTKLRKVHPSLLLHNKLIFV-----------------ESLKI 243
            K PDF+ AP L  + LEGCT L KVHPS+    KLIF+                 ESL+I
Sbjct: 663  KAPDFSGAPKLRRIILEGCTSLVKVHPSIGALKKLIFLNLEGCKNLKSFLSSIHLESLQI 722

Query: 244  LILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSLP 303
            L LSGC KL+K P V G+M+ L EL L GT IK LPLSIE+L GL    L +CK+L SLP
Sbjct: 723  LTLSGCSKLKKLPEVQGAMDNLSELSLKGTAIKGLPLSIEYLNGLALFNLEECKSLESLP 782

Query: 304  VAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITEVPSSIELLPGLELLN 363
              I   + L+ L LS C +LKK P+I   ME L EL LD T + E+PSSIE L GL LL 
Sbjct: 783  GCIFKLKSLKTLILSNCLRLKKLPEIQENMESLKELFLDDTGLRELPSSIEHLNGLVLLK 842

Query: 364  LNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSS 423
            L +CK  A +P SI  L SL+TL LSGC +L+ +PD +G ++ L +L  + + ++  PSS
Sbjct: 843  LKNCKRLASLPESICKLTSLQTLTLSGCSELKKLPDDMGSLQCLLKLKANGSGIQEVPSS 902

Query: 424  VFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSD 483
            + L+  L+ LS +GC G   S S +L L      ++S    L L SL+ L SL KL+LSD
Sbjct: 903  ITLLTRLQVLSLAGCKG-GGSKSRNLALSL----RASPTDGLRLSSLTVLHSLKKLNLSD 957

Query: 484  CGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQFLPQLPP 543
              L EGA+PSD+ +L  L  L LS+NNF+T+P S++ L +L+ L +E CK LQ LP+LP 
Sbjct: 958  RNLLEGALPSDLSSLSWLECLDLSRNNFITVPTSLSRLPHLRRLIVEHCKNLQSLPELPS 1017

Query: 544  NIIFVKVNGCSSLVTL---LGALKLCKSNGIVIECIDSLKLLRNNG----WAILMLREYL 596
            +I  +  N C+SL T      A  L K      E  +  +L+ N       AIL     +
Sbjct: 1018 SIKELLANDCTSLETFSYPSSAYPLRKFGDFNFEFSNCFRLVGNEQSDTVEAILQEIRLV 1077

Query: 597  EAVSDPL-----------KDFSTVIPGSKIPKWFMYQNEGSSITVTRPSYLYNMNKIVGY 645
             ++   +             +  V+PGS+IP+WF +Q+EG SITV  P   YN N I G 
Sbjct: 1078 ASIQKSMAPSEHSARYGESRYDAVVPGSRIPEWFTHQSEGDSITVELPPGCYNTNSI-GL 1136

Query: 646  AICCVFHVPRHSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLF--LSP 703
            A C VFH P+ S     R   + +         GF +        S +DH+W  +  +S 
Sbjct: 1137 AACAVFH-PKFSMGKIGRSAYFSVN-----ESGGFSLDNTTSMHFSKADHIWFGYRLISG 1190

Query: 704  RECYDRRWIFESNHFKLSFNDAREKYDMAGSGTGLKVKRCGFHPVYMHE 752
             +  D        H K++F  ++          G  VK+CG   VY  +
Sbjct: 1191 VDLRD--------HLKVAFATSKV--------PGEVVKKCGVRLVYEQD 1223

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359486073\|ref\|XP_002272820.2\| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147770134\|emb\|CAN76615.1\| hypothetical protein VITISV_040107 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|451798988\|gb\|AGF69192.1\| TMV resistance protein N-like protein 6 [Vitis labrusca]	Back alignment and taxonomy information

>gi\|451798990\|gb\|AGF69193.1\| TMV resistance protein N-like protein 7 [Vitis labrusca]	Back alignment and taxonomy information

>gi\|359486071\|ref\|XP_002272667.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359496026\|ref\|XP_002277166.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224127726\|ref\|XP_002329162.1\| tir-nbs-lrr resistance protein [Populus trichocarpa] gi\|222870943\|gb\|EEF08074.1\| tir-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225448053\|ref\|XP_002273151.1\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359493267\|ref\|XP_002271591.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		784
TAIR\|locus:2205824		1384	AT1G27170 [Arabidopsis thalian	0.760	0.430	0.311	2.5e-50
TAIR\|locus:2094498		1981	AT3G25510 [Arabidopsis thalian	0.528	0.208	0.333	1.6e-49
TAIR\|locus:2205804		1556	AT1G27180 [Arabidopsis thalian	0.771	0.388	0.282	3.7e-46
TAIR\|locus:2827629		1355	AT2G17050 [Arabidopsis thalian	0.395	0.228	0.374	5.1e-45
TAIR\|locus:2175991		1294	AT5G17680 [Arabidopsis thalian	0.876	0.530	0.274	7.9e-45
UNIPROTKB\|Q40392		1144	N "TMV resistance protein N" [	0.506	0.347	0.317	5e-42
TAIR\|locus:2147992		1189	AT5G11250 [Arabidopsis thalian	0.566	0.373	0.301	9.2e-41
TAIR\|locus:2053405		1215	AT2G14080 [Arabidopsis thalian	0.575	0.371	0.310	2.1e-39
TAIR\|locus:2122955		1309	AT4G19500 [Arabidopsis thalian	0.391	0.234	0.358	1.8e-38
TAIR\|locus:2130280		1041	AT4G16960 [Arabidopsis thalian	0.586	0.441	0.310	4.1e-38

TAIR\|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 549 (198.3 bits), Expect = 2.5e-50, P = 2.5e-50
 Identities = 209/671 (31%), Positives = 332/671 (49%)

Query:     2 NILQISFDGLQDSEKKIFLDVACFFKRWD--RDYVAKILEGCGFSPVIGIEVLIERSLLT 59
             ++L++SF  L D EKK+FLD+AC F + +  +D V  +L+GCG +    + VL ++SL+ 
Sbjct:   422 DVLELSFKSLDDEEKKVFLDIACLFLKMEIKKDEVVIVLKGCGLNAEAALSVLRQKSLVK 481

Query:    60 VDDYNTLGMHNSLQELGQLIVTRQSPEEPGKRSRLWRQEEVRHVLR--KNTVHLSA---- 113
             +   +TL MH+ ++++G+ +V ++S E+PG RSRLW + E+  VL   K T  +      
Sbjct:   482 ILANDTLWMHDQIRDMGRQMVLKESREDPGLRSRLWDRGEIMTVLNNMKGTSSIRGIVLD 541

Query:   114 --KAFSLMTNLGLLKINNVQLLEGL----EYLSNKLRLLDWHRYPLKSLPSNLQLDKIVE 167
               K F+       +   N++   G+     YL NKL      R+P +  P + ++   VE
Sbjct:   542 FKKKFARDPTADEIVSRNLRNNPGIYSVFNYLKNKLV-----RFPAEEKPKSSEITIPVE 596

Query:   168 -F----KMCYSRIE--ELWKGIKHL-NMLKVMKLSHS--ENLIKTPDFTEAPNLEELYLE 217
              F    K+   +I   EL   +K L + LK ++      ENL   PDF  A  L  L L 
Sbjct:   597 SFAPMTKLRLLQINNVELEGNLKLLPSELKWIQWKGCPLENL--PPDFL-ARQLSVLDLS 653

Query:   218 GCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDG-TDIK 276
               + +R+V     L NK++  E+LK++IL GC  L   P +  + E L++L+ +  T + 
Sbjct:   654 E-SGIRQVQT---LRNKMVD-ENLKVVILRGCHSLEAIPDL-SNHEALEKLVFEQCTLLV 707

Query:   277 ELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDL 336
             ++P S+ +L  L+ L    C  LS   V +S  + L  L LSGCS L   P+ +  M  L
Sbjct:   708 KVPKSVGNLRKLIHLDFRRCSKLSEFLVDVSGLKLLEKLFLSGCSDLSVLPENIGAMTSL 767

Query:   337 SELNLDGTSITEVPSSIXXXXXXXXXXXXDCKNFARVPSSINGLKSLKTLNLSGCCKLEN 396
              EL LDGT+I  +P SI             CK    +P  I  LKSL+ L L     L+N
Sbjct:   768 KELLLDGTAIKNLPESINRLQNLEILSLRGCK-IQELPLCIGTLKSLEKLYLDDTA-LKN 825

Query:   397 VPDTLGQVESLEELDISE-TAVRRPPSSVFLMKNLRTLSFSGC--NGPPSSASWHLHLPF 453
             +P ++G +++L++L +   T++ + P S+  +K+L+ L  +G      P   S    LP 
Sbjct:   826 LPSSIGDLKNLQDLHLVRCTSLSKIPDSINELKSLKKLFINGSAVEELPLKPS---SLP- 881

Query:   454 NLMGKSS--CLVALMLPSLSG-LRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNN 510
             +L   S+  C     +PS  G L SL +L LS   +   A+P +IG LH + EL L    
Sbjct:   882 SLYDFSAGDCKFLKQVPSSIGRLNSLLQLQLSSTPIE--ALPEEIGALHFIRELELRNCK 939

Query:   511 FVT-LPASINSLLNLKELEMEDCKRLQFLPQ---LPPNIIFVKVNGCSSLVTL---LGAL 563
             F+  LP SI  +  L  L +E    ++ LP+       ++ ++++ C  L  L    G L
Sbjct:   940 FLKFLPKSIGDMDTLYSLNLEG-SNIEELPEEFGKLEKLVELRMSNCKMLKRLPESFGDL 998

Query:   564 K----LCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVSDPLKDFS-TVIPG-SKIPK 617
             K    L     +V E  +S   L N     LM+   LE +  PL   S + +PG S+ P+
Sbjct:   999 KSLHRLYMKETLVSELPESFGNLSN-----LMV---LEMLKKPLFRISESNVPGTSEEPR 1050

Query:   618 WFMYQNEGSSI 628
             +    N  S +
Sbjct:  1051 FVEVPNSFSKL 1061

GO:0005622 "intracellular" evidence=IEA

GO:0005737 "cytoplasm" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0007165 "signal transduction" evidence=IEA

GO:0043531 "ADP binding" evidence=IEA

GO:0009507 "chloroplast" evidence=IDA

GO:0009506 "plasmodesma" evidence=IDA

TAIR\|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2827629 AT2G17050 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)]	Back alignment and assigned GO terms

TAIR\|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2122955 AT4G19500 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2130280 AT4G16960 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		784
PLN03210		1153	PLN03210, PLN03210, Resistant to P	5e-62
PLN03210		1153	PLN03210, PLN03210, Resistant to P	3e-24
PLN03210		1153	PLN03210, PLN03210, Resistant to P	1e-18
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	7e-11
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-09
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	4e-07
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	5e-07
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-05
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	2e-05
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	4e-05
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	5e-04
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	0.002
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	0.004

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

 Score =  226 bits (577), Expect = 5e-62
 Identities = 170/533 (31%), Positives = 259/533 (48%), Gaps = 105/533 (19%)

Query: 4   LQISFDGLQD-SEKKIFLDVACFFKRWDRDYVAKILEGCGFSPVIGIEVLIERSLLTVDD 62
           L++S+DGL +  +K IF  +AC F     + +  +L        IG++ L+++SL+ V  
Sbjct: 426 LRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVR- 484

Query: 63  YNTLGMHNSLQELGQLIVTRQSPEEPGKRSRLWRQEEVRHVLRKNT-------------- 108
            + + MH+ LQE+G+ IV  QS  EPG+R  L   +++  VL  NT              
Sbjct: 485 EDIVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDE 543

Query: 109 ---VHLSAKAFSLMTNLGLLKI--------NNVQ--LLEGLEYLSNKLRLLDWHRYPLKS 155
              +H+   AF  M NL  LK           V+  L EG +YL  KLRLL W +YPL+ 
Sbjct: 544 IDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRC 603

Query: 156 LPSNLQLDKIVEFKMCYSRIEELWKGIKHLNMLKVMKLSHSENLIKTPDFTEAPNLEELY 215
           +PSN + + +V+ +M  S++E+LW G+  L  L+ + L  S+NL + PD + A NLE L 
Sbjct: 604 MPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLK 663

Query: 216 LEGCTKLRKVHPSLLLHNKL-----------------IFVESLKILILSGCLKLRKFPHV 258
           L  C+ L ++  S+   NKL                 I ++SL  L LSGC +L+ FP +
Sbjct: 664 LSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPDI 723

Query: 259 VGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLS 318
             +   +  L LD T I+E P ++  L  L +L L + K+                    
Sbjct: 724 STN---ISWLDLDETAIEEFPSNL-RLENLDELILCEMKS-------------------- 759

Query: 319 GCSKLKKFPQIVT---TM--EDLSELNL-DGTSITEVPSSIELLPGLELLNLNDCKNFAR 372
              KL +  Q +T   TM    L+ L L D  S+ E+PSSI+ L  LE L + +C N   
Sbjct: 760 --EKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLET 817

Query: 373 VPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSVFLMKNLRT 432
           +P+ IN L+SL++L+LSGC +L   PD      ++ +L++S T +   P  +    NL  
Sbjct: 818 LPTGIN-LESLESLDLSGCSRLRTFPDI---STNISDLNLSRTGIEEVPWWIEKFSNLSF 873

Query: 433 LSFSGCNGPPSSASWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCG 485
           L  +GCN              NL   S         ++S L+ L  +D SDCG
Sbjct: 874 LDMNGCN--------------NLQRVS--------LNISKLKHLETVDFSDCG 904

syringae 6; Provisional. Length = 1153

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		784
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.97
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.96
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.95
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.95
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.95
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.95
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.94
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.92
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.91
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.88
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.7
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.69
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.68
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.67
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.64
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.57
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.51
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.47
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.47
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.46
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.19
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.95
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.93
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.9
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.88
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.87
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.86
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.84
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.8
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.69
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.67
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.66
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.65
PLN03150		623	hypothetical protein; Provisional	98.47
PRK15386		426	type III secretion protein GogB; Provisional	98.41
KOG4341		483	consensus F-box protein containing LRR [General fu	98.27
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.27
PLN03150		623	hypothetical protein; Provisional	98.23
PRK15386		426	type III secretion protein GogB; Provisional	98.2
KOG4341		483	consensus F-box protein containing LRR [General fu	98.19
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.17
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.12
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.1
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.08
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.03
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.98
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	97.96
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.85
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.79
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.66
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.63
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.5
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.48
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.42
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.28
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.15
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.11
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.99
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	96.77
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.7
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.44
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.25
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.15
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.54
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.39
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	94.69
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	94.46
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	93.86
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.52
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	93.42
PF07725		20	LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le	88.99
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	88.88
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	88.77
smart00370		26	LRR Leucine-rich repeats, outliers.	88.77
KOG4308		478	consensus LRR-containing protein [Function unknown	85.98
KOG4308		478	consensus LRR-containing protein [Function unknown	83.68
KOG0473		326	consensus Leucine-rich repeat protein [Function un	82.1
KOG3864		221	consensus Uncharacterized conserved protein [Funct	82.05
KOG3864		221	consensus Uncharacterized conserved protein [Funct	81.58
KOG0473		326	consensus Leucine-rich repeat protein [Function un	80.5

>PLN03210 Resistant to P	Back alignment and domain information

Probab=100.00  E-value=4e-64  Score=613.33  Aligned_cols=625  Identities=28%  Similarity=0.458  Sum_probs=417.0

Q ss_pred             CeeeEeccCCCh-hhhchhcceecccCccCHHHHHHHhhhcCCCchhhhHhhhcccceeEeCCCceecchHHHHHHHHHH
Q 003945            2 NILQISFDGLQD-SEKKIFLDVACFFKRWDRDYVAKILEGCGFSPVIGIEVLIERSLLTVDDYNTLGMHNSLQELGQLIV   80 (784)
Q Consensus         2 ~iL~lSYd~L~~-~lK~cFl~~a~Fp~~~~~~~l~~~w~a~gf~~~~~~~~Li~r~li~~~~~~~v~mHdll~d~~~~i~   80 (784)
                      ++|++|||+|++ .+|.||+||||||+|.+++.+..++.+.|+.++.+++.|++||||++. .++++|||++|+||++|+
T Consensus       424 ~~L~~SYd~L~~~~~k~~Fl~ia~ff~~~~~~~v~~~l~~~~~~~~~~l~~L~~ksLi~~~-~~~~~MHdLl~~~~r~i~  502 (1153)
T PLN03210        424 KTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVR-EDIVEMHSLLQEMGKEIV  502 (1153)
T ss_pred             HHHHHhhhccCccchhhhhheehhhcCCCCHHHHHHHHHhcCCCchhChHHHHhcCCEEEc-CCeEEhhhHHHHHHHHHH
Confidence            589999999986 599999999999999999998888888888889999999999999998 689999999999999999


Q ss_pred             HhcCCCCCCCcccccchHHHHHHHhhcc-----------------cccCHHHHhcCCCcceEEEcCc----------ccc
Q 003945           81 TRQSPEEPGKRSRLWRQEEVRHVLRKNT-----------------VHLSAKAFSLMTNLGLLKINNV----------QLL  133 (784)
Q Consensus        81 ~~e~~~~~~~~~~l~~~~~i~~vl~~~~-----------------~~~~~~~f~~~~~Lr~L~l~~~----------~l~  133 (784)
                      ++++ .+|++++++|+++++++++..++                 ..+...+|.+|++|++|.+..+          +++
T Consensus       503 ~~~~-~~~~~r~~l~~~~di~~vl~~~~g~~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~lp  581 (1153)
T PLN03210        503 RAQS-NEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLP  581 (1153)
T ss_pred             Hhhc-CCCCcceeEeCHHHHHHHHHhCcccceeeEEEeccCccceeeecHHHHhcCccccEEEEecccccccccceeecC
Confidence            9998 78999999999999999998775                 3467889999999999999654          356


Q ss_pred             CchhhcCcCccEEEEecCCCCCCCCCCCCCCeeEEEeCCCCcccccccccCCCCccEEEcCCCCCCCCCCCCCCCCCccE
Q 003945          134 EGLEYLSNKLRLLDWHRYPLKSLPSNLQLDKIVEFKMCYSRIEELWKGIKHLNMLKVMKLSHSENLIKTPDFTEAPNLEE  213 (784)
Q Consensus       134 ~~~~~l~~~Lr~L~l~~~~l~~lp~~~~l~~L~~L~L~~~~i~~l~~~~~~l~~L~~L~L~~~~~~~~~~~l~~l~~L~~  213 (784)
                      +++..+|.+||.|+|++++++.+|..+.+.+|++|+|+++.++.+|.++..+++|+.|+|+++.....+|+++.+++|++
T Consensus       582 ~~~~~lp~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~ls~l~~Le~  661 (1153)
T PLN03210        582 EGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLET  661 (1153)
T ss_pred             cchhhcCcccEEEEecCCCCCCCCCcCCccCCcEEECcCccccccccccccCCCCCEEECCCCCCcCcCCccccCCcccE
Confidence            77888899999999999999999999999999999999999999999999999999999999988888899999999999


Q ss_pred             EEecCCccCcccCccccccCcccccCCccEEEecCCCCCccccccccCCCcCcEEEecCCCccccChhhhcccCCceeec
Q 003945          214 LYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTL  293 (784)
Q Consensus       214 L~L~~~~~l~~~~~~i~~l~~L~~l~~L~~L~ls~~~~~~~~~~~l~~l~~L~~L~l~~~~i~~lp~~i~~l~~L~~L~L  293 (784)
                      |++++|..+..+|.++..                                                     +++|+.|++
T Consensus       662 L~L~~c~~L~~lp~si~~-----------------------------------------------------L~~L~~L~L  688 (1153)
T PLN03210        662 LKLSDCSSLVELPSSIQY-----------------------------------------------------LNKLEDLDM  688 (1153)
T ss_pred             EEecCCCCccccchhhhc-----------------------------------------------------cCCCCEEeC
Confidence            999999777766654433                                                     333333555


Q ss_pred             cCccCCCCCccccccccccCeEeecCCCCCccCcccccCCCCCCEEeccCcCCcccCccccCCCCCCEEecCCCCCccc-
Q 003945          294 NDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNFAR-  372 (784)
Q Consensus       294 ~~~~~~~~lp~~l~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~L~~~~i~~lp~~l~~l~~L~~L~L~~~~~~~~-  372 (784)
                      ++|..++.+|..+ ++++|+.|++++|..+..+|..   .++|+.|++++|.+..+|..+ .+++|+.|.+.++..... 
T Consensus       689 ~~c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~~---~~nL~~L~L~~n~i~~lP~~~-~l~~L~~L~l~~~~~~~l~  763 (1153)
T PLN03210        689 SRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDI---STNISWLDLDETAIEEFPSNL-RLENLDELILCEMKSEKLW  763 (1153)
T ss_pred             CCCCCcCccCCcC-CCCCCCEEeCCCCCCccccccc---cCCcCeeecCCCccccccccc-cccccccccccccchhhcc
Confidence            5555555555544 3566666666666655555543   345677777777777777654 466777777665432110 


Q ss_pred             ------ccccccCCCCCCEEEccCCCCCCcCCCCCCCCCCccEEecCCC-ccccCCccccccccccEEecCCCCCCCCCC
Q 003945          373 ------VPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESLEELDISET-AVRRPPSSVFLMKNLRTLSFSGCNGPPSSA  445 (784)
Q Consensus       373 ------l~~~~~~l~~L~~L~Ls~c~~l~~~~~~l~~l~~L~~L~l~~~-~i~~lp~~~~~l~~L~~L~l~~~~~l~~~~  445 (784)
                            .+......++|+.|++++|.....+|..++++++|+.|++++| .+..+|..+ .+++|+.|++++|..+... 
T Consensus       764 ~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~-~L~sL~~L~Ls~c~~L~~~-  841 (1153)
T PLN03210        764 ERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTF-  841 (1153)
T ss_pred             ccccccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCC-CccccCEEECCCCCccccc-
Confidence                  0111122356666666666666666666666666666666655 344555444 4556666666665533211 


Q ss_pred             CcccccccccccCccchhhccCCCCCCCCCCCEEecCCCCCCCCCCCcccCCCCCCCEEecCC-CCCcccchhhhcCCCC
Q 003945          446 SWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSK-NNFVTLPASINSLLNL  524 (784)
Q Consensus       446 ~~~~~~~l~~~~~~~~~~~~~~~~l~~l~~L~~L~Ls~~~l~~~~~p~~l~~l~~L~~L~L~~-n~l~~lp~~i~~l~~L  524 (784)
                                           |.   ..++|++|+|++|.+.  .+|.++..+++|+.|+|++ +++..+|..+..+++|
T Consensus       842 ---------------------p~---~~~nL~~L~Ls~n~i~--~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L  895 (1153)
T PLN03210        842 ---------------------PD---ISTNISDLNLSRTGIE--EVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHL  895 (1153)
T ss_pred             ---------------------cc---cccccCEeECCCCCCc--cChHHHhcCCCCCEEECCCCCCcCccCcccccccCC
Confidence                                 00   1134555555555553  3555555555555555555 2344555555555555


Q ss_pred             CeeccccccccCcCC--CCCCCceEEEecCCccceeecCcc-hhccccchhhhhhhhhHHhhhhhhHHHHHHHHHhhccC
Q 003945          525 KELEMEDCKRLQFLP--QLPPNIIFVKVNGCSSLVTLLGAL-KLCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVSD  601 (784)
Q Consensus       525 ~~L~L~~c~~L~~i~--~lp~sL~~L~~~~C~~L~~l~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  601 (784)
                      +.|++++|..|+.++  ..|.++..+. .++.+  .++... ....+|..+...              .    .++.   
T Consensus       896 ~~L~l~~C~~L~~~~l~~~~~~~~~~~-~n~~~--~~p~~~~l~f~nC~~L~~~--------------a----~l~~---  951 (1153)
T PLN03210        896 ETVDFSDCGALTEASWNGSPSEVAMAT-DNIHS--KLPSTVCINFINCFNLDQE--------------A----LLQQ---  951 (1153)
T ss_pred             CeeecCCCcccccccCCCCchhhhhhc-ccccc--cCCchhccccccccCCCch--------------h----hhcc---
Confidence            555555555554332  1111111000 00000  000000 000123222110              0    0111   


Q ss_pred             CCCceEEeecCCCCCCccccCCCCceEE-EEcCCCCcCCCcEEEEEEEEEEeeCCCcccccccCCCceeEEEEecCCCCe
Q 003945          602 PLKDFSTVIPGSKIPKWFMYQNEGSSIT-VTRPSYLYNMNKIVGYAICCVFHVPRHSTRIKKRRHSYELQCCMDGSDRGF  680 (784)
Q Consensus       602 ~~~~~~~~~pg~~iP~wf~~~~~g~si~-~~lp~~~~~~~~~~g~~~c~v~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~  680 (784)
                      ......+++||.++|+||.||+.|++++ |.+|+.|. ...+.||++|+|+++......  ...+.+.+.|.+.+..+..
T Consensus       952 ~~~~~~~~l~g~evp~~f~hr~~g~sl~~i~l~~~~~-~~~~~~f~~c~v~~~~~~~~~--~~~~~~~~~c~~~~~~~~~ 1028 (1153)
T PLN03210        952 QSIFKQLILSGEEVPSYFTHRTTGASLTNIPLLHISP-CQPFFRFRACAVVDSESFFII--SVSFDIQVCCRFIDRLGNH 1028 (1153)
T ss_pred             cccceEEECCCccCchhccCCcccceeeeeccCCccc-CCCccceEEEEEEecCccccC--CCceeEEEEEEEECCCCCc
Confidence            0122357899999999999999999998 99999887 678999999999986654211  1234567888887754443


Q ss_pred             eEEecccccCCCCCeEEEEEecCcccc----------cc--ccccccCeEEEEEeccccccccCCCCCceEEEEeceeee
Q 003945          681 FITFGGKFSHSGSDHLWLLFLSPRECY----------DR--RWIFESNHFKLSFNDAREKYDMAGSGTGLKVKRCGFHPV  748 (784)
Q Consensus       681 ~~~~~~~~~~~~s~h~~~~~~~~~~~~----------~~--~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~vk~cGv~li  748 (784)
                      ..       ....+|+|+.|.....+.          +.  .+...++|+.+.|.    ..   .....++||+|||+++
T Consensus      1029 ~~-------~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~----~~---~~~~~~~~~~cg~~~~ 1094 (1153)
T PLN03210       1029 FD-------SPYQPHVFSVTKKGSHLVIFDCCFPLNEDNAPLAELNYDHVDIQFR----LT---NKNSQLKLKGCGIRLS 1094 (1153)
T ss_pred             cc-------cCCCceeEeeeccccceEEecccccccccccchhccCCceeeEEEE----Ee---cCCCCeEEEeeeEEEe
Confidence            21       113444444443321110          00  11224677777775    11   1223479999999999


Q ss_pred             ecccccc
Q 003945          749 YMHEVEE  755 (784)
Q Consensus       749 y~~~~~~  755 (784)
                      |+++..+
T Consensus      1095 ~~~~~~~ 1101 (1153)
T PLN03210       1095 EDDSSLN 1101 (1153)
T ss_pred             ccCCCcc
Confidence            9665443

syringae 6; Provisional

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		784
4fcg_A		328	Structure Of The Leucine-Rich Repeat Domain Of The		2e-10
4fcg_A		328	Structure Of The Leucine-Rich Repeat Domain Of The		2e-08
4fcg_A		328	Structure Of The Leucine-Rich Repeat Domain Of The		2e-04

>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328

Back alignment and structure

Iteration: 1

Score = 64.7 bits (156), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 54/200 (27%), Positives = 88/200 (44%), Gaps = 14/200 (7%) Query: 250 LKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKN-LSSLPVAISS 308 + L +FP + LQ +D + ELP + + GL LTL +N L +LP +I+S Sbjct: 91 VPLPQFPDQAFRLSHLQHXTIDAAGLXELPDTXQQFAGLETLTL--ARNPLRALPASIAS 148 Query: 309 FQCLRNLKLSGCSKLKKFPQIVTTME---------DLSELNLDGTSITEVPSSIXXXXXX 359 LR L + C +L + P+ + + + +L L L+ T I +P+SI Sbjct: 149 LNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNL 208 Query: 360 XXXXXXDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESLEELDISE-TAVR 418 + A P +I+ L L+ L+L GC L N P G L+ L + + + + Sbjct: 209 KSLKIRNSPLSALGP-AIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLL 267 Query: 419 RPPSSVFLMKNLRTLSFSGC 438 P + + L L GC Sbjct: 268 TLPLDIHRLTQLEKLDLRGC 287

PyMOL of 4fcg

>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328

Back alignment and structure

>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		784
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-53
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	8e-50
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	8e-42
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-39
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-23
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-33
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	5e-28
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-27
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	6e-21
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	8e-21
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-12
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	7e-33
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-30
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-28
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-21
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	7e-13
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-12
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-28
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	8e-28
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-24
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-22
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	8e-15
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	9e-28
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	8e-24
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-21
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-16
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-14
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-10
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-27
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-20
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	7e-16
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-27
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-14
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-14
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-27
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-26
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-24
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-19
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	6e-26
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-20
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-13
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-12
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-25
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-20
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-16
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-24
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-24
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-24
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	9e-23
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	8e-09
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	5e-24
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	4e-18
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	7e-16
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-09
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-23
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	7e-21
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-08
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-23
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-23
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-20
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-19
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-15
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	8e-13
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-23
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-22
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-20
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-18
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-15
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-06
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-04
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-22
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	9e-22
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-21
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	9e-17
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-16
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-21
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	8e-13
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-21
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-21
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-21
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-14
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-13
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-21
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	9e-10
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	5e-21
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-20
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-13
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	9e-21
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-19
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-16
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-16
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	7e-07
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-20
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	6e-19
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-17
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	6e-10
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-04
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-17
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-09
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	3e-17
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-10
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-10
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	4e-08
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	3e-17
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	3e-15
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-14
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-05
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-17
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	5e-17
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-16
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	1e-14
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-08
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	2e-05
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	9e-16
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-15
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	4e-12
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-15
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-15
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	4e-11
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-15
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-13
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-07
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-15
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	3e-09
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	1e-15
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	8e-05
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	3e-15
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	5e-13
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	6e-10
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	9e-15
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	5e-09
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-14
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	4e-14
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	4e-14
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	3e-12
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	3e-12
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	1e-11
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	1e-09
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	6e-12
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	3e-11
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	3e-07
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	8e-12
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-10
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	6e-09
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	6e-05
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	7e-11
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	1e-05
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-04
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	2e-10
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	8e-06
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	3e-10
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	4e-07
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	6e-10
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	3e-09
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-08
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-05
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	9e-10
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	2e-06
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	1e-09
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-08
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	5e-06
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	7e-05
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	1e-09
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	1e-04
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	9e-09
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	2e-04
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	7e-08
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	1e-04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	7e-07
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	2e-05
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	1e-04
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	2e-06
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	4e-05
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	4e-06
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	2e-05
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	1e-05
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	2e-05
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	5e-04
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	2e-05
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	2e-05
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	2e-05
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	4e-05
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	2e-04
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	3e-04
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	4e-04

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

 Score =  187 bits (476), Expect = 3e-53
 Identities = 69/326 (21%), Positives = 121/326 (37%), Gaps = 42/326 (12%)

Query: 231 LHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQ 290
            H+        + L   G   LR +  V+   +       +            +     Q
Sbjct: 4   SHHHHHHSSGRENLYFQGSTALRPYHDVLSQWQRHYNADRNRW---HSAWRQANS-NNPQ 59

Query: 291 LTLNDCKNLSSLPVAI--SSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITE 348
           +     + L +    +  ++      L+L     L +FP     +  L  + +D   + E
Sbjct: 60  IETRTGRALKATADLLEDATQPGRVALELRSV-PLPQFPDQAFRLSHLQHMTIDAAGLME 118

Query: 349 VPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVE--- 405
           +P +++   GLE L L        +P+SI  L  L+ L++  C +L  +P+ L   +   
Sbjct: 119 LPDTMQQFAGLETLTLARNP-LRALPASIASLNRLRELSIRACPELTELPEPLASTDASG 177

Query: 406 ------SLEELDISETAVRRPPSSVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKS 459
                 +L+ L +  T +R  P+S+  ++NL++L                          
Sbjct: 178 EHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSP-------------------- 217

Query: 460 SCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLS-KNNFVTLPASI 518
             L AL  P++  L  L +LDL  C       P   G    L  L L   +N +TLP  I
Sbjct: 218 --LSAL-GPAIHHLPKLEELDLRGCTALRN-YPPIFGGRAPLKRLILKDCSNLLTLPLDI 273

Query: 519 NSLLNLKELEMEDCKRLQFLPQLPPN 544
           + L  L++L++  C  L  LP L   
Sbjct: 274 HRLTQLEKLDLRGCVNLSRLPSLIAQ 299

PyMOL of 4fcg

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		784
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	100.0
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.98
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.98
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.98
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.97
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.97
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.97
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.97
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.97
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.96
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.96
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.96
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.96
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.96
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.96
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.96
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.96
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.95
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.95
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.94
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.94
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.93
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.93
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.93
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.93
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.92
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.91
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.91
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.91
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.91
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.89
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.89
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.89
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.88
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.88
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.88
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.88
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.88
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.88
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.88
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.87
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.87
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.86
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.86
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.85
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.85
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.85
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.85
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.84
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.83
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.83
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.82
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.8
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.79
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.79
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.78
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.78
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.78
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.78
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.77
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.76
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.76
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.75
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.74
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.74
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.73
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.73
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.73
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.73
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.73
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.73
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.72
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.71
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.7
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.67
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.66
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.64
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.63
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.62
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.6
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.58
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.57
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.57
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.57
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.56
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.54
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.54
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.54
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.53
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.53
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.51
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.5
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.5
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.47
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.47
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.47
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.47
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.45
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.4
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.38
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.38
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.33
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.33
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.32
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.31
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.26
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.26
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.25
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.25
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.25
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.24
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.2
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.19
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.13
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	99.07
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.06
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.05
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.03
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.01
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.99
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.97
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.96
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.93
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.92
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.89
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.65
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.65
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.6
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.52
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	98.52
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.49
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.49
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.48
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	98.46
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.43
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	98.23
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.18
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.05
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.85
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.68
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.67
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.64
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.11
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.08
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	94.65
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	94.07
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	93.95
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	93.11

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

Probab=100.00  E-value=5.2e-39  Score=382.12  Aligned_cols=443  Identities=20%  Similarity=0.205  Sum_probs=302.0

Q ss_pred             HhcCCCcceEEEcCccccCchh-hcCcCccEEEEecCCCCCCCCCC-CCCCeeEEEeCCCCcc-cccccccCCCCccEEE
Q 003945          116 FSLMTNLGLLKINNVQLLEGLE-YLSNKLRLLDWHRYPLKSLPSNL-QLDKIVEFKMCYSRIE-ELWKGIKHLNMLKVMK  192 (784)
Q Consensus       116 f~~~~~Lr~L~l~~~~l~~~~~-~l~~~Lr~L~l~~~~l~~lp~~~-~l~~L~~L~L~~~~i~-~l~~~~~~l~~L~~L~  192 (784)
                      +.++++|+.|++++|.+.+... ....+|++|++++|.+...+..+ .+++|++|++++|.+. .+|..+..+++|++|+
T Consensus       174 ~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~  253 (768)
T 3rgz_A          174 SDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLN  253 (768)
T ss_dssp             TTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCBCTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEE
T ss_pred             hccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcccccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEE
Confidence            5667777777777777654321 22358889999888886644446 8889999999999887 4678888899999999


Q ss_pred             cCCCCCCCCCCCCCCCCCccEEEecCCccCcccCcccccc-Cccc------------------ccCCccEEEecCCCCCc
Q 003945          193 LSHSENLIKTPDFTEAPNLEELYLEGCTKLRKVHPSLLLH-NKLI------------------FVESLKILILSGCLKLR  253 (784)
Q Consensus       193 L~~~~~~~~~~~l~~l~~L~~L~L~~~~~l~~~~~~i~~l-~~L~------------------~l~~L~~L~ls~~~~~~  253 (784)
                      +++|.....+|.. .+++|++|++++|.....+|..++.. .+|+                  .+++|++|++++|.+.+
T Consensus       254 Ls~n~l~~~~~~~-~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~  332 (768)
T 3rgz_A          254 ISSNQFVGPIPPL-PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSG  332 (768)
T ss_dssp             CCSSCCEESCCCC-CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEE
T ss_pred             CCCCcccCccCcc-ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccC
Confidence            9888776555554 67777777777765444555554432 2222                  13455556666665555


Q ss_pred             ccccc-ccCCCcCcEEEecCCCcc-ccChhhhccc-CCceeeccCc--------------------------cCCCCCcc
Q 003945          254 KFPHV-VGSMECLQELLLDGTDIK-ELPLSIEHLF-GLVQLTLNDC--------------------------KNLSSLPV  304 (784)
Q Consensus       254 ~~~~~-l~~l~~L~~L~l~~~~i~-~lp~~i~~l~-~L~~L~L~~~--------------------------~~~~~lp~  304 (784)
                      .+|.. ++++++|++|++++|.+. .+|..+..++ +|+.|++++|                          ...+.+|.
T Consensus       333 ~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~  412 (768)
T 3rgz_A          333 ELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPP  412 (768)
T ss_dssp             ECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCG
T ss_pred             cCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCH
Confidence            55544 566666666666666554 4555554444 4444444433                          22234445


Q ss_pred             ccccccccCeEeecCCCCCccCcccccCCCCCCEEeccCcCCc-ccCccccCCCCCCEEecCCCCCcccccccccCCCCC
Q 003945          305 AISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSIT-EVPSSIELLPGLELLNLNDCKNFARVPSSINGLKSL  383 (784)
Q Consensus       305 ~l~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~L~~~~i~-~lp~~l~~l~~L~~L~L~~~~~~~~l~~~~~~l~~L  383 (784)
                      .+..+++|++|++++|...+..|..++.+++|+.|++++|.+. .+|..+..+++|+.|++++|.+.+.+|..+..+++|
T Consensus       413 ~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L  492 (768)
T 3rgz_A          413 TLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNL  492 (768)
T ss_dssp             GGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTC
T ss_pred             HHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCC
Confidence            5555666666666666655566666666666777777766666 556666677777777777777777777777777777


Q ss_pred             CEEEccCCCCCCcCCCCCCCCCCccEEecCCCccc-cCCccccccccccEEecCCCCCCCCCCCcccc----ccccc---
Q 003945          384 KTLNLSGCCKLENVPDTLGQVESLEELDISETAVR-RPPSSVFLMKNLRTLSFSGCNGPPSSASWHLH----LPFNL---  455 (784)
Q Consensus       384 ~~L~Ls~c~~l~~~~~~l~~l~~L~~L~l~~~~i~-~lp~~~~~l~~L~~L~l~~~~~l~~~~~~~~~----~~l~~---  455 (784)
                      ++|++++|...+.+|..++.+++|+.|++++|.+. .+|..+..+++|+.|++++|......+.....    .....   
T Consensus       493 ~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~  572 (768)
T 3rgz_A          493 NWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAG  572 (768)
T ss_dssp             CEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCS
T ss_pred             CEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccc
Confidence            77777777777777777777777777777777776 56777777777888877777632111111000    00000   


Q ss_pred             -----------------------------------------ccCccchhhccCCCCCCCCCCCEEecCCCCCCCCCCCcc
Q 003945          456 -----------------------------------------MGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSD  494 (784)
Q Consensus       456 -----------------------------------------~~~~~~~~~~~~~~l~~l~~L~~L~Ls~~~l~~~~~p~~  494 (784)
                                                               ....+...+..|..++.+++|+.|++++|.++ +.+|..
T Consensus       573 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~-g~ip~~  651 (768)
T 3rgz_A          573 KRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLS-GYIPKE  651 (768)
T ss_dssp             CEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCB-SCCCGG
T ss_pred             ccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCccc-ccCCHH
Confidence                                                     00113345566778889999999999999997 789999


Q ss_pred             cCCCCCCCEEecCCCCCc-ccchhhhcCCCCCeeccccccccCcCCCC---CCCceEEEecCCccceeec
Q 003945          495 IGNLHSLNELYLSKNNFV-TLPASINSLLNLKELEMEDCKRLQFLPQL---PPNIIFVKVNGCSSLVTLL  560 (784)
Q Consensus       495 l~~l~~L~~L~L~~n~l~-~lp~~i~~l~~L~~L~L~~c~~L~~i~~l---p~sL~~L~~~~C~~L~~l~  560 (784)
                      ++.+++|+.|+|++|+++ .+|..++.+++|+.|+|++|+.-..+|+.   .++|+.|+++++.--..+|
T Consensus       652 l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP  721 (768)
T 3rgz_A          652 IGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIP  721 (768)
T ss_dssp             GGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECC
T ss_pred             HhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCC
Confidence            999999999999999999 89999999999999999999877777753   2568888888776444444

PyMOL of 3rgz

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		784
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	1e-13
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	3e-09
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-09
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	7e-08
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	3e-06
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	0.003
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	3e-09
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	2e-06
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	5e-05
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	0.001
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	3e-06
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.002
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	9e-06
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	7e-05
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	2e-05
d1m9la_		198	c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree	6e-05
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	8e-05
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	2e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	0.002
d2omxa2		199	c.10.2.1 (A:37-235) Internalin B {Listeria monocyt	0.002
d2omxa2		199	c.10.2.1 (A:37-235) Internalin B {Listeria monocyt	0.003
d2ca6a1		344	c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom	0.002

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 70.1 bits (170), Expect = 1e-13
 Identities = 52/299 (17%), Positives = 99/299 (33%), Gaps = 25/299 (8%)

Query: 209 PNLEELYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQEL 268
           P+   L L+   K+ ++      + K     +L  LIL      +  P     +  L+ L
Sbjct: 31  PDTALLDLQNN-KITEIKDGDFKNLK-----NLHTLILINNKISKISPGAFAPLVKLERL 84

Query: 269 LLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQ 328
            L    +KELP  +      +++  N+   +        +   +  L  +          
Sbjct: 85  YLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENG 144

Query: 329 IVTTMEDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNL 388
               M+ LS + +  T+IT +P    L P L  L+L+  K      +S+ GL +L  L L
Sbjct: 145 AFQGMKKLSYIRIADTNITTIPQG--LPPSLTELHLDGNKITKVDAASLKGLNNLAKLGL 202

Query: 389 SGCCKLENVPDTLGQVESLEELDISETAVRRPPSSVFLMKNLRTLSFSGCNGPPSSASWH 448
           S          +L     L EL ++   + + P  +   K ++ +               
Sbjct: 203 SFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHN----------- 251

Query: 449 LHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAI-PSDIGNLHSLNELYL 506
                N +              +   S + + L    +    I PS    ++    + L
Sbjct: 252 -----NNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQL 305

PyMOL of d1xkua_

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		784
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.91
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.89
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.88
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.86
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.85
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.84
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.79
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.76
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.76
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.73
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.73
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.71
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.6
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.56
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.54
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.53
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.52
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.52
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.49
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.48
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.48
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.46
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.44
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.44
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.34
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.25
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.2
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.2
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.2
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.15
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.15
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.14
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.89
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.85
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.81
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.69
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.17
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.03
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.47
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.39
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.7
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.07

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.91  E-value=6.3e-23  Score=220.94  Aligned_cols=339  Identities=19%  Similarity=0.240  Sum_probs=207.9

Q ss_pred             CccEEEEecCCCCCCCCCCCCCCeeEEEeCCCCcccccccccCCCCccEEEcCCCCCCCCCCCCCCCCCccEEEecCCcc
Q 003945          142 KLRLLDWHRYPLKSLPSNLQLDKIVEFKMCYSRIEELWKGIKHLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTK  221 (784)
Q Consensus       142 ~Lr~L~l~~~~l~~lp~~~~l~~L~~L~L~~~~i~~l~~~~~~l~~L~~L~L~~~~~~~~~~~l~~l~~L~~L~L~~~~~  221 (784)
                      +|++|++++++++++...-.+++|++|++++|+++.++. ++++++|++|++++|.+.. ++.++.+++|+.|++.++. 
T Consensus        45 ~l~~L~l~~~~I~~l~gl~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n~i~~-i~~l~~l~~L~~L~~~~~~-  121 (384)
T d2omza2          45 QVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNNQIAD-ITPLANLTNLTGLTLFNNQ-  121 (384)
T ss_dssp             TCCEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSSCCCC-CGGGTTCTTCCEEECCSSC-
T ss_pred             CCCEEECCCCCCCCccccccCCCCCEEeCcCCcCCCCcc-ccCCccccccccccccccc-ccccccccccccccccccc-
Confidence            677777777777666422267777777777777777763 7777777777777776543 3447777777777776652 


Q ss_pred             CcccCccccccCcccccCCccEEEecCCCCCccccccccCCCcCcEEEecCCCccccChhhhcccCCceeeccCccCCCC
Q 003945          222 LRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSS  301 (784)
Q Consensus       222 l~~~~~~i~~l~~L~~l~~L~~L~ls~~~~~~~~~~~l~~l~~L~~L~l~~~~i~~lp~~i~~l~~L~~L~L~~~~~~~~  301 (784)
                      ...++...       ....+..+....+.+....+....................    .+.............+  ...
T Consensus       122 ~~~~~~~~-------~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~--~~~  188 (384)
T d2omza2         122 ITDIDPLK-------NLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLK----PLANLTTLERLDISSN--KVS  188 (384)
T ss_dssp             CCCCGGGT-------TCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCG----GGTTCTTCCEEECCSS--CCC
T ss_pred             cccccccc-------ccccccccccccccccccccccccccccccccccccchhh----hhcccccccccccccc--ccc
Confidence            22222111       1122222333322221111111111111111111111111    1112222222222221  222


Q ss_pred             CccccccccccCeEeecCCCCCccCcccccCCCCCCEEeccCcCCcccCccccCCCCCCEEecCCCCCcccccccccCCC
Q 003945          302 LPVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNFARVPSSINGLK  381 (784)
Q Consensus       302 lp~~l~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~L~~~~i~~lp~~l~~l~~L~~L~L~~~~~~~~l~~~~~~l~  381 (784)
                      .......+++++.++++++......|  ...+++|+.|++++|.++.++ .+..+++|+.|++++|.+.+..+  +..++
T Consensus       189 ~~~~~~~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~~~~-~l~~l~~L~~L~l~~n~l~~~~~--~~~~~  263 (384)
T d2omza2         189 DISVLAKLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKDIG-TLASLTNLTDLDLANNQISNLAP--LSGLT  263 (384)
T ss_dssp             CCGGGGGCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCCCCG-GGGGCTTCSEEECCSSCCCCCGG--GTTCT
T ss_pred             cccccccccccceeeccCCccCCCCc--ccccCCCCEEECCCCCCCCcc-hhhcccccchhccccCccCCCCc--ccccc
Confidence            23335567778888887765554333  345677888888888887765 46777888888888887654332  66778


Q ss_pred             CCCEEEccCCCCCCcCCCCCCCCCCccEEecCCCccccCCccccccccccEEecCCCCCCCCCCCcccccccccccCccc
Q 003945          382 SLKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSC  461 (784)
Q Consensus       382 ~L~~L~Ls~c~~l~~~~~~l~~l~~L~~L~l~~~~i~~lp~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~l~~~~~~~~  461 (784)
                      +|++|+++++...+. + .+..++.++.+.+..|.+..++ .+..+++++.|++++|....                   
T Consensus       264 ~L~~L~l~~~~l~~~-~-~~~~~~~l~~l~~~~n~l~~~~-~~~~~~~l~~L~ls~n~l~~-------------------  321 (384)
T d2omza2         264 KLTELKLGANQISNI-S-PLAGLTALTNLELNENQLEDIS-PISNLKNLTYLTLYFNNISD-------------------  321 (384)
T ss_dssp             TCSEEECCSSCCCCC-G-GGTTCTTCSEEECCSSCCSCCG-GGGGCTTCSEEECCSSCCSC-------------------
T ss_pred             cCCEeeccCcccCCC-C-cccccccccccccccccccccc-ccchhcccCeEECCCCCCCC-------------------
Confidence            888888887765432 2 3566778888888888887654 46778888888888876211                   


Q ss_pred             hhhccCCCCCCCCCCCEEecCCCCCCCCCCCcccCCCCCCCEEecCCCCCcccchhhhcCCCCCeeccccc
Q 003945          462 LVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDC  532 (784)
Q Consensus       462 ~~~~~~~~l~~l~~L~~L~Ls~~~l~~~~~p~~l~~l~~L~~L~L~~n~l~~lp~~i~~l~~L~~L~L~~c  532 (784)
                           .+.+..+++|++|++++|++++  ++ .++++++|++|++++|+++.+++ +.++++|+.|+|++|
T Consensus       322 -----l~~l~~l~~L~~L~L~~n~l~~--l~-~l~~l~~L~~L~l~~N~l~~l~~-l~~l~~L~~L~L~~N  383 (384)
T d2omza2         322 -----ISPVSSLTKLQRLFFANNKVSD--VS-SLANLTNINWLSAGHNQISDLTP-LANLTRITQLGLNDQ  383 (384)
T ss_dssp             -----CGGGGGCTTCCEEECCSSCCCC--CG-GGGGCTTCCEEECCSSCCCBCGG-GTTCTTCSEEECCCE
T ss_pred             -----CcccccCCCCCEEECCCCCCCC--Ch-hHcCCCCCCEEECCCCcCCCChh-hccCCCCCEeeCCCC
Confidence                 1125678889999999998853  44 58888999999999999888774 788889999988876

PyMOL of d2omza2

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure