Citrus Sinensis ID: 004056


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770------
MSLMEISIMHHVGIVLFLLWLLSYFDRCHPAAYFISLIYLYSVHDRYVMRLRRKVEFEERKNSFQRRVLKDSETVRWLNHAIEKMWPICMEQIASQKLLLPIIPWFLEKYKPWTAKKALVQHLYLGRNPPMLTEMRVLRQSNDDDHMVLELGMNFLTADDMSAILAVKLRKRLGFGMWAKMHVTGMHVEGKVLVGVKFLRRWPFIDRLRVCFAEPPYFQMTVKPIFTHGLDVTEFPGIAGWLDKLLSIAFEQTLVEPNMLVVDVDKFASPQPGNWFSVDVKEPVAYARVEVVEASDMKPSDLNGLADPYVKGQLGPYRFRTKTQRKTLSPKWHEEFNIPISTWDSPNVLVIEVRDKDHFVDDTLGDCTINISDLRDGQRHDMWIPLQNIKIGRLHLAITVLEESAKGVDSPCDGGTLNKEGMGNKEDQSNKEDIRESFANETTDKGSFSSVSSEKSPKVADNFEPINIEGQQETGIWVHQPGSEVAQTWEPRKGKNRRLDTLVRRVPNGSFNSTNSAASGSLNNDSSSTDDNQEGKNSIRRGLRKIGSMFQRNSRKEDHAGSIGEAVPSPRANLRAVNTKDVGVKFIVEDSLSGSIPVKATKDINVSSDESGPESPSRGHVKGMAKSIMKHAEKHARSIKHAFSRKDSTKRRGGTSPVTERELYVDSDSSDDESLPSSRLERIPDFPIPMSSCSTRDDNCDTKEQITRTSSSDPEADILGQTDKVSADSEEKKDDDEVNKTEGVDDGQIEFIKPELSEGDLKGAEDINRGAETDVS
cccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEccccccEEEEEEEEEccccccEEEEEEEEEEEccccccHHEEHHHHHcccccEEEEEEEEEEEEEEEEEEEEEcccccccccEEEEEEccccEEEEEEEEccccccccccccccHHHHHHHHHHHHHcccccccEEEEcccccccccccccccccccccEEEEEEEEEEccccccccccccccccEEEEEccEEEEEEEccccccccEEEEEEEEccccccccEEEEEEEEcccccccEEEEEEEEcccccccccEEEEEEccccccEEEEEEEEEEEccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccEEEEEEEEEccccccEEEEEEEEEEccccccEEEEEEEHEEHHEEEEEEEEEEEcEEEEEEEEEEEEEccccccEEEEEEEEEccccEEEEEEEEEcccccHcccccHHHHHHHHHHHHHHHHccccccEEEEcccccccccccEccccccccccEEEEEEEEcccccccccccccccEEEEEEccccEEcEEEEccccccccEEEEEEEEccccccEEEEEEEEcccccccccEEEEEEHHHcccccccEEEEEcccccccEEEEEEEEEccccccccHHHHHHHHHHHcccccccHHccHHHHHHHHHcccccccccccccccccEEccEEEEEEEEccccccEEEccccccccEEEEEEcccccEEEEEEEccccccccccEccHHHHHccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccEEEEccHccccccccccccccccHHHHcccccHcccccccHHHHHcccccccc
MSLMEISIMHHVGIVLFLLWLLSyfdrchpaaYFISLIYLYSVHDRYVMRLRRKVEFEERKNSFQRRVLKDSETVRWLNHAIEKMWPICMEQIASQKLLLPiipwflekykpwtAKKALVQHLylgrnppmlTEMRVLRQSNDDDHMVLELGMNFLTADDMSAILAVKLRKRLGFGMWAKMHVTGMHVEGKVLVGVKflrrwpfidrlrvcfaeppyfqmtvkpifthgldvtefpgiAGWLDKLLSIAFEQtlvepnmlvvdvdkfaspqpgnwfsvdvkePVAYARVEVveasdmkpsdlngladpyvkgqlgpyrfrtktqrktlspkwheefnipistwdspnvlvievrdkdhfvddtlgdctinisdlrdgqrhdmwiplqnikigRLHLAITVLEesakgvdspcdggtlnkegmgnkedqsnkeDIRESFanettdkgsfssvssekspkvadnfepiniegqqetgiwvhqpgsevaqtweprkgknrrlDTLVrrvpngsfnstnsaasgslnndssstddnqegkNSIRRGLRKIGSMfqrnsrkedhagsigeavpspranlravntkdvGVKFIVEdslsgsipvkatkdinvssdesgpespsrghvkGMAKSIMKHAEKHARSIKHAfsrkdstkrrggtspvterelyvdsdssddeslpssrleripdfpipmsscstrddncdtkeqitrtsssdpeadilgqtdkvsadseekkdddevnktegvddgqiefikpelsegdlkgaedinrgaetdvs
MSLMEISIMHHVGIVLFLLWLLSYFDRCHPAAYFISLIYLYSVHDRYVMRLRrkvefeerknsfqrrvlkdsetvRWLNHAIEKMWPICMEQIASQKLLLPIIPWFLEKYKPWTAKKALVQHLYLGRNPPMLTEMRVLRQSNDDDHMVLELGMNFLTADDMSAILAVKLRKRLGFGMWAKMHVTGMHVEGKVLVGVKFLRRWPFIDRLRVCFAEPPYFQMTVKPIFTHGLDVTEFPGIAGWLDKLLSIAFEQTLVEPNMLVVDVDKFAspqpgnwfsvdvKEPVAYARVEVVeasdmkpsdlngladpyvkgqlgpyrfrtktqrktlspkwheefnipistwdspnVLVIEVRDKdhfvddtlgdCTINIsdlrdgqrhDMWIPLQNIKIGRLHLAITVLEesakgvdspcdggtlnkegmgnkedqsnkEDIRESFAnettdkgsfssvssekspkvADNFEPINIEGQQETGIWVHQPGsevaqtweprkgknrrldtlvrrvpngsfnstnsaasgslnndssstddnqegknsirrglRKIGSMfqrnsrkedhagsigeavpspranlravntKDVGVKFIvedslsgsipvkatkdinvssdesgpespsrghVKGMAKSIMKHAEKHARSikhafsrkdstkrrggtspvterelyvdsdssddeslpssrleripdfpipmsscstrddncDTKEQitrtsssdpeadilgqtdkvsadseekkdddevnktegvddgqiefikpelsegdlkgaedinrgaetdvs
MSLMEISIMHHVGIVLFLLWLLSYFDRCHPAAYFISLIYLYSVHDRYVMRLRRKVEFEERKNSFQRRVLKDSETVRWLNHAIEKMWPICMEQIASQKLLLPIIPWFLEKYKPWTAKKALVQHLYLGRNPPMLTEMRVLRQSNDDDHMVLELGMNFLTADDMSAILAVKLRKRLGFGMWAKMHVTGMHVEGKVLVGVKFLRRWPFIDRLRVCFAEPPYFQMTVKPIFTHGLDVTEFPGIAGWLDKLLSIAFEQTLVEPNMLVVDVDKFASPQPGNWFSVDVKEPVAYARVEVVEASDMKPSDLNGLADPYVKGQLGPYRFRTKTQRKTLSPKWHEEFNIPISTWDSPNVLVIEVRDKDHFVDDTLGDCTINISDLRDGQRHDMWIPLQNIKIGRLHLAITVLEESAKGVDSPCDGGTLNKEGMGNKEDQSNKEDIRESFANETTDKGsfssvsseksPKVADNFEPINIEGQQETGIWVHQPGSEVAQTWEPRKGKNRRLDTLVRRVPNGSFNSTnsaasgslnndssstddnQEGKNSIRRGLRKIGSMFQRNSRKEDHAGSIGEAVPSPRANLRAVNTKDVGVKFIVEDSLSGSIPVKATKDINVSSDESGPESPSRGHVKGMAKSIMKHAEKHARSIKHAFSRKDSTKRRGGTSPVTERELYVdsdssddeslpssRLERIPDFPIPMSSCSTRDDNCDTKEQITRTSSSDPEADILGQTdkvsadseekkdddevNKTEGVDDGQIEFIKPELSEGDLKGAEDINRGAETDVS
****EISIMHHVGIVLFLLWLLSYFDRCHPAAYFISLIYLYSVHDRYVMRLRRKVEFEERKNSFQRRVLKDSETVRWLNHAIEKMWPICMEQIASQKLLLPIIPWFLEKYKPWTAKKALVQHLYLGRNPPMLTEMRVLRQSNDDDHMVLELGMNFLTADDMSAILAVKLRKRLGFGMWAKMHVTGMHVEGKVLVGVKFLRRWPFIDRLRVCFAEPPYFQMTVKPIFTHGLDVTEFPGIAGWLDKLLSIAFEQTLVEPNMLVVDVDKFASPQPGNWFSVDVKEPVAYARVEVVEA*******LNGLADPYVKGQLGPYRFRTKTQRKTLSPKWHEEFNIPISTWDSPNVLVIEVRDKDHFVDDTLGDCTINISDLRDGQRHDMWIPLQNIKIGRLHLAITVLE***********************************************************************TGIWVH*************************************************************************************************VNTKDVGVKFIVED******************************************************************************************************************************************************************************************
***MEISIMHHVGIVLFLLWLLSYFDRCHPAAYFISLIYLYSVHDRYVMRLRRKVEFEERKNSFQRRVLKDSETVRWLNHAIEKMWPICMEQIASQKLLLPIIPWFLEKYKPWTAKKALVQHLYLGRNPPMLTEMRVLRQSNDDDHMVLELGMNFLTADDMSAILAVKLRKRLGFGMWAKMHVTGMHVEGKVLVGVKFLRRWPFIDRLRVCFAEPPYFQMTVKPIFTHGLDVTEFPGIAGWLDKLLSIAFEQTLVEPNMLVVDVDKFASPQPGNWFSVDVKEPVAYARVEVVEASDMK***L*GLADPYVKGQLGPYRFRTKTQRKTLSPKWHEEFNIPISTWDSPNVLVIEVRDKDHFVDDTLGDCTINISDLRDGQRHDMWIPLQNIKIGRLHLAITVLEES************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************
MSLMEISIMHHVGIVLFLLWLLSYFDRCHPAAYFISLIYLYSVHDRYVMRLRRKVEFEERKNSFQRRVLKDSETVRWLNHAIEKMWPICMEQIASQKLLLPIIPWFLEKYKPWTAKKALVQHLYLGRNPPMLTEMRVLRQSNDDDHMVLELGMNFLTADDMSAILAVKLRKRLGFGMWAKMHVTGMHVEGKVLVGVKFLRRWPFIDRLRVCFAEPPYFQMTVKPIFTHGLDVTEFPGIAGWLDKLLSIAFEQTLVEPNMLVVDVDKFASPQPGNWFSVDVKEPVAYARVEVVEASDMKPSDLNGLADPYVKGQLGPYRFRTKTQRKTLSPKWHEEFNIPISTWDSPNVLVIEVRDKDHFVDDTLGDCTINISDLRDGQRHDMWIPLQNIKIGRLHLAITVLEESAKGVDSPCDGGTLNKEGMG*********DIRESFAN*******************ADNFEPINIEGQQETGIWVHQPGSEVAQTWEPRKGKNRRLDTLVRRVPNGSFNSTNS*********************SIRRGLRKIGSMFQ************GEAVPSPRANLRAVNTKDVGVKFIVEDSLSGSIPVKATKDI******************GMAK***********SIKHAF***************TERE****************RLERIPDFPIPMSSC********************PEADILGQT******************TEGVDDGQIEFIKPELSEGDLKGAEDINRGAETDVS
*SLMEISIMHHVGIVLFLLWLLSYFDRCHPAAYFISLIYLYSVHDRYVMRLRRKVEFEERKNSFQRRVLKDSETVRWLNHAIEKMWPICMEQIASQKLLLPIIPWFLEKYKPWTAKKALVQHLYLGRNPPMLTEMRVLRQSNDDDHMVLELGMNFLTADDMSAILAVKLRKRLGFGMWAKMHVTGMHVEGKVLVGVKFLRRWPFIDRLRVCFAEPPYFQMTVKPIFTHGLDVTEFPGIAGWLDKLLSIAFEQTLVEPNMLVVDVDKFASPQPGNWFSVDVKEPVAYARVEVVEASDMKPSDLNGLADPYVKGQLGPYRFRTKTQRKTLSPKWHEEFNIPISTWDSPNVLVIEVRDKDHFVDDTLGDCTINISDLRDGQRHDMWIPLQNIKIGRLHLAITVLEESAKGVDSPCDGGTLNKEGMGNKEDQSNKEDIRESFANETTDKGSFSSVSSEKSPKVADNFEPINIEGQQETGIWVHQPGSEVAQTWEPRKGKNRRLDTLVRRVPNGSFNSTNSAASGSLNNDSSSTDDNQEGKNSIRRGLRKIGSMFQR***************************************************************************************************************************************************CDTKEQITRTSSSDPEADILGQTDKVSADS***********************************************
iiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLMEISIMHHVGIVLFLLWLLSYFDRCHPAAYFISLIYLYSVHDRYVMRLRRKVEFEERKNSFQRRVLKDSETVRWLNHAIEKMWPICMEQIASQKLLLPIIPWFLEKYKPWTAKKALVQHLYLGRNPPMLTEMRVLRQSNDDDHMVLELGMNFLTADDMSAILAVKLRKRLGFGMWAKMHVTGMHVEGKVLVGVKFLRRWPFIDRLRVCFAEPPYFQMTVKPIFTHGLDVTEFPGIAGWLDKLLSIAFEQTLVEPNMLVVDVDKFASPQPGNWFSVDVKEPVAYARVEVVEASDMKPSDLNGLADPYVKGQLGPYRFRTKTQRKTLSPKWHEEFNIPISTWDSPNVLVIEVRDKDHFVDDTLGDCTINISDLRDGQRHDMWIPLQNIKIGRLHLAITVLEESAKGVDSPCDGGTLNKEGMGNKEDQSNKEDIRESFANETTDKGSFSSVSSEKSPKVADNFEPINIEGQQETGIWVHQPGSEVAQTWEPRKGKNRRLDTLVRRVPNGSFNSTNSAASGSLNNDSSSTDDNQEGKNSIRRGLRKIGSMFQRNSRKEDHAGSIGEAVPSPRANLRAVNTKDVGVKFIVEDSLSGSIPVKATKDINVSSDESGPESPSRGHVKGMAKSIMKHAEKHARSIKHAFSRKDSTKRRGGTSPVTERELYVDSDSSDDESLPSSRLERIPDFPIPMSSCSTRDDNCDTKEQITRTSSSDPEADILGQTDKVSADSEEKKDDDEVNKTEGVDDGQIEFIKPELSEGDLKGAEDINRGAETDVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query776 2.2.26 [Sep-21-2011]
Q93XX4751 C2 domain-containing prot yes no 0.929 0.960 0.605 0.0
Q5DTI8891 Extended synaptotagmin-3 yes no 0.463 0.404 0.260 5e-20
A0FGR9886 Extended synaptotagmin-3 yes no 0.456 0.399 0.243 3e-18
Q8L706560 Synaptotagmin-5 OS=Arabid no no 0.476 0.660 0.229 5e-18
Q5M7N9889 Extended synaptotagmin-3 yes no 0.390 0.340 0.233 2e-17
A0JJX5569 Synaptotagmin-4 OS=Arabid no no 0.389 0.530 0.246 4e-15
A0FGR8921 Extended synaptotagmin-2 no no 0.381 0.321 0.234 9e-15
Q3TZZ7845 Extended synaptotagmin-2 no no 0.381 0.350 0.237 1e-14
Q03640 1545 Tricalbin-3 OS=Saccharomy yes no 0.391 0.196 0.233 7e-14
Q9ZVT9 1020 C2 and GRAM domain-contai no no 0.132 0.100 0.403 3e-13
>sp|Q93XX4|C2D61_ARATH C2 domain-containing protein At1g53590 OS=Arabidopsis thaliana GN=NTMC2T6.1 PE=1 SV=2 Back     alignment and function desciption
 Score =  912 bits (2356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/771 (60%), Positives = 567/771 (73%), Gaps = 50/771 (6%)

Query: 4   MEISIMHHVGIVLFLLWLLSYFDRCHPAAYFISLIYLYSVHDRYVMRLRRKVEFEERKNS 63
           ME S++HH+ IVL LLW +S  +R H   YF++LIYLY VH+RYVMRL+RK++FEERK +
Sbjct: 1   MESSLIHHIIIVLLLLWFISSLNRSHAFFYFLALIYLYLVHERYVMRLKRKLQFEERKQA 60

Query: 64  FQRRVLKDSETVRWLNHAIEKMWPICMEQIASQKLLLPIIPWFLEKYKPWTAKKALVQHL 123
            QRRVL DSE+VRW+N+A+EK+WPICMEQIASQK+L PIIPWFLEKY+PWTAKKA++QHL
Sbjct: 61  NQRRVLSDSESVRWMNYAVEKIWPICMEQIASQKILGPIIPWFLEKYRPWTAKKAVIQHL 120

Query: 124 YLGRNPPMLTEMRVLRQSNDDDHMVLELGMNFLTADDMSAILAVKLRKRLGFGMWAKMHV 183
           Y+GRNPP+LT++RVLRQS  DDH+VLELGMNFL ADDMSAILAVKLRKRLGFGMW K+H+
Sbjct: 121 YMGRNPPLLTDIRVLRQSTGDDHLVLELGMNFLAADDMSAILAVKLRKRLGFGMWTKLHL 180

Query: 184 TGMHVEGKVLVGVKFLRRWPFIDRLRVCFAEPPYFQMTVKPIFTHGLDVTEFPGIAGWLD 243
           TGMHVEGKVL+GVKFLRRWPF+ RLRVCFAEPPYFQMTVKPIFTHGLDV   PGIAGWLD
Sbjct: 181 TGMHVEGKVLIGVKFLRRWPFLGRLRVCFAEPPYFQMTVKPIFTHGLDVAVLPGIAGWLD 240

Query: 244 KLLSIAFEQTLVEPNMLVVDVDKFASPQPGNWFSVDVKEPVAYARVEVVEASDMKPSDLN 303
           KLLSIAFEQTLV+PNMLVVD++KF SP   NWF VD KEPVA+  VEV EASD+KPSDLN
Sbjct: 241 KLLSIAFEQTLVQPNMLVVDMEKFVSPTSENWFFVDEKEPVAHVLVEVFEASDLKPSDLN 300

Query: 304 GLADPYVKGQLGPYRFRTKTQRKTLSPKWHEEFNIPISTWDSPNVLVIEVRDKDHFVDDT 363
           GLADPYVKG+LG YRF+TK Q+KTLSPKWHEEF IPI TWDSP++L IEV DKD FVDDT
Sbjct: 301 GLADPYVKGKLGAYRFKTKIQKKTLSPKWHEEFKIPIFTWDSPSILNIEVGDKDRFVDDT 360

Query: 364 LGDCTINISDLRDGQRHDMWIPLQNIKIGRLHLAITVLEESAKGVDSPCDGGTLNKEGMG 423
           LG+C++NI + R GQR+DMW+ LQNIK+GRLHLAITV+E++AK  D P            
Sbjct: 361 LGECSVNIEEFRGGQRNDMWLSLQNIKMGRLHLAITVIEDNAKSSDDPL----------- 409

Query: 424 NKEDQSNKEDIRESFANETTDKGSFSSVSSEKSPKVADNFEPINIEGQQETGIWVHQPGS 483
            K+ + NKEDI+ SFA++TT+ GSF   SS+KSP V DNFEPI I+GQ+ET IWV +PG+
Sbjct: 410 -KKAKLNKEDIQTSFASDTTNLGSF---SSDKSPSVVDNFEPIKIDGQEETAIWVQKPGA 465

Query: 484 EVAQTWEPRKGKNRRLDTLVRRVPNGSFNSTNSAASGSLNNDSSSTDDNQEG-KN---SI 539
           EV+Q WEPRKGK+RRLD+ ++R PN            SL+N SSSTDDNQEG KN   S+
Sbjct: 466 EVSQIWEPRKGKSRRLDSQIQRTPNDE----------SLSNGSSSTDDNQEGSKNPMKSV 515

Query: 540 RRGLRKIGSMFQRNSRKEDH-AGSIGE--AVPSPRANLRAVNTKDVGVKFIVEDSLSGSI 596
            RGLRKIGSMF RN +KE+   GSI E     SPR NL+AVN KDVG+ FIV+D+LSG +
Sbjct: 516 GRGLRKIGSMFHRNVKKEEFLIGSIEEESQSQSPRINLKAVNQKDVGLNFIVDDNLSGPL 575

Query: 597 PVKATKDINVSSDESGPESPSRGHVKGMAKSIMKHAEKHARSIKHAFSRKDSTKRRGGTS 656
             K+    ++ ++E+      +GH+K +AKS +K AEK A+ IKHAFSRK S K R G  
Sbjct: 576 SGKSLDGESLDAEENS----GKGHMKDVAKSFLKQAEKSAKQIKHAFSRKGSMKPRDGHK 631

Query: 657 PVTERELYVDSDSSDDESLPSSRLERIPDFPIPMSSCSTRDDNCD-------TKEQITRT 709
            +           S D+    + ++ +   P  +    TRD N +              T
Sbjct: 632 EIVPESDSGTDSESSDDDDAFTCVKNLATEPGKL----TRDGNIERTGDDDHVDSTTLAT 687

Query: 710 SSSDPEADILGQTDKVSADSEEKKDDDEVNKTEGVDDGQIEFIKPELSEGD 760
           +  D   DIL  +  V A  E+ K   E  ++E  D      IK E  +GD
Sbjct: 688 AKEDSSGDILEDSTDVEAKEEKLK---EAAESETRDMDTAMNIKTEDEKGD 735





Arabidopsis thaliana (taxid: 3702)
>sp|Q5DTI8|ESYT3_MOUSE Extended synaptotagmin-3 OS=Mus musculus GN=Esyt3 PE=2 SV=2 Back     alignment and function description
>sp|A0FGR9|ESYT3_HUMAN Extended synaptotagmin-3 OS=Homo sapiens GN=ESYT3 PE=2 SV=1 Back     alignment and function description
>sp|Q8L706|SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana GN=SYT5 PE=2 SV=1 Back     alignment and function description
>sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropicalis GN=esyt3 PE=2 SV=1 Back     alignment and function description
>sp|A0JJX5|SYT4_ARATH Synaptotagmin-4 OS=Arabidopsis thaliana GN=SYT4 PE=2 SV=1 Back     alignment and function description
>sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens GN=ESYT2 PE=1 SV=1 Back     alignment and function description
>sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus GN=Esyt2 PE=1 SV=1 Back     alignment and function description
>sp|Q03640|TCB3_YEAST Tricalbin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB3 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZVT9|C2GR1_ARATH C2 and GRAM domain-containing protein At1g03370 OS=Arabidopsis thaliana GN=At1g03370 PE=2 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query776
255578544765 conserved hypothetical protein [Ricinus 0.965 0.979 0.671 0.0
359494388771 PREDICTED: C2 domain-containing protein 0.951 0.957 0.633 0.0
297834336742 integral membrane single C2 domain prote 0.884 0.924 0.657 0.0
356549572766 PREDICTED: C2 domain-containing protein 0.850 0.861 0.672 0.0
224061351729 integral membrane single C2 domain prote 0.894 0.951 0.650 0.0
356549574757 PREDICTED: C2 domain-containing protein 0.838 0.859 0.666 0.0
449456673730 PREDICTED: C2 domain-containing protein 0.841 0.894 0.677 0.0
449503642731 PREDICTED: C2 domain-containing protein 0.841 0.893 0.677 0.0
18404532751 calcium-dependent lipid-binding domain [ 0.929 0.960 0.605 0.0
15451210751 Unknown protein [Arabidopsis thaliana] 0.929 0.960 0.604 0.0
>gi|255578544|ref|XP_002530135.1| conserved hypothetical protein [Ricinus communis] gi|223530360|gb|EEF32251.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score = 1056 bits (2731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/766 (67%), Positives = 623/766 (81%), Gaps = 17/766 (2%)

Query: 1   MSLMEISIMHHVGIVLFLLWLLSYFDRCHPAAYFISLIYLYSVHDRYVMRLRRKVEFEER 60
           M + E SIMHHVGI+LF+LWLLSYF+RCHP A+FISLIYLY VH+RYVMRLRRK++F+ER
Sbjct: 1   MDITETSIMHHVGIILFVLWLLSYFNRCHPFAFFISLIYLYLVHERYVMRLRRKLQFQER 60

Query: 61  KNSFQRRVLKDSETVRWLNHAIEKMWPICMEQIASQKLLLPIIPWFLEKYKPWTAKKALV 120
           K + Q+R L DSE+VRWLNHA+EK+WPICMEQIASQK+LLPIIPWFLEKYKPWTAKKA+V
Sbjct: 61  KQANQKRALSDSESVRWLNHAVEKIWPICMEQIASQKILLPIIPWFLEKYKPWTAKKAVV 120

Query: 121 QHLYLGRNPPMLTEMRVLRQSNDDDHMVLELGMNFLTADDMSAILAVKLRKRLGFGMWAK 180
           QH+YLGR PP+ TEMRVLR+   DDH+VLELGMNF TADDMS++LAVKLR+RLGFGMWAK
Sbjct: 121 QHMYLGRTPPLFTEMRVLRECTGDDHLVLELGMNFCTADDMSSVLAVKLRRRLGFGMWAK 180

Query: 181 MHVTGMHVEGKVLVGVKFLRRWPFIDRLRVCFAEPPYFQMTVKPIFTHGLDVTEFPGIAG 240
           +H+T MHVEGKVL+GVKFL  WPF+ RLR+CFAEPPYFQMTVKP+FTHGLDVTE PGIAG
Sbjct: 181 LHMTAMHVEGKVLIGVKFLSHWPFLGRLRICFAEPPYFQMTVKPVFTHGLDVTELPGIAG 240

Query: 241 WLDKLLSIAFEQTLVEPNMLVVDVDKFASPQPGNWFSVDVKEPVAYARVEVVEASDMKPS 300
           WLDKLLS+AFEQTLV+PNMLVVD++KFASP+P NWFSVD KEP+AY +VEV+EA+DMKPS
Sbjct: 241 WLDKLLSVAFEQTLVQPNMLVVDMEKFASPKPENWFSVDEKEPIAYVKVEVMEATDMKPS 300

Query: 301 DLNGLADPYVKGQLGPYRFRTKTQRKTLSPKWHEEFNIPISTWDSPNVLVIEVRDKDHFV 360
           DLNGLADPYVKGQLG Y+FRTK QRKTL+PKW EEF IPI TWDSPNVLVIEVRDKDHFV
Sbjct: 301 DLNGLADPYVKGQLGSYKFRTKIQRKTLAPKWQEEFKIPICTWDSPNVLVIEVRDKDHFV 360

Query: 361 DDTLGDCTINISDLRDGQRHDMWIPLQNIKIGRLHLAITVLEESAKGVDSPCDGGTLNKE 420
           DD+LGDC INI+DLRDG RHDMW+PLQNIKIGRLHLAITVLEE+AK   +  DG TL+KE
Sbjct: 361 DDSLGDCIININDLRDGGRHDMWLPLQNIKIGRLHLAITVLEENAKVGANIFDGDTLSKE 420

Query: 421 GMGNKEDQSNKEDIRESFANETTDKGSF-SSVSSEKSPKVADNFEPINIEGQQETGIWVH 479
            M            ++SF NET ++ SF SS +S+KSP+V DN EPINIEGQ++TGIWVH
Sbjct: 421 EM------------QDSFINETANRASFSSSTASDKSPRVIDNLEPINIEGQEQTGIWVH 468

Query: 480 QPGSEVAQTWEPRKGKNRRLDTLVRRVPNGSFNSTNSAASGSLNNDSSSTDDNQEGK--- 536
           QPG+EV+QTWEPRKGK+ RLD+  RRVP  SF S+N   SG LNNDSSS+D+N +GK   
Sbjct: 469 QPGNEVSQTWEPRKGKSMRLDSRARRVPGDSFGSSNLPVSGPLNNDSSSSDENVDGKSSM 528

Query: 537 NSIRRGLRKIGSMFQRNSRKEDHAGSIGEAVPSPRANLRAVNTKDVGVKFIVEDSLSGSI 596
           N ++RGLRKI S+F R S+KED  GS  +AV SP AN++AVN K++GV F+VEDSLSGS 
Sbjct: 529 NRVQRGLRKISSVFHRGSKKEDSMGSNEDAVQSPYANIKAVNQKEIGVTFVVEDSLSGST 588

Query: 597 PVKATKDINVSSDESGPESPSRGHVKGMAKSIMKHAEKHARSIKHAFSRKDSTKRRGGTS 656
            VK +  +N+S D   PE+P +G+VK  AKSI+KHAEK ARSI+H  SRK S K RG +S
Sbjct: 589 VVKNSNAVNLSPDGIAPETPGKGNVKDRAKSILKHAEKSARSIRHVLSRKGSRKSRGDSS 648

Query: 657 PVTERELYVDSDSSDDESLPSSRLERIPDFPIPMSSCSTRDDNCDTKEQITRTSSSDPEA 716
            VTE E+Y +S+SSDDE L SS++E+IP    P ++    DD    ++ + +  S +   
Sbjct: 649 VVTELEIYPESESSDDEELSSSQVEKIPIVSCPTTNTCGNDDADKVEDNVVQVDSVELVT 708

Query: 717 DILGQTDKVSADSEEKKDDDEVNKTEGVDDGQIEFIKPELSEGDLK 762
           D  GQ +KV+ ++ E  D+++V+   G ++ + EF KP+LS+  L+
Sbjct: 709 DTEGQMNKVNVEALESGDENKVSSFSGGNELE-EFSKPQLSDEKLE 753




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359494388|ref|XP_002267637.2| PREDICTED: C2 domain-containing protein At1g53590-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297834336|ref|XP_002885050.1| integral membrane single C2 domain protein [Arabidopsis lyrata subsp. lyrata] gi|297330890|gb|EFH61309.1| integral membrane single C2 domain protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356549572|ref|XP_003543166.1| PREDICTED: C2 domain-containing protein At1g53590-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|224061351|ref|XP_002300437.1| integral membrane single C2 domain protein [Populus trichocarpa] gi|222847695|gb|EEE85242.1| integral membrane single C2 domain protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356549574|ref|XP_003543167.1| PREDICTED: C2 domain-containing protein At1g53590-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|449456673|ref|XP_004146073.1| PREDICTED: C2 domain-containing protein At1g53590-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449503642|ref|XP_004162104.1| PREDICTED: C2 domain-containing protein At1g53590-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18404532|ref|NP_564637.1| calcium-dependent lipid-binding domain [Arabidopsis thaliana] gi|332278165|sp|Q93XX4.2|C2D61_ARATH RecName: Full=C2 domain-containing protein At1g53590; AltName: Full=N-terminal-TM-C2 domain type 6 protein 1; Short=NTMC2TYPE6.1 gi|332194846|gb|AEE32967.1| calcium-dependent lipid-binding domain [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15451210|gb|AAK96876.1| Unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query776
TAIR|locus:2089601737 NTMC2T6.2 [Arabidopsis thalian 0.822 0.865 0.648 9.6e-231
TAIR|locus:2024912751 NTMC2T6.1 [Arabidopsis thalian 0.631 0.652 0.710 2.2e-201
TAIR|locus:2201036560 NTMC2T2.1 "AT1G05500" [Arabido 0.444 0.616 0.236 2.8e-19
TAIR|locus:2095062815 ATSYTF "AT3G18370" [Arabidopsi 0.158 0.150 0.333 2.9e-18
ASPGD|ASPL0000040774 1506 AN9149 [Emericella nidulans (t 0.476 0.245 0.239 4.5e-17
ZFIN|ZDB-GENE-050809-35861 esyt3 "extended synaptotagmin- 0.390 0.351 0.237 1.7e-16
TAIR|locus:2184931569 SYTD "AT5G11100" [Arabidopsis 0.396 0.541 0.235 4.6e-16
MGI|MGI:1098699891 Esyt3 "extended synaptotagmin- 0.414 0.361 0.269 1e-15
UNIPROTKB|A0FGR9886 ESYT3 "Extended synaptotagmin- 0.417 0.365 0.256 7.6e-15
UNIPROTKB|A0FGR8921 ESYT2 "Extended synaptotagmin- 0.405 0.342 0.26 1.7e-14
TAIR|locus:2089601 NTMC2T6.2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2226 (788.7 bits), Expect = 9.6e-231, P = 9.6e-231
 Identities = 432/666 (64%), Positives = 517/666 (77%)

Query:     4 MEISIMHHVGIVLFLLWLLSYFDRCHPAAYFISLIYLYSVHDRYVMRLRRKVEFEERKNS 63
             ME S++HHV IVL LLW+LSY +R H   Y +SL+YLY VH+RYVMRLR+K++FEERK +
Sbjct:     1 MECSVIHHVVIVLLLLWVLSYLNRSHAVFYVLSLVYLYLVHERYVMRLRKKLQFEERKQA 60

Query:    64 FQRRVLKDSETVRWLNHAIEKMWPICMEQIASQKLLLPIIPWFLEKYKPWTAKKALVQHL 123
              QRRVL DSE+VRWLNHA+E++WPICMEQIASQK+L PIIPWFL+KY+PWTAKK ++QHL
Sbjct:    61 NQRRVLSDSESVRWLNHAVERIWPICMEQIASQKILRPIIPWFLDKYRPWTAKKVVIQHL 120

Query:   124 YLGRNPPMLTEMRVLRQSNDDDHMVLELGMNFLTADDMSAILAVKLRKRLGFGMWAKMHV 183
             YLGRNPP+LT++RVLRQS  DDH+VLELGMNFLTADDMSAILAVKLRKRLGFGMW K+H+
Sbjct:   121 YLGRNPPLLTDIRVLRQSTGDDHLVLELGMNFLTADDMSAILAVKLRKRLGFGMWTKLHL 180

Query:   184 TGMHVEGKVLVGVKFLRRWPFIDRLRVCFAEPPYFQMTVKPIFTHGLDVTEFPGIAGWLD 243
             TGMHVEGKVL+GVKFLRRWPF+ RLRVCFAEPPYFQMTVKPI THGLDV   PGIAGWLD
Sbjct:   181 TGMHVEGKVLIGVKFLRRWPFLGRLRVCFAEPPYFQMTVKPITTHGLDVAVLPGIAGWLD 240

Query:   244 KLLSIAFEQTLVEPNMLVVDVDKFASPQPG-NWFSVDVKEPVAYARVEVVEASDMKPSDL 302
             KLLS+AFEQTLVEPNMLVVD++KF SP+ G NWF VD KEPVA+A VEVVEA D+KPSDL
Sbjct:   241 KLLSVAFEQTLVEPNMLVVDMEKFVSPESGDNWFFVDEKEPVAHALVEVVEACDVKPSDL 300

Query:   303 NGLADPYVKGQLGPYRFRTKTQRKTLSPKWHEEFNIPISTWDSPNVLVIEVRDKDHFVDD 362
             NGLADPYVKGQLG YRF+TK   KTL+PKW EEF IPI TWDS N+L IEV+DKD F DD
Sbjct:   301 NGLADPYVKGQLGAYRFKTKILWKTLAPKWQEEFKIPICTWDSANILNIEVQDKDRFSDD 360

Query:   363 TLGDCTINISDLRDGQRHDMWIPLQNIKIGRLHLAITVLEESAKGVDSPCDGGTLNKEGM 422
             +LGDC++NI++ R GQR+DMW+PLQNIK+GRLHLAITVLE+ AK  D P +G T+ KE  
Sbjct:   361 SLGDCSVNIAEFRGGQRNDMWLPLQNIKMGRLHLAITVLEDEAKLNDDPFEGVTICKE-- 418

Query:   423 GNKEDQSNKEDIRESFANETTDKGXXXXXXXXXXPKVADNFEPINIEGQQETGIWVHQPG 482
                       D+  SFA++ T+KG          P+V DN EPINIEGQ+ETGIWVHQPG
Sbjct:   419 ----------DMWASFASDVTNKGSFSSVVSDKSPRVPDNMEPINIEGQEETGIWVHQPG 468

Query:   483 SEVAQTWEPRKGKNRRLDTLVRRVPNGSFNSTXXXXXXXXXXXXXXXXXXQEGKNSIRR- 541
             +EV+Q WEPRKGK+R LD  ++    GS  ST                  QEGK+ ++  
Sbjct:   469 TEVSQIWEPRKGKSRCLDNKIQCA--GSVRSTASTSPNNESSSTDKN---QEGKSEMKSV 523

Query:   542 --GLRKIGSMFQRNSRKED--HAGSIGEAVPSPRANLRAVNTKDVGVKFIVEDSLSGSIP 597
               GL+KIG +F +N +KE+  H GSI E + SPR NL+A+N KDVGVKFIVED LSG + 
Sbjct:   524 GWGLKKIGLVFHKNGKKEECHHTGSIEEDIRSPRINLKALNQKDVGVKFIVEDRLSGPLT 583

Query:   598 VKATKDINVSSDESGPESPSRGHVKGMAKSIMKHAEKHARSIKHAFSRKDSTKRRGGT-S 656
              ++ K  +  S++S      + H+K +AKSI+KHAEK AR +KHAFS K S K R    S
Sbjct:   584 GRSPKGESFDSEDS----QHKRHMKDVAKSILKHAEKSARHLKHAFSHKGSRKSRDDECS 639

Query:   657 PVTERE 662
              V+E++
Sbjct:   640 TVSEQD 645




GO:0005576 "extracellular region" evidence=ISM
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2024912 NTMC2T6.1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201036 NTMC2T2.1 "AT1G05500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095062 ATSYTF "AT3G18370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000040774 AN9149 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050809-35 esyt3 "extended synaptotagmin-like protein 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2184931 SYTD "AT5G11100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1098699 Esyt3 "extended synaptotagmin-like protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A0FGR9 ESYT3 "Extended synaptotagmin-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A0FGR8 ESYT2 "Extended synaptotagmin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q93XX4C2D61_ARATHNo assigned EC number0.60570.92910.9600yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
NTMC2T6.1
NTMC2T6.1; NTMC2T6.1; LOCATED IN- plasma membrane, vacuole; EXPRESSED IN- 23 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- C2 membrane targeting protein (InterPro-IPR018029), C2 calcium/lipid-binding region, CaLB (InterPro-IPR008973), C2 calcium-dependent membrane targeting (InterPro-IPR000008); BEST Arabidopsis thaliana protein match is- unknown protein (TAIR-AT3G14590.2); Has 4658 Blast hits to 3860 proteins in 257 species- Archae - 0; Bacteria - 64; Metazoa - 2751; Fungi - 514; Plants - 693; Viruses - 7; Other Eukaryotes - 629 (source- NCBI BLink). (751 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT3G30390
amino acid transporter family protein; Encodes a putative amino acid transporter. (460 aa)
       0.871
PHOS34
universal stress protein (USP) family protein; Contains a universal stress protein domain. Prot [...] (260 aa)
       0.788
AT3G17020
universal stress protein (USP) family protein; universal stress protein (USP) family protein; F [...] (163 aa)
       0.786
AT3G28580
AAA-type ATPase family protein; AAA-type ATPase family protein; FUNCTIONS IN- nucleoside-tripho [...] (500 aa)
       0.716
TOM3
TOM3; protein binding; Necessary for the efficient multiplication of tobamoviruses. (303 aa)
       0.679
PUB13
PUB13 (PLANT U-BOX 13); ubiquitin-protein ligase; Encodes a protein containing a UND, a U-box, [...] (660 aa)
       0.659
AT2G41190
amino acid transporter family protein; amino acid transporter family protein; FUNCTIONS IN- ami [...] (536 aa)
       0.657
ERF1-1
ERF1-1 (EUKARYOTIC RELEASE FACTOR 1-1); translation release factor; Encodes a eukaryotic releas [...] (436 aa)
       0.599
AT2G44310
calcium-binding EF hand family protein; calcium-binding EF hand family protein; FUNCTIONS IN- c [...] (142 aa)
       0.565
AT1G07040
unknown protein; unknown protein; INVOLVED IN- biological_process unknown; LOCATED IN- chloropl [...] (371 aa)
       0.565

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query776
COG5038 1227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 2e-29
cd00030102 cd00030, C2, C2 domain 3e-25
smart00239101 smart00239, C2, Protein kinase C conserved region 4e-21
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 3e-20
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 1e-19
pfam0016885 pfam00168, C2, C2 domain 7e-19
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 7e-18
cd04026131 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein 4e-16
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 1e-13
cd04035123 cd04035, C2A_Rabphilin_Doc2, C2 domain first repea 7e-13
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 2e-12
cd04019150 cd04019, C2C_MCTP_PRT_plant, C2 domain third repea 2e-12
cd04009133 cd04009, C2B_Munc13-like, C2 domain second repeat 2e-12
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 3e-12
cd04036119 cd04036, C2_cPLA2, C2 domain present in cytosolic 7e-12
cd04031125 cd04031, C2A_RIM1alpha, C2 domain first repeat con 2e-11
cd08377119 cd08377, C2C_MCTP_PRT, C2 domain third repeat foun 3e-11
cd04014132 cd04014, C2_PKC_epsilon, C2 domain in Protein Kina 3e-11
cd08384133 cd08384, C2B_Rabphilin_Doc2, C2 domain second repe 8e-11
cd08385124 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain 3e-10
cd08387124 cd08387, C2A_Synaptotagmin-8, C2A domain first rep 5e-10
cd00275128 cd00275, C2_PLC_like, C2 domain present in Phospho 6e-10
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 6e-10
cd04033133 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the 2e-09
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 2e-09
cd08375136 cd08375, C2_Intersectin, C2 domain present in Inte 2e-09
cd04043126 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma 3e-09
cd04046126 cd04046, C2_Calpain, C2 domain present in Calpain 1e-08
cd04037124 cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer 4e-08
cd08681118 cd08681, C2_fungal_Inn1p-like, C2 domain found in 7e-08
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 8e-08
cd08682126 cd08682, C2_Rab11-FIP_classI, C2 domain found in R 8e-08
cd04041111 cd04041, C2A_fungal, C2 domain first repeat; funga 8e-08
cd08386125 cd08386, C2A_Synaptotagmin-7, C2A domain first rep 1e-07
cd04052111 cd04052, C2B_Tricalbin-like, C2 domain second repe 2e-07
cd04027127 cd04027, C2B_Munc13, C2 domain second repeat in Mu 3e-07
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 8e-07
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 8e-07
cd04045120 cd04045, C2C_Tricalbin-like, C2 domain third repea 1e-06
cd08405136 cd08405, C2B_Synaptotagmin-7, C2 domain second rep 2e-06
cd08676153 cd08676, C2A_Munc13-like, C2 domain first repeat i 4e-06
cd08378121 cd08378, C2B_MCTP_PRT_plant, C2 domain second repe 9e-06
cd08401121 cd08401, C2A_RasA2_RasA3, C2 domain first repeat p 2e-05
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 2e-05
cd08402136 cd08402, C2B_Synaptotagmin-1, C2 domain second rep 2e-05
cd08675137 cd08675, C2B_RasGAP, C2 domain second repeat of Ra 3e-05
cd08379126 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repe 1e-04
cd04030127 cd04030, C2C_KIAA1228, C2 domain third repeat pres 1e-04
cd04039108 cd04039, C2_PSD, C2 domain present in Phosphatidyl 1e-04
cd08388128 cd08388, C2A_Synaptotagmin-4-11, C2A domain first 1e-04
cd08688110 cd08688, C2_KIAA0528-like, C2 domain found in the 1e-04
cd04011111 cd04011, C2B_Ferlin, C2 domain second repeat in Fe 3e-04
cd08403134 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s 4e-04
cd04050105 cd04050, C2B_Synaptotagmin-like, C2 domain second 4e-04
cd08395120 cd08395, C2C_Munc13, C2 domain third repeat in Mun 0.003
PLN03008 868 PLN03008, PLN03008, Phospholipase D delta 0.004
cd04021125 cd04021, C2_E3_ubiquitin_ligase, C2 domain present 0.004
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
 Score =  125 bits (316), Expect = 2e-29
 Identities = 96/419 (22%), Positives = 190/419 (45%), Gaps = 56/419 (13%)

Query: 10  HHVGIVLFLL---WLLSYFDRCHPAAYFI--SLIYLYSVHDRYVMRLRRKVEFEERKNSF 64
             V IVL      W+  Y      + +FI    +Y+Y    +   R+RR +    ++   
Sbjct: 156 QSVAIVLIGSVASWIFGYLGFSFASLFFIILVTMYVYRTCIK---RVRRNIRDLVQQELS 212

Query: 65  QRRVLKDSETVRWLNHAIEKMWPICMEQIASQ------KLLLPIIPWFLEKYKPWTAKKA 118
           + ++  D E+V WLN  ++K WPI    I+ Q      + L   IP F+           
Sbjct: 213 EEKLENDYESVEWLNTFLQKFWPIIEPSISQQVVDQVNQQLAEAIPSFI--------DAL 264

Query: 119 LVQHLYLGRNPPMLTEMRVLRQSNDDDHMVLELGMNFLTAD--DMSA---------ILAV 167
            +    LG  PP +  +R    S + D +V+++  +F   D  D++A          +++
Sbjct: 265 ALDEFTLGSKPPRIDGIRSY-PSTESDTVVMDVDFSFTPHDISDVTATSARASVNPKISL 323

Query: 168 KLRKRLGFGMWAKMHVT--GMHVEGKVLVGVKFLRRWPFIDRLRVCFAEPPYFQMTVKPI 225
            ++K   FG    + +    +  +G+V V V+ + ++PFI  +     E P F   + P+
Sbjct: 324 VVKKGKSFGS-FTLPILVEDLFFKGRVRVRVELMSKYPFIKTVSFQLLEVPEFDFILVPL 382

Query: 226 --FTHGLDVTEFPGIAGWLDKLLSIAFEQTLVEPNMLVVDVDKFASPQPGNWFSVDVKEP 283
                G+D+   PG++ ++ ++++      L+ PN L +D+ +  +   G          
Sbjct: 383 GGDFFGVDIFAIPGLSRFIQEIINSTLGPMLLPPNSLTIDISQIMAGDSGT--------A 434

Query: 284 VAYARVEVVEASDMKPSD--LNGLADPYVKGQL-GPYRFRTKTQRKTLSPKWHEEFNIPI 340
           +    V++  A  +K SD  +NG  DPY+          +T+ ++ TL+P W+E F I +
Sbjct: 435 IGVVEVKIKSAEGLKKSDSTINGTVDPYITVTFSDRVIGKTRVKKNTLNPVWNETFYILL 494

Query: 341 STWDSPNVLVIEVRDKDHFV-DDTLGDCTINISDLRD--GQRHDMWIPLQNIK-IGRLH 395
           +++  P  L + + D + F  D  +G   ++++ L     ++++++  L+N K +GRL 
Sbjct: 495 NSFTDP--LNLSLYDFNSFKSDKVVGSTQLDLALLHQNPVKKNELYEFLRNTKNVGRLT 551


Length = 1227

>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|175981 cd04014, C2_PKC_epsilon, C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin Back     alignment and domain information
>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins Back     alignment and domain information
>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>gnl|CDD|176006 cd04041, C2A_fungal, C2 domain first repeat; fungal group Back     alignment and domain information
>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176046 cd08401, C2A_RasA2_RasA3, C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|176025 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>gnl|CDD|176004 cd04039, C2_PSD, C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>gnl|CDD|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176041 cd08395, C2C_Munc13, C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|178585 PLN03008, PLN03008, Phospholipase D delta Back     alignment and domain information
>gnl|CDD|175988 cd04021, C2_E3_ubiquitin_ligase, C2 domain present in E3 ubiquitin ligase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 776
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 100.0
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.97
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.86
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.85
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.83
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.82
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.81
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.81
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.81
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.81
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.81
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.81
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.8
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.8
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.8
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.8
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.79
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.79
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.79
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.79
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.79
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.79
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.78
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.78
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.78
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.78
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.77
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.77
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.77
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.77
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.77
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.76
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.76
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.76
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.76
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.76
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.76
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.75
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.75
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.74
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.74
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.74
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.73
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.73
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.73
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.72
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.72
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.72
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.72
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.72
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.72
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.71
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.71
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.71
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.71
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.7
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.7
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.7
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.69
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.69
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.69
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.69
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.68
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.68
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.68
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.68
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.67
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.67
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.66
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.66
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.66
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.66
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.65
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.65
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.65
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 99.64
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.63
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.63
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.63
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.63
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.63
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.62
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.62
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.62
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.61
PLN03008 868 Phospholipase D delta 99.6
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.59
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.59
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.58
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.58
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.56
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 99.56
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.55
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.55
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.51
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.49
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.49
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.46
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.44
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 99.37
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.32
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.28
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.27
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.23
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.22
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.19
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 99.11
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.1
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.07
PLN02270 808 phospholipase D alpha 99.05
PLN02223537 phosphoinositide phospholipase C 99.03
KOG13281103 consensus Synaptic vesicle protein BAIAP3, involve 98.94
PLN02952599 phosphoinositide phospholipase C 98.93
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 98.91
KOG1328 1103 consensus Synaptic vesicle protein BAIAP3, involve 98.82
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 98.79
PLN02230598 phosphoinositide phospholipase C 4 98.79
PLN02222581 phosphoinositide phospholipase C 2 98.76
KOG0169746 consensus Phosphoinositide-specific phospholipase 98.75
PLN02228567 Phosphoinositide phospholipase C 98.73
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 98.72
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 98.69
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 98.68
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 98.66
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 98.65
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 98.63
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.53
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 98.52
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 98.52
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 98.36
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 98.36
PF1029691 DUF2404: Putative integral membrane protein conser 98.33
PLN02352 758 phospholipase D epsilon 98.32
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 98.29
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 98.27
KOG13261105 consensus Membrane-associated protein FER-1 and re 98.14
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 97.88
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 97.86
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 97.84
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 97.84
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 97.83
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 97.75
KOG10111283 consensus Neurotransmitter release regulator, UNC- 97.66
PLN02964 644 phosphatidylserine decarboxylase 97.62
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 97.58
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 97.37
KOG1327529 consensus Copine [Signal transduction mechanisms] 97.36
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 97.35
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 97.34
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 97.26
KOG1326 1105 consensus Membrane-associated protein FER-1 and re 97.14
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 97.12
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 97.11
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 97.1
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 97.06
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 97.05
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 97.02
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 97.0
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 96.88
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 96.79
KOG3837523 consensus Uncharacterized conserved protein, conta 96.58
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 96.55
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 96.38
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 96.35
KOG1327529 consensus Copine [Signal transduction mechanisms] 96.23
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 95.95
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 95.68
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 95.54
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 95.48
KOG0696 683 consensus Serine/threonine protein kinase [Signal 95.46
PF15627156 CEP76-C2: CEP76 C2 domain 95.46
PF12416340 DUF3668: Cep120 protein; InterPro: IPR022136 This 95.32
KOG12651189 consensus Phospholipase C [Lipid transport and met 94.97
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 94.82
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 94.12
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 94.09
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 94.0
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 93.52
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 93.28
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 93.26
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 93.21
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 93.14
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 92.87
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 92.52
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 92.42
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 92.25
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 91.99
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 91.82
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 91.7
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 91.69
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 91.69
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 91.48
KOG1452442 consensus Predicted Rho GTPase-activating protein 91.41
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 91.16
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 91.05
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 90.71
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 90.52
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 90.3
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 90.21
cd08397159 C2_PI3K_class_III C2 domain present in class III p 89.97
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 89.95
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 89.77
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 89.65
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 89.62
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 89.49
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 89.41
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 89.31
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 89.23
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 89.11
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 88.95
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 88.84
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 88.52
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 88.46
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 88.38
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 88.13
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 87.82
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 87.82
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 86.6
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 86.26
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 86.12
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 84.69
KOG3532 1051 consensus Predicted protein kinase [General functi 84.42
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 83.88
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 83.82
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 83.67
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 82.81
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 82.79
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 82.75
PLN03008 868 Phospholipase D delta 82.31
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 82.08
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 81.65
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 81.4
cd08694196 C2_Dock-A C2 domains found in Dedicator Of CytoKin 81.39
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 81.16
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 81.15
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 81.07
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 80.41
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=2.8e-58  Score=538.30  Aligned_cols=382  Identities=25%  Similarity=0.505  Sum_probs=330.1

Q ss_pred             hHHHHHHHHH---HHHHHHHHhcchhHHHHHHHHhhheeeehhhHHHHHHHHHHHHHHhhhhcccCCCccchHHHHHHHH
Q 004056            7 SIMHHVGIVL---FLLWLLSYFDRCHPAAYFISLIYLYSVHDRYVMRLRRKVEFEERKNSFQRRVLKDSETVRWLNHAIE   83 (776)
Q Consensus         7 ~~~~~~~~vl---~~~wllg~~g~s~~~llli~~~~l~~~~~r~~~rlr~~i~~e~~r~~~~~~~~~d~EsveWLN~iL~   83 (776)
                      .|||.+++++   +++|++||++|+++.+||+++..++ +++++..|+|+.++....+++.++++..|+|+|||||+||+
T Consensus       153 ~w~qs~~i~l~~~v~Swifg~~~fs~~slffii~~~~~-vY~~~~~rv~rnird~v~~~~~~ek~~nd~ESveWLNtfL~  231 (1227)
T COG5038         153 DWYQSVAIVLIGSVASWIFGYLGFSFASLFFIILVTMY-VYRTCIKRVRRNIRDLVQQELSEEKLENDYESVEWLNTFLQ  231 (1227)
T ss_pred             hhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHhhhcchhHHHHHHHHHH
Confidence            6999888886   6889999999999988888876544 36788889999999998888888999999999999999999


Q ss_pred             HhCcccchHHHHHHhhccchHHHHhhcCCcccceeeeeeeecCCCCCEEeeEEEEecCCCCCeEEEEEEEEEeeCCCcch
Q 004056           84 KMWPICMEQIASQKLLLPIIPWFLEKYKPWTAKKALVQHLYLGRNPPMLTEMRVLRQSNDDDHMVLELGMNFLTADDMSA  163 (776)
Q Consensus        84 ~~Wp~~~e~~~s~~I~~~~l~~~l~~~kP~~i~~l~~~~ftLGs~PPrI~~Vrv~~~~~~~d~vilDldis~~~~~D~si  163 (776)
                      ++||++ |+.+|++|...+.+ .|...-|+||..++|.+||||++||||.+||.|+ +++.|.+.|||+++|++ .|++.
T Consensus       232 KfW~i~-eP~iSqqV~dqvn~-~la~~iPsFI~~l~l~efTLGsk~PrI~~Irsyp-~te~dtv~mD~~~sftP-~d~sD  307 (1227)
T COG5038         232 KFWPII-EPSISQQVVDQVNQ-QLAEAIPSFIDALALDEFTLGSKPPRIDGIRSYP-STESDTVVMDVDFSFTP-HDISD  307 (1227)
T ss_pred             hheecc-ChHHHHHHHHHHHH-HHHhhcchhhhhhhhhhcccCCCCCceeeeeecC-CCCCceEEEEeeeccCc-cchhh
Confidence            999998 56678888754444 5555889999999999999999999999999996 78999999999999975 55555


Q ss_pred             heehhhhhh----------cC--cc-eeEEEEEEEEEEEEEEEEEEeeccCCCccceeeEEEeCCceEEEEEeecc--cc
Q 004056          164 ILAVKLRKR----------LG--FG-MWAKMHVTGMHVEGKVLVGVKFLRRWPFIDRLRVCFAEPPYFQMTVKPIF--TH  228 (776)
Q Consensus       164 ~l~v~l~~r----------lG--~G-~~~~i~V~~l~~~G~lRV~L~L~~~~P~vg~v~vsFle~P~idf~lkpl~--~~  228 (776)
                      +.+-+.+++          +|  +| +++||.|+++.|.|++||++.|++.+||++.|++|||+.|+|||.++|++  .+
T Consensus       308 ~t~~~~r~~vn~kIsL~v~~Gk~~~~~~lPI~Vedl~f~g~~Rvr~~L~~~~PfiktV~~~Lle~Pe~df~l~Plg~~~~  387 (1227)
T COG5038         308 VTATSARASVNPKISLVVKKGKSFGSFTLPILVEDLFFKGRVRVRVELMSKYPFIKTVSFQLLEVPEFDFILVPLGGDFF  387 (1227)
T ss_pred             hhhHHHhhhcCcceeEEEEeeeeeeEEeccEEEEeeeeeEEEEEEEEecCCCcceeEEEEEEecCcceeEEEEEcCCCcc
Confidence            554444443          23  45 67899999999999999999999999999999999999999999999996  35


Q ss_pred             CCccccCcchHHHHHHHHHHHhhhcccCCceeeecccccCCCCCCceeeeeecCceeEEEEEEEEecCCCCCC--CCCCC
Q 004056          229 GLDVTEFPGIAGWLDKLLSIAFEQTLVEPNMLVVDVDKFASPQPGNWFSVDVKEPVAYARVEVVEASDMKPSD--LNGLA  306 (776)
Q Consensus       229 G~dV~~iPgLs~~I~~~I~~~l~~~LV~Pn~l~Idl~~~~s~~~~~~fsL~y~~~~GvL~V~VieA~~L~~~D--~~G~s  306 (776)
                      |+||+.||||++||+++|..++++|+++|+++++|+++++++..        ..+.|+|.|+|.+|++|...+  .++..
T Consensus       388 g~dI~~iPGL~~fI~~~i~~~l~pml~~Pnsl~idi~~~m~~~s--------~~aIGVv~vkI~sa~~lk~~d~~i~~~v  459 (1227)
T COG5038         388 GVDIFAIPGLSRFIQEIINSTLGPMLLPPNSLTIDISQIMAGDS--------GTAIGVVEVKIKSAEGLKKSDSTINGTV  459 (1227)
T ss_pred             ceeEecCccHHHHHHHHHHhhcCCeeeCCceEEEcHHHhhcccc--------CCeeEEEEEEEeeccCcccccccccCCC
Confidence            89999999999999999999999999999999999999997732        468999999999999999988  68999


Q ss_pred             CcEEEEEeCC-eEEEeeeecCCCCCcceeeEEEeeccCCCCCEEEEEEeecCCCC-CCceeEEEEecCcccCCCcc-cee
Q 004056          307 DPYVKGQLGP-YRFRTKTQRKTLSPKWHEEFNIPISTWDSPNVLVIEVRDKDHFV-DDTLGDCTINISDLRDGQRH-DMW  383 (776)
Q Consensus       307 DPYVkv~Lg~-~~~kTkvikkTlNP~WnEtF~f~V~~~e~~~~L~V~VyD~D~~~-Dd~LG~v~I~L~~L~~~~~~-~~W  383 (776)
                      |||+.+.... ...+|++.++++||+|||+|++.+...  .+.|.++|||++.++ |+.+|++.++|..|.....+ +.-
T Consensus       460 Dpyit~~~~~r~~gkT~v~~nt~nPvwNEt~Yi~lns~--~d~L~LslyD~n~~~sd~vvG~~~l~L~~L~~~~~~~ne~  537 (1227)
T COG5038         460 DPYITVTFSDRVIGKTRVKKNTLNPVWNETFYILLNSF--TDPLNLSLYDFNSFKSDKVVGSTQLDLALLHQNPVKKNEL  537 (1227)
T ss_pred             CceEEEEeccccCCccceeeccCCccccceEEEEeccc--CCceeEEEEeccccCCcceeeeEEechHHhhhccccccce
Confidence            9999999765 466999999999999999999999874  478999999988886 99999999999998876543 222


Q ss_pred             ee-cCC-CCceEEEEEEEEEec
Q 004056          384 IP-LQN-IKIGRLHLAITVLEE  403 (776)
Q Consensus       384 ~~-L~~-~~~GeI~LsL~~~~~  403 (776)
                      +. +.+ ...|+|++.+.|.|.
T Consensus       538 ~e~~~~~k~vGrL~yDl~ffp~  559 (1227)
T COG5038         538 YEFLRNTKNVGRLTYDLRFFPV  559 (1227)
T ss_pred             eeeeccCccceEEEEeeeeecc
Confidence            22 222 457999999988875



>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>PF10296 DUF2404: Putative integral membrane protein conserved region (DUF2404); InterPro: IPR019411 This is entry represents a domain of unknown function found in mitochondrial distribution and morphology proteins Mdm12 and Mdm34, and in maintenance of mitochondrial morphology protein Mmm1 Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>KOG3532 consensus Predicted protein kinase [General function prediction only] Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query776
2ep6_A133 Solution Structure Of The Second C2 Domain From Hum 3e-09
2chd_A142 Crystal Structure Of The C2a Domain Of Rabphilin-3a 5e-08
2k3h_A140 Structural Determinants For Ca2+ And Pip2 Binding B 5e-08
3gpe_A137 Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain 5e-08
1dsy_A139 C2 Domain From Protein Kinase C (Alpha) Complexed W 5e-08
4dnl_A140 Crystal Structure Of A C2 Domain Of A Protein Kinas 1e-07
3jzy_A510 Crystal Structure Of Human Intersectin 2 C2 Domain 1e-07
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 3e-07
2r83_A284 Crystal Structure Analysis Of Human Synaptotagmin 1 4e-07
2uzp_A144 Crystal Structure Of The C2 Domain Of Human Protein 5e-07
3f04_A143 Crystal Structure Of Synaptotagmin I C2a Domain Len 9e-07
1byn_A128 Solution Structure Of The Calcium-Bound First C2-Do 1e-06
1rsy_A152 Structure Of The First C2-domain Of Synaptotagmin I 1e-06
3f00_A143 Crystal Structure Of Synaptotagmin I C2a Domain Wit 1e-06
2d8k_A141 Solution Structure Of The First C2 Domain Of Synapt 2e-06
2nsq_A155 Crystal Structure Of The C2 Domain Of The Human E3 2e-06
1a25_A149 C2 Domain From Protein Kinase C (Beta) Length = 149 2e-06
1dqv_A296 Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt 1e-05
3hn8_A296 Crystal Structure Of Synaptotagmin Length = 296 1e-05
2cm6_A166 Crystal Structure Of The C2b Domain Of Rabphilin3a 1e-04
1rh8_A142 Three-Dimensional Structure Of The Calcium-Free Pic 1e-04
3kwt_A148 Munc13-1 C2b-Domain, Calcium-Free Length = 148 2e-04
1gmi_A136 Structure Of The C2 Domain From Novel Protein Kinas 2e-04
3rpb_A140 The C2b-Domain Of Rabphilin: Structural Variations 2e-04
2cm5_A166 Crystal Structure Of The C2b Domain Of Rabphilin Le 2e-04
>pdb|2EP6|A Chain A, Solution Structure Of The Second C2 Domain From Human Mctp2 Protein Length = 133 Back     alignment and structure

Iteration: 1

Score = 60.8 bits (146), Expect = 3e-09, Method: Composition-based stats. Identities = 39/103 (37%), Positives = 61/103 (59%), Gaps = 4/103 (3%) Query: 277 SVDVKEPVAYARVEVVEASDMKPSDLNGLADPYVKGQLGPYRFRTKTQRKTLSPKWHEEF 336 S DVK+ V +V+V++A+D+ +D +G +DP+ +LG R +T T K L+P+W++ F Sbjct: 6 SGDVKD-VGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVF 64 Query: 337 NIPISTWDSPNVLVIEVRDKD-HFVDDTLGDCTINISDLRDGQ 378 PI D +VL + V D+D D LG I + +RDGQ Sbjct: 65 TFPIK--DIHDVLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQ 105
>pdb|2CHD|A Chain A, Crystal Structure Of The C2a Domain Of Rabphilin-3a Length = 142 Back     alignment and structure
>pdb|2K3H|A Chain A, Structural Determinants For Ca2+ And Pip2 Binding By The C2a Domain Of Rabphilin-3a Length = 140 Back     alignment and structure
>pdb|3GPE|A Chain A, Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain Complexed With Ca2+ And Ptdins(4,5)p2 Length = 137 Back     alignment and structure
>pdb|1DSY|A Chain A, C2 Domain From Protein Kinase C (Alpha) Complexed With Ca2+ And Phosphatidylserine Length = 139 Back     alignment and structure
>pdb|4DNL|A Chain A, Crystal Structure Of A C2 Domain Of A Protein Kinase C Alpha (Prkca) From Homo Sapiens At 1.90 A Resolution Length = 140 Back     alignment and structure
>pdb|3JZY|A Chain A, Crystal Structure Of Human Intersectin 2 C2 Domain Length = 510 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|2R83|A Chain A, Crystal Structure Analysis Of Human Synaptotagmin 1 C2a-c2b Length = 284 Back     alignment and structure
>pdb|2UZP|A Chain A, Crystal Structure Of The C2 Domain Of Human Protein Kinase C Gamma. Length = 144 Back     alignment and structure
>pdb|3F04|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain Length = 143 Back     alignment and structure
>pdb|1BYN|A Chain A, Solution Structure Of The Calcium-Bound First C2-Domain Of Synaptotagmin I Length = 128 Back     alignment and structure
>pdb|1RSY|A Chain A, Structure Of The First C2-domain Of Synaptotagmin I: A Novel Ca2+(slash)phospholipid Binding Fold Length = 152 Back     alignment and structure
>pdb|3F00|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain With Cu(Ii) Length = 143 Back     alignment and structure
>pdb|2D8K|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Vii Length = 141 Back     alignment and structure
>pdb|2NSQ|A Chain A, Crystal Structure Of The C2 Domain Of The Human E3 Ubiquitin-Protein Ligase Nedd4-Like Protein Length = 155 Back     alignment and structure
>pdb|1A25|A Chain A, C2 Domain From Protein Kinase C (Beta) Length = 149 Back     alignment and structure
>pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 Back     alignment and structure
>pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 Back     alignment and structure
>pdb|2CM6|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin3a Length = 166 Back     alignment and structure
>pdb|1RH8|A Chain A, Three-Dimensional Structure Of The Calcium-Free Piccolo C2a- Domain Length = 142 Back     alignment and structure
>pdb|3KWT|A Chain A, Munc13-1 C2b-Domain, Calcium-Free Length = 148 Back     alignment and structure
>pdb|1GMI|A Chain A, Structure Of The C2 Domain From Novel Protein Kinase C Epsilon Length = 136 Back     alignment and structure
>pdb|3RPB|A Chain A, The C2b-Domain Of Rabphilin: Structural Variations In A Janus-Faced Domain Length = 140 Back     alignment and structure
>pdb|2CM5|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin Length = 166 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query776
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 5e-33
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 1e-32
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 2e-28
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 3e-28
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 1e-26
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 2e-25
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 3e-24
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 3e-24
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 1e-22
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 2e-22
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 6e-22
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 6e-22
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 2e-21
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 3e-21
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 4e-21
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 4e-20
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 6e-20
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 1e-19
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 1e-19
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 3e-19
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 6e-19
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 7e-18
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 2e-18
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 6e-18
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 1e-17
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 5e-15
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 3e-17
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 3e-17
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 6e-17
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 1e-16
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 2e-16
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 2e-16
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 7e-16
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 8e-16
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 1e-15
3nsj_A540 Perforin-1; pore forming protein, immune system; H 4e-15
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 9e-15
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 2e-14
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 2e-14
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 3e-14
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 2e-12
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 7e-07
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 8e-07
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 2e-06
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 8e-06
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
 Score =  122 bits (309), Expect = 5e-33
 Identities = 29/119 (24%), Positives = 56/119 (47%), Gaps = 7/119 (5%)

Query: 288 RVEVVEASDMK---PSDLNGLADPYVKGQLGP---YRFRTKTQRKTLSPKWHEEFNIPIS 341
            V V+ A+ +      D+    DPYV+  +      R RT+     ++P W+E F   + 
Sbjct: 6   TVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRTRHFNNDINPVWNETFEFILD 65

Query: 342 TWDSPNVLVIEVRDKDHFVDDTLGDCTINISDLRDGQRHDMWIPLQNIKIGRLHLAITV 400
                NVL I + D ++ +D+TLG  T  +S ++ G++ ++      +    L +++ V
Sbjct: 66  PNQE-NVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEVPFIFNQVTEMVLEMSLEV 123


>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Length = 138 Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Length = 126 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query776
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.96
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.96
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.84
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.82
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.82
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.82
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.82
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.81
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.81
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.8
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.8
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.8
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.8
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.79
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.79
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.79
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.79
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.79
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.79
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.78
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.78
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.77
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.77
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.77
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.77
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.76
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.76
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.76
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.76
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.75
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.75
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.75
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.74
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.73
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.72
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.67
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.66
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.58
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.57
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.55
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.52
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.51
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.5
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.47
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 99.38
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.32
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.09
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.08
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.08
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 98.94
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 98.89
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 98.6
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 98.54
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 98.4
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 98.29
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 97.57
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 97.39
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 97.36
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 97.29
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 97.18
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 97.17
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 97.12
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 97.07
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 96.99
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 96.94
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 96.94
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 96.66
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 96.5
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 96.31
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 96.19
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 95.94
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 95.9
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 95.82
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 94.52
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 94.48
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 93.73
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 93.68
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 93.57
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 92.85
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 92.45
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 92.24
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 92.22
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 91.63
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 90.99
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 90.99
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 90.86
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 89.33
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 84.07
3l4c_A220 Dedicator of cytokinesis protein 1; DOCK180, DOCK1 83.58
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 81.76
2wxf_A 940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 81.5
3nsj_A540 Perforin-1; pore forming protein, immune system; H 80.95
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
Probab=99.96  E-value=4.8e-29  Score=262.79  Aligned_cols=234  Identities=23%  Similarity=0.333  Sum_probs=193.2

Q ss_pred             CCceeeeeecCceeEEEEEEEEecCCCCCCCCCCCCcEEEEEeCC---eEEEeeeecCCCCCcceeeEEEeeccCC-CCC
Q 004056          272 PGNWFSVDVKEPVAYARVEVVEASDMKPSDLNGLADPYVKGQLGP---YRFRTKTQRKTLSPKWHEEFNIPISTWD-SPN  347 (776)
Q Consensus       272 ~~~~fsL~y~~~~GvL~V~VieA~~L~~~D~~G~sDPYVkv~Lg~---~~~kTkvikkTlNP~WnEtF~f~V~~~e-~~~  347 (776)
                      +..+|++.|....+.|.|+|++|++|+++|.+|.+||||++++++   +.++|+++++|+||.|||+|.|.+...+ ...
T Consensus         6 G~l~~~l~y~~~~~~L~v~v~~a~~L~~~d~~~~~dpyv~v~~~~~~~~~~~T~~~~~~~nP~wne~f~f~v~~~~~~~~   85 (284)
T 2r83_A            6 GKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELAGK   85 (284)
T ss_dssp             CEEEEEEEEETTTTEEEEEEEEEECCCCCSSSSSCCEEEEEEEETCTTSCEECCCCCSCSSCEEEEEEEECCCGGGCTTC
T ss_pred             eEEEEEEEEECCCCEEEEEEEEeeCCCCCCCCCCCCeEEEEEEEcCCCceEeCCcccCCCCCeeCceEEEEechHHhCcC
Confidence            456899999999999999999999999999999999999999964   5889999999999999999999987533 246


Q ss_pred             EEEEEEeecCCCC-CCceeEEEEecCcccCCCccceeeecCCC------CceEEEEEEEEEecC------------C---
Q 004056          348 VLVIEVRDKDHFV-DDTLGDCTINISDLRDGQRHDMWIPLQNI------KIGRLHLAITVLEES------------A---  405 (776)
Q Consensus       348 ~L~V~VyD~D~~~-Dd~LG~v~I~L~~L~~~~~~~~W~~L~~~------~~GeI~LsL~~~~~~------------~---  405 (776)
                      .|.|+|||+|.++ |++||++.++|.++..+...+.|++|.+.      ..|+|++.+.|.+..            +   
T Consensus        86 ~l~~~V~d~d~~~~~~~lG~~~i~l~~l~~~~~~~~w~~L~~~~~~~~~~~G~i~l~l~~~p~~~~l~v~v~~a~~L~~~  165 (284)
T 2r83_A           86 TLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKM  165 (284)
T ss_dssp             EEEEEEEECCSSSCCCEEEEEEEEGGGCCCSSCEEEEEECBCCSSCCCCCCCEEEEEEEEETTTTEEEEEEEEEESCCCC
T ss_pred             EEEEEEEECCCCCCCceeEEEEEcchhcccCCcceeEEEeeccccccccccccEEEEEEecCcCCceEEEEEEeECCCCc
Confidence            8999999999987 99999999999999988888999999752      469999999887641            1   


Q ss_pred             --CccCCCcccccccccCCCCcccccccceeecCCCceEEEecccccCCCCCCCCCCCceEEEEecC--eeee-eEE-Ee
Q 004056          406 --KGVDSPCDGGTLNKEGMGNKEDQSNKEDIRESFANETTDKGSFSSVSSEKSPKVADNFEPINIEG--QQET-GIW-VH  479 (776)
Q Consensus       406 --k~~~dP~vkv~L~~e~~~gkrlkKKKT~vkk~t~nP~~n~~~a~~Lp~~~~~~~~d~~~vi~~~G--~~~~-gv~-~~  479 (776)
                        ...+|||+++++.   ..+++..++||.+++++.||+||+.+.+.++..+.......+.+++.+.  ..+- |-. +.
T Consensus       166 d~~~~~dpyv~v~~~---~~~~~~~~~kT~v~~~t~nP~wne~f~f~v~~~~l~~~~l~i~V~d~d~~~~~~~iG~~~i~  242 (284)
T 2r83_A          166 DVGGLSDPYVKIHLM---QNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVG  242 (284)
T ss_dssp             STTSCCCEEEEEEEE---ETTEEEEEEECCCCCSCSSCEEEEEEEEECCTTTGGGEEEEEEEEECCSSSCCCEEEEEEEE
T ss_pred             CCCCCcCeEEEEEEE---eCCcEeeeeccceecCCCCCEEceeEEEeCCHHHhCceEEEEEEEeCCCCCCCcEEEEEEEC
Confidence              1347999999983   3466667899999999999999999988888776655567788888873  2222 443 33


Q ss_pred             cCC-cccccccccccCCCCCccceEeecCC
Q 004056          480 QPG-SEVAQTWEPRKGKNRRLDTLVRRVPN  508 (776)
Q Consensus       480 ~pg-~~~~~~W~~~~~~~r~~~~q~~~~~~  508 (776)
                      -.. ....+||.+|+.+||++.++||..-.
T Consensus       243 l~~~~~~~~~w~~~~~~~~~~~~~W~~L~~  272 (284)
T 2r83_A          243 YNSTGAELRHWSDMLANPRRPIAQWHTLQV  272 (284)
T ss_dssp             TTCCHHHHHHHHHHHHSTTSCEEEEEECBC
T ss_pred             CCCCCcHHHHHHHHHHCCCCchheeeecCC
Confidence            222 23359999999999999999997653



>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 776
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 8e-22
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 1e-20
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 1e-20
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 5e-20
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 7e-18
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 1e-16
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 2e-16
d1bdya_123 b.7.1.1 (A:) Domain from protein kinase C delta {R 1e-15
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 1e-15
d1gmia_136 b.7.1.1 (A:) Domain from protein kinase C epsilon 2e-14
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 2e-14
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 2e-13
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 3e-13
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 4e-12
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 4e-12
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 1e-11
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 2e-11
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 5e-11
d1dqva1130 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus 9e-10
d2zkmx2122 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human 7e-08
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Domain from cytosolic phospholipase A2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 89.4 bits (221), Expect = 8e-22
 Identities = 30/120 (25%), Positives = 57/120 (47%), Gaps = 7/120 (5%)

Query: 288 RVEVVEASDMKP---SDLNGLADPYVKGQLGP---YRFRTKTQRKTLSPKWHEEFNIPIS 341
            V V+ A+ +      D+    DPYV+  +      R RT+     ++P W+E F   I 
Sbjct: 6   TVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRTRHFNNDINPVWNETFE-FIL 64

Query: 342 TWDSPNVLVIEVRDKDHFVDDTLGDCTINISDLRDGQRHDMWIPLQNIKIGRLHLAITVL 401
             +  NVL I + D ++ +D+TLG  T  +S ++ G++ ++      +    L +++ V 
Sbjct: 65  DPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEVPFIFNQVTEMVLEMSLEVA 124


>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query776
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.84
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.82
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.82
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.79
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.79
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.77
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.76
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.75
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.75
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.73
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.72
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.71
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.71
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.7
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.7
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.67
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.66
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.66
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.59
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.33
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 98.93
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 98.91
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 98.76
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 98.7
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 97.62
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 97.42
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 97.32
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 97.29
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 97.07
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 96.85
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 96.35
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 94.06
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 93.14
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 92.13
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 92.01
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 91.96
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 91.34
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 90.38
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 89.23
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 86.94
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 82.85
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.84  E-value=4e-21  Score=177.49  Aligned_cols=117  Identities=32%  Similarity=0.518  Sum_probs=104.3

Q ss_pred             CceeEEEEEEEEecCCCCCCCCCCCCcEEEEEeCCeEEEeeeecCCCCCcceeeEEEeeccCCCCCEEEEEEeecCCCC-
Q 004056          282 EPVAYARVEVVEASDMKPSDLNGLADPYVKGQLGPYRFRTKTQRKTLSPKWHEEFNIPISTWDSPNVLVIEVRDKDHFV-  360 (776)
Q Consensus       282 ~~~GvL~V~VieA~~L~~~D~~G~sDPYVkv~Lg~~~~kTkvikkTlNP~WnEtF~f~V~~~e~~~~L~V~VyD~D~~~-  360 (776)
                      .+.|.|+|+|++|+||+++|..|.+||||++++++++++|+++++|+||.|||+|.|.+...  .+.|.|+|||++.++ 
T Consensus         3 ~~~G~L~V~v~~A~~L~~~d~~g~~Dpyv~v~~~~~~~~T~~~~~t~nP~wne~f~f~v~~~--~~~L~i~V~d~~~~~~   80 (126)
T d2ep6a1           3 KDVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKDI--HDVLEVTVFDEDGDKP   80 (126)
T ss_dssp             CCSEEEEEEEEEEESCCCSSSSSCCCEEEEEEETTEEEECCCCSSCSSCCCCEEEEEEESCT--TCEEEEEEEEEETTEE
T ss_pred             CccEEEEEEEEEeECCCCCCCCCCcCeEEEEEcCCeEEEEEeeCCceeEEEEEEEEEEEecc--CceeEEEEEEccCCcC
Confidence            47899999999999999999999999999999999999999999999999999999999853  468999999999987 


Q ss_pred             CCceeEEEEecCcccCCCccceeeecCC-----CCceEEEEEEEEEe
Q 004056          361 DDTLGDCTINISDLRDGQRHDMWIPLQN-----IKIGRLHLAITVLE  402 (776)
Q Consensus       361 Dd~LG~v~I~L~~L~~~~~~~~W~~L~~-----~~~GeI~LsL~~~~  402 (776)
                      |++||++.++|+++..+.  ..|+.|..     ..+|+|+|+++|+.
T Consensus        81 d~~lG~~~i~l~~l~~~~--~~~~~l~~~~~~~~~~G~i~l~~~~i~  125 (126)
T d2ep6a1          81 PDFLGKVAIPLLSIRDGQ--PNCYVLKNKDLEQAFKGVIYLEMDLIY  125 (126)
T ss_dssp             EEECCBCEEEGGGCCSSC--CEECCCBCSCTTSCCSSEEEEEEEEEE
T ss_pred             cceEEEEEEEHHHCCCCC--ceEEEccccCCCCceeEEEEEEEEEEE
Confidence            899999999999997654  45776653     34799999999874



>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure