Citrus Sinensis ID: 004063
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 776 | ||||||
| 225433351 | 804 | PREDICTED: uncharacterized protein LOC10 | 0.966 | 0.932 | 0.532 | 0.0 | |
| 356533381 | 784 | PREDICTED: uncharacterized protein LOC10 | 0.934 | 0.924 | 0.491 | 1e-172 | |
| 297831252 | 728 | hypothetical protein ARALYDRAFT_898989 [ | 0.640 | 0.682 | 0.554 | 1e-143 | |
| 255554298 | 713 | conserved hypothetical protein [Ricinus | 0.856 | 0.932 | 0.456 | 1e-142 | |
| 145338880 | 714 | protein BLISTER [Arabidopsis thaliana] g | 0.694 | 0.754 | 0.520 | 1e-141 | |
| 125528809 | 760 | hypothetical protein OsI_04881 [Oryza sa | 0.641 | 0.655 | 0.485 | 1e-109 | |
| 242055353 | 770 | hypothetical protein SORBIDRAFT_03g04350 | 0.568 | 0.572 | 0.487 | 1e-109 | |
| 115441767 | 760 | Os01g0911800 [Oryza sativa Japonica Grou | 0.643 | 0.656 | 0.481 | 1e-109 | |
| 414879058 | 748 | TPA: hypothetical protein ZEAMMB73_30879 | 0.587 | 0.609 | 0.482 | 1e-109 | |
| 147843847 | 443 | hypothetical protein VITISV_004427 [Viti | 0.377 | 0.661 | 0.679 | 1e-104 |
| >gi|225433351|ref|XP_002282738.1| PREDICTED: uncharacterized protein LOC100251145 [Vitis vinifera] gi|297741880|emb|CBI33315.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 675 bits (1742), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 418/785 (53%), Positives = 527/785 (67%), Gaps = 35/785 (4%)
Query: 5 QASDFSLHDQHHLEADRVRVTDLDGAGTSDGPDKAVVSLPLVMHNDDNKALKLAQQSQQV 64
Q++D SL Q LE ++VRV D DGAG SDG +AV + N+DNK +++ Q S+
Sbjct: 42 QSADVSLCVQP-LENEQVRVMDSDGAGISDGVGEAVTKVI----NNDNKKIEIFQNSEPC 96
Query: 65 SLSDKRINSNCFENDLNSSSAYLAQTYSNNQ-----ETSGSAGPVNVSNSQETKDVNNDF 119
S SD D + SA QT N+Q + SG G V Q K+ N+D
Sbjct: 97 S-SDIYAKPPFSTKDYKAFSADSVQTQVNDQGFNRYDASGFLGLVG----QLAKEKNDDG 151
Query: 120 VIYSSGQGRLRDGIMSNQFLSLLPEASQDYDSSNSSKSGFQGIEESQSKGNDSFPKVPTL 179
I++ +G + I+S+Q ++ P+A +D DSS SS+S F +EE+Q K + S K T+
Sbjct: 152 GIHAGAEGSAYE-IVSDQSIAF-PQAIRDTDSS-SSQSNFHRMEETQQKDHKSSLKSFTV 208
Query: 180 VNSGPSHDFVTKISPQNSVSTLFQSKPSNAIALGN-GHSFHSSSEGTAHLTTSTGGSASE 238
++ G S + S +NS NAI N G++ SS + H T+ SA
Sbjct: 209 IDPGISQVPLANASSENS---------GNAILPNNYGYANMKSSADSVHPITTAKQSAFG 259
Query: 239 VGLNTPSTTNFSDPVSFNTGEGKPSNSASGLASLQ-STPFK-RSEYSGYNFDAGNSFNHV 296
VG + P + +F+ + N + K S+S L S ++P S + + FD S NH+
Sbjct: 260 VGQDVPGSVDFNVHMLSNKEDKKLSSSFGYLPSTHGASPLASESSSTSFAFDVRGSSNHL 319
Query: 297 PVSSATNKFTLGKSRASFLDSLNVPRASSGTLFEQTEPERDS--FMSSSSLNSMDVLGSS 354
P+ S T + +SR SFLDS+NVPR S + TEP + F SSS +NSMDVLGSS
Sbjct: 320 PLYSVTPETNARRSRPSFLDSINVPRVPSASHLPLTEPGKAEPFFSSSSKVNSMDVLGSS 379
Query: 355 PAQNPSMEKETTGAFSKTTTSNIPSAFDYLGNPTVSTSDRGDIRRLGSNESSIENQHGFY 414
+ E E FSK SN PS FD+ N +VS +R ++ R G +++S+E + F+
Sbjct: 380 ASTKSLAESENFEPFSKAGNSNGPSLFDHSINSSVSVGNRVEMLRHGLDQNSLERKFEFH 439
Query: 415 STKHNEDFAALEQHIEDLTQEKFALQRSLEASRALSESLAAENSSLTDSYNQQRSVVNQL 474
S K NEDFAALEQHIEDLTQEKF+LQR+LEASRAL+ESLAAENSSLTDSYNQQ SVVNQL
Sbjct: 440 SQKQNEDFAALEQHIEDLTQEKFSLQRALEASRALAESLAAENSSLTDSYNQQGSVVNQL 499
Query: 475 KSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRLRSNE 534
KS+MEKLQEEIK QLV+LESF+ EYAN +LECNAADERAK+LASEVIGLEEKALRLRS+E
Sbjct: 500 KSDMEKLQEEIKAQLVDLESFKIEYANAQLECNAADERAKLLASEVIGLEEKALRLRSSE 559
Query: 535 LKLERQLENSQSEISSYKKKISSLEKERQDFQSTIEALQEEKKMMQSKLRKASGSGKSID 594
LKLERQLENS +EISS+KKK+SSLEKERQD Q TI+ALQEEKK++Q K+RKAS +GKSID
Sbjct: 560 LKLERQLENSNAEISSFKKKVSSLEKERQDLQLTIDALQEEKKLLQKKVRKASANGKSID 619
Query: 595 FGKTAASTVNASTSTEDLAITDTTL---DNSNQDTHDDASLPRIDASGSTLLPESGRLAL 651
K+ + STST+DL D + S+ + + AS+ + S LLP+ G++
Sbjct: 620 ASKSPTDRKDVSTSTDDLVNEDNACMIPETSSLEMLNSASVQANELSSFPLLPDGGQMNF 679
Query: 652 EGLAVNIPHDQMRMIHNINALISELALEKEELVQALSSELAQSSKLKDLNNELSRKLEHQ 711
E +VNIP DQMRMI NINALISELALEKEEL+QAL +E +QSSKLKDLN ELSRKLE Q
Sbjct: 680 EVSSVNIPADQMRMIQNINALISELALEKEELMQALVTESSQSSKLKDLNKELSRKLEVQ 739
Query: 712 TQRLELLTAQNMANENISFRQPDSASTHDHTAYADEGDEVVERVLGWIMKLFPGGPSRRR 771
TQRLELLT+Q+MANE I RQPDS HD+ AYADEGDEVVERVLGWIM+LFPGGP++RR
Sbjct: 740 TQRLELLTSQSMANEVIQARQPDSRIMHDNAAYADEGDEVVERVLGWIMRLFPGGPAKRR 799
Query: 772 TSKLL 776
TSKLL
Sbjct: 800 TSKLL 804
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356533381|ref|XP_003535243.1| PREDICTED: uncharacterized protein LOC100817279 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297831252|ref|XP_002883508.1| hypothetical protein ARALYDRAFT_898989 [Arabidopsis lyrata subsp. lyrata] gi|297329348|gb|EFH59767.1| hypothetical protein ARALYDRAFT_898989 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|255554298|ref|XP_002518189.1| conserved hypothetical protein [Ricinus communis] gi|223542785|gb|EEF44322.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|145338880|ref|NP_189040.3| protein BLISTER [Arabidopsis thaliana] gi|9294667|dbj|BAB03016.1| unnamed protein product [Arabidopsis thaliana] gi|332643320|gb|AEE76841.1| protein BLISTER [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|125528809|gb|EAY76923.1| hypothetical protein OsI_04881 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|242055353|ref|XP_002456822.1| hypothetical protein SORBIDRAFT_03g043500 [Sorghum bicolor] gi|241928797|gb|EES01942.1| hypothetical protein SORBIDRAFT_03g043500 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|115441767|ref|NP_001045163.1| Os01g0911800 [Oryza sativa Japonica Group] gi|20161363|dbj|BAB90287.1| heavy meromyosin-like [Oryza sativa Japonica Group] gi|113534694|dbj|BAF07077.1| Os01g0911800 [Oryza sativa Japonica Group] gi|125573067|gb|EAZ14582.1| hypothetical protein OsJ_04505 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|414879058|tpg|DAA56189.1| TPA: hypothetical protein ZEAMMB73_308793 [Zea mays] gi|414879059|tpg|DAA56190.1| TPA: hypothetical protein ZEAMMB73_308793 [Zea mays] gi|414879060|tpg|DAA56191.1| TPA: hypothetical protein ZEAMMB73_308793 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|147843847|emb|CAN79450.1| hypothetical protein VITISV_004427 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 776 | ||||||
| TAIR|locus:2076071 | 714 | BLI "BLISTER" [Arabidopsis tha | 0.743 | 0.808 | 0.437 | 1.8e-112 | |
| DICTYBASE|DDB_G0271670 | 374 | DDB_G0271670 [Dictyostelium di | 0.416 | 0.863 | 0.172 | 6.4e-06 | |
| POMBASE|SPBC215.13 | 534 | SPBC215.13 "sequence orphan" [ | 0.463 | 0.674 | 0.194 | 0.00015 | |
| UNIPROTKB|O18515 | 534 | O18515 "Nucleoporin p62" [Hydr | 0.260 | 0.378 | 0.221 | 0.00044 | |
| CGD|CAL0006203 | 768 | orf19.4906 [Candida albicans ( | 0.311 | 0.315 | 0.247 | 0.00091 | |
| UNIPROTKB|Q5APQ2 | 768 | CaO19.4906 "Putative uncharact | 0.311 | 0.315 | 0.247 | 0.00091 | |
| UNIPROTKB|I3LRD3 | 2501 | CENPE "Uncharacterized protein | 0.349 | 0.108 | 0.224 | 0.00094 |
| TAIR|locus:2076071 BLI "BLISTER" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1088 (388.1 bits), Expect = 1.8e-112, Sum P(2) = 1.8e-112
Identities = 266/608 (43%), Positives = 359/608 (59%)
Query: 180 VNSGPSHDFVTKISPQNSVSTLFQSKPSNAIALGNGHSFHSSSEGTAHLTTSTGGSASEV 239
VN+ P + I Q+S S S +L +G S +G H + T +
Sbjct: 127 VNTRPEVVPYSNIDKQSSESFDRASTLRETASLFSGTSMQM--DGFIHGSGLTSSRKDSL 184
Query: 240 GLNTPSTTNFSDPVSFNTGEG--------KPSNSASGLASLQSTPFKRSEYSGYNFDAGN 291
T +F + G G KP+ S+S L + T + SE S ++ + +
Sbjct: 185 QPTTRMAGSFDEVAKNQQGSGELGGSIVQKPTLSSSYLFNSPDTSSRPSEPSDFSVNITS 244
Query: 292 SFNHVPVSSATNKFTLGKSRASFLDSLNVPRASSGTLFEQTEPERXXXXXXXXXXXXXXX 351
S P++SA ++ T+ +SR SFLDSLN+ RA T ++ PE
Sbjct: 245 SS---PLNSAKSEATVKRSRPSFLDSLNISRAPE-TQYQH--PEIQADLVTSSGSQLSGS 298
Query: 352 XXXPAQNPSMEKETTGAFSKTT-TSNIPSAFDYLGNPTVSTSDRGDIRRLGSNESSIENQ 410
S +++ G S T+ S+ P+ F+ + ++ G + G + S+ Q
Sbjct: 299 DGFGPSYISGRRDSNGPSSLTSGASDYPNPFEKFRSSLYPAAN-GVMP--GFTDFSMPKQ 355
Query: 411 HGFYSTKHNEDFAALEQHIEDLTQEKFALQXXXXXXXXXXXXXXXXXXXXTDSYNQQRSV 470
N+DF ALEQHIEDLTQEKF+LQ TD+YNQQR +
Sbjct: 356 --------NDDFTALEQHIEDLTQEKFSLQRDLDASRALAESLASENSSMTDTYNQQRGL 407
Query: 471 VNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRL 530
VNQLK +ME+L ++I+ Q+ ELES R EYAN +LECNAADER++ILASEVI LE+KALRL
Sbjct: 408 VNQLKDDMERLYQQIQAQMGELESVRVEYANAQLECNAADERSQILASEVISLEDKALRL 467
Query: 531 RSNELKLERQLENXXXXXXXXXXXXXXXXXXRQDFQSTIEALQEEKKMMQSKLRKASGSG 590
RSNELKLER+LE RQD QSTI+ALQEEKK++Q+ ++KAS G
Sbjct: 468 RSNELKLERELEKAQTEMLSYKKKLQSLEKDRQDLQSTIKALQEEKKVLQTMVQKASSGG 527
Query: 591 KSIDFGKXXXXXXXXXXXXEDLAITDTTLDNSNQDTHDDASLPRIDASGSTLLPESGRLA 650
KS D K E LAI+DTT ++SNQ+T D +L D+S + ++PE+ +L
Sbjct: 528 KSTDLSKNSTSRKNVSTSTEGLAISDTTPESSNQET-DSTTLLESDSSNTAIIPETRQLT 586
Query: 651 LEGLAVNIPHDQMRMIHNINALISELALEKEELVQALSSELAQSSKLKDLNNELSRKLEH 710
LEG ++++P DQMR+IHNIN LI+ELA+EKEELVQALSSEL++S+ +++LN ELSRKLE
Sbjct: 587 LEGFSLSVPADQMRVIHNINTLIAELAIEKEELVQALSSELSRSAHVQELNKELSRKLEA 646
Query: 711 QTQRLELLTAQNMANENIS--FRQPDSASTHDHTAYADEGDEVVERVLGWIMKLFPGGPS 768
QTQRLEL+TAQ MA +N+S +QPD+ + T ADEGDEVVERVLGWIMK+FPGGPS
Sbjct: 647 QTQRLELVTAQKMAIDNVSPEKQQPDTHVVQERTPIADEGDEVVERVLGWIMKMFPGGPS 706
Query: 769 RRRTSKLL 776
+RRTSKLL
Sbjct: 707 KRRTSKLL 714
|
|
| DICTYBASE|DDB_G0271670 DDB_G0271670 [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC215.13 SPBC215.13 "sequence orphan" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O18515 O18515 "Nucleoporin p62" [Hydra vulgaris (taxid:6087)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0006203 orf19.4906 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5APQ2 CaO19.4906 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LRD3 CENPE "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| scaffold_302959.1 | annotation not avaliable (728 aa) | |||||||
(Arabidopsis lyrata) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 776 | |||
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-11 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-08 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 9e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-07 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-06 | |
| pfam09726 | 680 | pfam09726, Macoilin, Transmembrane protein | 2e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 8e-06 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 9e-06 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-05 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 2e-05 | |
| pfam13863 | 126 | pfam13863, DUF4200, Domain of unknown function (DU | 2e-05 | |
| TIGR01843 | 423 | TIGR01843, type_I_hlyD, type I secretion membrane | 2e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 6e-05 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 7e-05 | |
| pfam04156 | 186 | pfam04156, IncA, IncA protein | 9e-05 | |
| COG3096 | 1480 | COG3096, MukB, Uncharacterized protein involved in | 9e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-04 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 3e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 3e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-04 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 8e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.001 | |
| COG4717 | 984 | COG4717, COG4717, Uncharacterized conserved protei | 0.001 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.002 | |
| pfam13863 | 126 | pfam13863, DUF4200, Domain of unknown function (DU | 0.002 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.002 | |
| PRK10929 | 1109 | PRK10929, PRK10929, putative mechanosensitive chan | 0.002 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 0.003 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.003 | |
| pfam03962 | 188 | pfam03962, Mnd1, Mnd1 family | 0.003 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.004 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 66.7 bits (163), Expect = 3e-11
Identities = 48/196 (24%), Positives = 93/196 (47%), Gaps = 3/196 (1%)
Query: 394 RGDIRRLGSNESSIENQHGFYSTKHNEDFAALEQ---HIEDLTQEKFALQRSLEASRALS 450
+ L +E Q + LEQ +E+L +E L+ LE +
Sbjct: 701 EDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERL 760
Query: 451 ESLAAENSSLTDSYNQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAAD 510
E L E SL ++ + + + +L+ + + LQEE++ ELE + E + +
Sbjct: 761 EELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLE 820
Query: 511 ERAKILASEVIGLEEKALRLRSNELKLERQLENSQSEISSYKKKISSLEKERQDFQSTIE 570
+R + L E+ LEE+ L +LE +LE + E+ K+++ LE E+++ + ++
Sbjct: 821 QRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELK 880
Query: 571 ALQEEKKMMQSKLRKA 586
L+EEK+ ++ +LR+
Sbjct: 881 ELEEEKEELEEELREL 896
|
Length = 1163 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|206034 pfam13863, DUF4200, Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217933 pfam04156, IncA, IncA protein | Back alignment and domain information |
|---|
| >gnl|CDD|225638 COG3096, MukB, Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|227061 COG4717, COG4717, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206034 pfam13863, DUF4200, Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236798 PRK10929, PRK10929, putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 776 | |||
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.47 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.38 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.36 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.31 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.31 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.1 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 98.07 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.0 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.92 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.87 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 97.87 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.77 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.75 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.72 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.59 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.52 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.43 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 97.35 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.32 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.3 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.25 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.24 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 97.23 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 97.17 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 97.12 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.11 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.11 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 97.1 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 97.07 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 97.07 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 97.02 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.99 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 96.94 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 96.93 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 96.92 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 96.92 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.89 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 96.88 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 96.88 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 96.87 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 96.86 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 96.79 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.78 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.72 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 96.7 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 96.66 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 96.62 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.6 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 96.5 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 96.4 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 96.39 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 96.35 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 96.35 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.33 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 96.3 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 96.29 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 96.27 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 96.24 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 96.22 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 96.22 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 96.19 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 96.19 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 96.17 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 96.15 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 96.07 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 96.06 | |
| cd07651 | 236 | F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology | 96.02 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 96.01 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 96.0 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 95.96 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 95.96 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 95.96 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 95.89 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 95.82 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 95.81 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 95.81 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 95.81 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 95.81 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 95.78 | |
| PF13514 | 1111 | AAA_27: AAA domain | 95.77 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 95.75 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 95.75 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 95.74 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 95.74 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 95.73 | |
| PF13166 | 712 | AAA_13: AAA domain | 95.73 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 95.72 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 95.68 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 95.62 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 95.61 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 95.52 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 95.51 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 95.51 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 95.48 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 95.48 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 95.37 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 95.35 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 95.35 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 95.28 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 95.14 | |
| cd07647 | 239 | F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/ | 95.14 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 95.06 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 95.02 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 95.0 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 94.94 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 94.87 | |
| cd07655 | 258 | F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/ | 94.86 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 94.83 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 94.74 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 94.71 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 94.68 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 94.65 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 94.63 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 94.62 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 94.56 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 94.54 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 94.49 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 94.47 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 94.43 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 94.42 | |
| cd07671 | 242 | F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin | 94.39 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 94.33 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 94.32 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 94.3 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 94.23 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 94.13 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 94.1 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 94.09 | |
| PF13514 | 1111 | AAA_27: AAA domain | 94.03 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 94.0 | |
| cd07653 | 251 | F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B | 93.94 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 93.94 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 93.84 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 93.79 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 93.69 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 93.63 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 93.63 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 93.62 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 93.6 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 93.58 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 93.5 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 93.49 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 93.42 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 93.32 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 93.28 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 93.28 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 93.26 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 93.03 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 93.01 | |
| PF09731 | 582 | Mitofilin: Mitochondrial inner membrane protein; I | 92.79 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 92.75 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 92.73 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 92.7 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 92.69 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 92.67 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 92.67 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 92.65 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 92.61 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 92.57 | |
| PF02050 | 123 | FliJ: Flagellar FliJ protein; InterPro: IPR012823 | 92.35 | |
| PF05546 | 207 | She9_MDM33: She9 / Mdm33 family; InterPro: IPR0088 | 92.34 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 92.31 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 92.27 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 92.26 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 92.15 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 92.13 | |
| cd07658 | 239 | F-BAR_NOSTRIN The F-BAR (FES-CIP4 Homology and Bin | 92.04 | |
| PF05700 | 221 | BCAS2: Breast carcinoma amplified sequence 2 (BCAS | 92.02 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 91.97 | |
| cd07672 | 240 | F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin | 91.95 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 91.86 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 91.82 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 91.81 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 91.71 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 91.65 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 91.57 | |
| PF02050 | 123 | FliJ: Flagellar FliJ protein; InterPro: IPR012823 | 91.52 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 91.5 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 91.44 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 91.42 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 91.22 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 91.09 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 91.09 | |
| PF09744 | 158 | Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte | 91.06 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 91.05 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 90.94 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 90.91 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 90.85 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 90.78 | |
| PF13166 | 712 | AAA_13: AAA domain | 90.78 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 90.75 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 90.7 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 90.69 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 90.5 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 90.44 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 90.4 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 90.37 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 90.37 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 90.28 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 90.25 | |
| PF04380 | 79 | BMFP: Membrane fusogenic activity; InterPro: IPR00 | 90.21 | |
| cd07649 | 233 | F-BAR_GAS7 The F-BAR (FES-CIP4 Homology and Bin/Am | 90.19 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 90.11 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 89.93 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 89.86 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 89.84 | |
| cd07680 | 258 | F-BAR_PACSIN1 The F-BAR (FES-CIP4 Homology and Bin | 89.84 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 89.63 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 89.56 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 89.48 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 89.32 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 89.3 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 89.21 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 89.11 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 88.94 | |
| cd07653 | 251 | F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B | 88.92 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 88.91 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 88.86 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 88.75 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 88.57 | |
| PF07200 | 150 | Mod_r: Modifier of rudimentary (Mod(r)) protein; I | 88.43 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 88.1 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 88.06 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 87.92 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 87.9 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 87.81 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 87.8 | |
| cd07622 | 201 | BAR_SNX4 The Bin/Amphiphysin/Rvs (BAR) domain of S | 87.72 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 87.59 | |
| PF14362 | 301 | DUF4407: Domain of unknown function (DUF4407) | 87.44 | |
| KOG4438 | 446 | consensus Centromere-associated protein NUF2 [Cell | 87.22 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 87.2 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 87.19 | |
| cd07675 | 252 | F-BAR_FNBP1L The F-BAR (FES-CIP4 Homology and Bin/ | 87.14 | |
| KOG2264 | 907 | consensus Exostosin EXT1L [Signal transduction mec | 86.87 | |
| TIGR02473 | 141 | flagell_FliJ flagellar export protein FliJ. Member | 86.85 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 86.84 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 86.81 | |
| cd07656 | 241 | F-BAR_srGAP The F-BAR (FES-CIP4 Homology and Bin/A | 86.75 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 86.7 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 86.65 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 86.62 | |
| cd07666 | 243 | BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of S | 86.61 | |
| PRK10722 | 247 | hypothetical protein; Provisional | 86.46 | |
| PF11180 | 192 | DUF2968: Protein of unknown function (DUF2968); In | 86.29 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 86.2 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 86.07 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 86.06 | |
| PRK15178 | 434 | Vi polysaccharide export inner membrane protein Ve | 85.99 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 85.96 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 85.94 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 85.91 | |
| COG1566 | 352 | EmrA Multidrug resistance efflux pump [Defense mec | 85.84 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 85.59 | |
| PF13942 | 179 | Lipoprotein_20: YfhG lipoprotein | 85.53 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 85.52 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 85.52 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 85.24 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 85.17 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 85.14 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 85.02 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 84.82 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 84.73 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 84.48 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 84.01 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 83.79 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 83.67 | |
| cd07657 | 237 | F-BAR_Fes_Fer The F-BAR (FES-CIP4 Homology and Bin | 83.65 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 83.55 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 83.49 | |
| cd09234 | 337 | V_HD-PTP_like Protein-interacting V-domain of mamm | 83.47 | |
| KOG4460 | 741 | consensus Nuclear pore complex, Nup88/rNup84 compo | 83.36 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 83.33 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 83.24 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 83.19 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 82.88 | |
| cd07676 | 253 | F-BAR_FBP17 The F-BAR (FES-CIP4 Homology and Bin/A | 82.75 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 82.68 | |
| cd07624 | 200 | BAR_SNX7_30 The Bin/Amphiphysin/Rvs (BAR) domain o | 82.66 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 82.63 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 82.61 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 82.36 | |
| KOG0244 | 913 | consensus Kinesin-like protein [Cytoskeleton] | 82.3 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 82.29 | |
| cd07652 | 234 | F-BAR_Rgd1 The F-BAR (FES-CIP4 Homology and Bin/Am | 82.24 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 82.21 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 82.17 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 81.92 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 81.57 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 81.55 | |
| PF08172 | 248 | CASP_C: CASP C terminal; InterPro: IPR012955 This | 81.51 | |
| PF08606 | 70 | Prp19: Prp19/Pso4-like; InterPro: IPR013915 This r | 81.49 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 81.46 | |
| PF13815 | 118 | Dzip-like_N: Iguana/Dzip1-like DAZ-interacting pro | 81.34 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 81.32 | |
| PF13863 | 126 | DUF4200: Domain of unknown function (DUF4200) | 81.17 | |
| PF03938 | 158 | OmpH: Outer membrane protein (OmpH-like); InterPro | 81.01 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 80.96 | |
| KOG4460 | 741 | consensus Nuclear pore complex, Nup88/rNup84 compo | 80.72 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 80.62 | |
| PF05262 | 489 | Borrelia_P83: Borrelia P83/100 protein; InterPro: | 80.11 |
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
Probab=98.47 E-value=0.00028 Score=81.21 Aligned_cols=165 Identities=18% Similarity=0.318 Sum_probs=77.1
Q ss_pred hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHH
Q 004063 420 EDFAALEQHIEDLTQEKFALQRSLEASRALSESLAAENSSLTDSYNQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEY 499 (776)
Q Consensus 420 ~~faaLqqhIeDLT~EKfaLqR~L~~s~~l~EsLa~ENsaLt~~yNqQ~~~v~qLk~~mE~Lq~Ei~aQ~~~le~l~aEr 499 (776)
.+...|++.++++..+--.+...+.....-.+++..+-..+..........+..++.++++++.++......++.+..+.
T Consensus 677 ~e~~~l~~~~~~l~~~l~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~e~~~~~~~~ 756 (1179)
T TIGR02168 677 REIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKEL 756 (1179)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 34455555555555555555555555554444455444444444444444455555555555555444444444444444
Q ss_pred HHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHhHhhhhHHHhhhhHHHHHHHHHHHHhHHHhhhhHHHHHHHHHHHHHHH
Q 004063 500 ANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLERQLENSQSEISSYKKKISSLEKERQDFQSTIEALQEEKKMM 579 (776)
Q Consensus 500 DaAq~E~n~A~ERaK~LAaEVV~LEek~lqLRS~eLKleKElE~l~~Er~S~~~q~ssi~kER~~l~stIdaLQEEKklL 579 (776)
..+..++....++...+..++..|+.++..++...-.++.++..+..++..++.++..+..+...++..+..|+.+.+.+
T Consensus 757 ~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~l 836 (1179)
T TIGR02168 757 TELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAAT 836 (1179)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 44444444444444444444444444444333322223334444444444444444444444444444444444444444
Q ss_pred HHHHH
Q 004063 580 QSKLR 584 (776)
Q Consensus 580 qSKLR 584 (776)
+.++.
T Consensus 837 ~~~~~ 841 (1179)
T TIGR02168 837 ERRLE 841 (1179)
T ss_pred HHHHH
Confidence 44433
|
SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. |
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >cd07647 F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Proteins | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >cd07655 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd07671 F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway | Back alignment and domain information |
|---|
| >PF05546 She9_MDM33: She9 / Mdm33 family; InterPro: IPR008839 Members of this family are mitochondrial inner membrane proteins with a role in inner mitochondrial membrane organisation and biogenesis [] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd07658 F-BAR_NOSTRIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Nitric Oxide Synthase TRaffic INducer (NOSTRIN) | Back alignment and domain information |
|---|
| >PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >cd07672 F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 2 | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF04380 BMFP: Membrane fusogenic activity; InterPro: IPR007475 BMFP consists of two structural domains, a coiled-coil C-terminal domain via which the protein self-associates as a trimer, and an N-terminal domain disordered at neutral pH but adopting an amphipathic alpha-helical structure in the presence of phospholipid vesicles, high ionic strength, acidic pH or SDS | Back alignment and domain information |
|---|
| >cd07649 F-BAR_GAS7 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Growth Arrest Specific protein 7 | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >cd07680 F-BAR_PACSIN1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 1 (PACSIN1) | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd07622 BAR_SNX4 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 4 | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF14362 DUF4407: Domain of unknown function (DUF4407) | Back alignment and domain information |
|---|
| >KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >cd07675 F-BAR_FNBP1L The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 1-Like | Back alignment and domain information |
|---|
| >KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02473 flagell_FliJ flagellar export protein FliJ | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >cd07656 F-BAR_srGAP The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Slit-Robo GTPase Activating Proteins | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >cd07666 BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 7 | Back alignment and domain information |
|---|
| >PRK10722 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13942 Lipoprotein_20: YfhG lipoprotein | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >cd07657 F-BAR_Fes_Fer The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fes (feline sarcoma) and Fer (Fes related) tyrosine kinases | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >cd09234 V_HD-PTP_like Protein-interacting V-domain of mammalian His-Domain type N23 protein tyrosine phosphatase and related domains | Back alignment and domain information |
|---|
| >KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >cd07676 F-BAR_FBP17 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 17 | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >cd07624 BAR_SNX7_30 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 7 and 30 | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0244 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >cd07652 F-BAR_Rgd1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Saccharomyces cerevisiae Rho GTPase activating protein Rgd1 and similar proteins | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins | Back alignment and domain information |
|---|
| >PF08606 Prp19: Prp19/Pso4-like; InterPro: IPR013915 This region is found specifically in PRP19-like protein | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13815 Dzip-like_N: Iguana/Dzip1-like DAZ-interacting protein N-terminal | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PF13863 DUF4200: Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >PF03938 OmpH: Outer membrane protein (OmpH-like); InterPro: IPR005632 This entry includes outer membrane proteins such as OmpH (Skp) among others | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF05262 Borrelia_P83: Borrelia P83/100 protein; InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 776 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-15 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-14 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-13 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 9e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 5e-09 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 1e-08 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 2e-08 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 3e-08 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 2e-07 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 2e-07 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 4e-07 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 9e-07 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 1e-06 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 2e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 5e-04 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 9e-08 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 2e-05 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 4e-05 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 4e-05 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 5e-05 | |
| 1m1j_C | 409 | Fibrinogen gamma chain; coiled coils, disulfide ri | 9e-05 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 6e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 78.0 bits (191), Expect = 6e-15
Identities = 67/528 (12%), Positives = 142/528 (26%), Gaps = 156/528 (29%)
Query: 361 MEKETTGAFSKTTTSNIPSAFDYLGNPTVSTSDRGDIRRL-----GSNESSIENQHGFYS 415
++ SK +I + + + RL E ++ F
Sbjct: 38 VQDMPKSILSKEEIDHI------IMSKDAVSG----TLRLFWTLLSKQEEMVQK---FVE 84
Query: 416 TKHNEDFAALEQHIEDLTQEKFALQRSLEASRALSESLAAENSSLTDSYNQQR-SVVNQL 474
++ L I+ ++ + R R + L +N YN R +L
Sbjct: 85 EVLRINYKFLMSPIKTEQRQPSMMTRMYIEQR---DRLYNDNQVFAK-YNVSRLQPYLKL 140
Query: 475 KSEMEKLQEEIKV----------QLVELESFRNE-----------YANVRLECNAADERA 513
+ + +L+ V V L+ + + N++ CN+ +
Sbjct: 141 RQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLK-NCNSPETVL 199
Query: 514 KILASEVIGLEEKALRLRSNELKLERQLENSQSEISSYKKKISSLEKERQ---------- 563
++L L ++ N N + I S + ++ L K +
Sbjct: 200 EMLQK----L---LYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLN 252
Query: 564 ----------DFQSTI----------EAL--QEEKKMMQSKLRKASGSGKSID-FGKTAA 600
+ I + L + + K
Sbjct: 253 VQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLK--- 309
Query: 601 STVNASTSTEDL-----------------AITD--TTLDNSNQDTHDDASLPR-IDASGS 640
+DL +I D T DN D L I++S +
Sbjct: 310 ---YLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDK--LTTIIESSLN 364
Query: 641 TLLPESGRLALEGLAVNIPHDQMRMIHNINALISELALE------KEELVQALSSELAQS 694
L P R + L+V P A I + L + V + ++L +
Sbjct: 365 VLEPAEYRKMFDRLSV-FPPS---------AHIPTILLSLIWFDVIKSDVMVVVNKLHKY 414
Query: 695 SKLKDLNNELSRKLEHQTQRLELLTAQNMA--NENI--SFRQPDSASTHD---------- 740
S ++ E + + + +N + +I + P + + D
Sbjct: 415 SLVEKQPKESTISI-PSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYF 473
Query: 741 --HTAY----ADEGDEVVE--RV---LGWI-MKLFPGGPSRRRTSKLL 776
H + + + + V ++ K+ + + +L
Sbjct: 474 YSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSIL 521
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 | Back alignment and structure |
|---|
| >1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Length = 409 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 776 | |||
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.41 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.31 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.3 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.09 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.49 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 97.24 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.16 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 97.16 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.15 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 97.01 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 96.91 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.6 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 96.47 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.4 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 95.68 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 95.62 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 95.61 | |
| 3abh_A | 312 | Pacsin2, protein kinase C and casein kinase substr | 95.4 | |
| 2x3v_A | 337 | Syndapin I, protein kinase C and casein kinase sub | 95.03 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 94.91 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 94.77 | |
| 3aco_A | 350 | Pacsin2, protein kinase C and casein kinase substr | 94.74 | |
| 4dyl_A | 406 | Tyrosine-protein kinase FES/FPS; structural genomi | 94.56 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 94.53 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 94.24 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 94.15 | |
| 2efk_A | 301 | CDC42-interacting protein 4; EFC domain, structura | 94.07 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 93.44 | |
| 2v0o_A | 276 | FCHO2, FCH domain only protein 2; lipid-binding pr | 93.16 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 92.93 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 92.79 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 92.74 | |
| 2efl_A | 305 | Formin-binding protein 1; EFC domain, structural g | 92.6 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 92.3 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 92.0 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 91.65 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 91.23 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 91.05 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 91.05 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 90.46 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 90.31 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 90.02 | |
| 1wt6_A | 81 | Myotonin-protein kinase; coiled-coil, kinase activ | 89.96 | |
| 3m3w_A | 320 | Pacsin3, protein kinase C and casein kinase II sub | 89.82 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 89.43 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 89.31 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 89.09 | |
| 3i2w_A | 290 | Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocyt | 88.04 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 87.61 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 86.74 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 86.44 | |
| 2no2_A | 107 | HIP-I, huntingtin-interacting protein 1; clathrin | 85.2 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 85.19 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 85.07 | |
| 3ibp_A | 302 | Chromosome partition protein MUKB; structural main | 84.91 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 84.62 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 84.36 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 84.23 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 83.75 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 83.59 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 83.47 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 82.85 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 81.8 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 81.75 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 81.72 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 80.1 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 80.06 |
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
Probab=98.41 E-value=3.3e-07 Score=107.35 Aligned_cols=54 Identities=30% Similarity=0.273 Sum_probs=0.0
Q ss_pred hhHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHhHHHHHHHHHHHhHHHHHHH
Q 004063 667 HNINALISELALEKEELVQALSSELAQSSKLKDLNNELSRKLEHQTQRLELLTA 720 (776)
Q Consensus 667 dsInaLisELa~EReravsaLa~esr~~~dLk~lN~ELsRKLE~qtQRLELlts 720 (776)
..+..-+.+|+.+.+++...|..+.....++.....+|.++|+.++++||-+-.
T Consensus 1112 ~~le~~l~~Le~eie~L~eeLee~~~~~~~le~q~~~L~~ele~L~~~Ieel~~ 1165 (1184)
T 1i84_S 1112 NNALKKIRELESHISDLQEDLESEKAARNKAEKQKRDLSEELEALKTELEDTLD 1165 (1184)
T ss_dssp ------------------------------------------------------
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence 333344455555555555555555555666666667777777777777765433
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3abh_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.00A {Homo sapiens} PDB: 3q0k_A 3lll_A 3hah_A 3qni_A 3hai_A 3q84_A | Back alignment and structure |
|---|
| >2x3v_A Syndapin I, protein kinase C and casein kinase substrate in N protein 1; BAR, N-WAsp, dynamin, pacsin 1, endocytosis; 2.45A {Mus musculus} PDB: 2x3w_A 2x3x_A | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3aco_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4dyl_A Tyrosine-protein kinase FES/FPS; structural genomics, structural genomics consortium, BCR, CR associated substrate, transferase; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >2v0o_A FCHO2, FCH domain only protein 2; lipid-binding protein, EFC domain, vesicle trafficking, membrane curvature, endocytosis, exocytosis, F-BAR domain; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3m3w_A Pacsin3, protein kinase C and casein kinase II substrate P; mouse, BAR domain, endocytosis; 2.60A {Mus musculus} PDB: 3syv_A 3qe6_A | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3i2w_A Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocytosis; 2.67A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >3ibp_A Chromosome partition protein MUKB; structural maintenance of chromosomes, SMC, condensin, chromosome segregation, hinge, dimerization domain; 3.10A {Escherichia coli} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 776 | ||||
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 0.002 |
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain superfamily: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain family: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain domain: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 38.2 bits (88), Expect = 0.002
Identities = 21/172 (12%), Positives = 50/172 (29%), Gaps = 9/172 (5%)
Query: 422 FAALEQHIEDLTQEKFALQRSLEASRALSESLAAENSSLTDSYNQQRSVVNQLKSEMEKL 481
+ ++ + ++ + L E + A S Y + LK + +
Sbjct: 109 RDDFCKQNQEASSDRCS-GLLQVIFSPLEEEVKAGIYSKPGGYRLFVQKLQDLKKKYYEE 167
Query: 482 QEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLERQL 541
+ L+++ ++ D+ E+ KA +++ L
Sbjct: 168 PRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIEVERVKAESAQASAKMLHEMQ 227
Query: 542 ENSQSEISSY--------KKKISSLEKERQDFQSTIEALQEEKKMMQSKLRK 585
++ + K+ +E +R E K Q +L K
Sbjct: 228 RKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQLLK 279
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 776 | |||
| d2efka1 | 279 | CDC42-interacting protein 4, CIP4 {Human (Homo sap | 95.72 | |
| d2efla1 | 288 | Formin-binding protein 1, FNBP1 {Human (Homo sapie | 94.81 | |
| d2efla1 | 288 | Formin-binding protein 1, FNBP1 {Human (Homo sapie | 94.66 | |
| d1f5na1 | 300 | Interferon-induced guanylate-binding protein 1 (GB | 87.78 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 86.42 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 85.83 | |
| d2efka1 | 279 | CDC42-interacting protein 4, CIP4 {Human (Homo sap | 84.43 | |
| d1i4da_ | 200 | Arfaptin, Rac-binding fragment {Human (Homo sapien | 81.51 |
| >d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: BAR/IMD domain-like superfamily: BAR/IMD domain-like family: FCH domain domain: CDC42-interacting protein 4, CIP4 species: Human (Homo sapiens) [TaxId: 9606]
Probab=95.72 E-value=0.58 Score=42.02 Aligned_cols=86 Identities=14% Similarity=0.147 Sum_probs=57.8
Q ss_pred HHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHhHhhhhHH
Q 004063 460 LTDSYNQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLER 539 (776)
Q Consensus 460 Lt~~yNqQ~~~v~qLk~~mE~Lq~Ei~aQ~~~le~l~aErDaAq~E~n~A~ERaK~LAaEVV~LEek~lqLRS~eLKleK 539 (776)
|..-..++......++.++.+++.++......++..+..|+.+..+...|..+...+......-..++.+++...-+...
T Consensus 93 l~~~~~~~~~~~k~~~~~~~~~~k~l~~~~~~~~k~k~~y~~~~~e~e~~~~~~~~~~~~~~~~~~~~~K~~~~~~~~~~ 172 (279)
T d2efka1 93 LTKYSQEMKQERKMHFQEGRRAQQQLENGFKQLENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRSH 172 (279)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCTTSCHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccHHHHHHHHHHHHHHHH
Confidence 33344455666777788888888998888889999999999998888888877666654433334444444444444444
Q ss_pred HhhhhH
Q 004063 540 QLENSQ 545 (776)
Q Consensus 540 ElE~l~ 545 (776)
++++++
T Consensus 173 ~~~~~~ 178 (279)
T d2efka1 173 MAEESK 178 (279)
T ss_dssp HHHHHH
T ss_pred HHHHHH
Confidence 444444
|
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|