Citrus Sinensis ID: 004068
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 775 | 2.2.26 [Sep-21-2011] | |||||||
| Q8RY22 | 1097 | Protease Do-like 7 OS=Ara | yes | no | 0.948 | 0.670 | 0.748 | 0.0 | |
| Q0UY70 | 1017 | Pro-apoptotic serine prot | N/A | no | 0.556 | 0.423 | 0.306 | 1e-53 | |
| Q1E3N5 | 1034 | Pro-apoptotic serine prot | N/A | no | 0.540 | 0.405 | 0.307 | 8e-53 | |
| Q2H334 | 1030 | Pro-apoptotic serine prot | N/A | no | 0.56 | 0.421 | 0.320 | 1e-52 | |
| Q7S9D2 | 1026 | Pro-apoptotic serine prot | N/A | no | 0.545 | 0.412 | 0.304 | 2e-52 | |
| A1CUK5 | 1028 | Pro-apoptotic serine prot | N/A | no | 0.541 | 0.408 | 0.306 | 3e-51 | |
| Q0CSC0 | 1038 | Pro-apoptotic serine prot | N/A | no | 0.536 | 0.400 | 0.315 | 3e-51 | |
| A1DP85 | 1028 | Pro-apoptotic serine prot | N/A | no | 0.548 | 0.413 | 0.315 | 5e-51 | |
| Q4WLG1 | 1028 | Pro-apoptotic serine prot | yes | no | 0.548 | 0.413 | 0.315 | 1e-50 | |
| A6RG85 | 1028 | Pro-apoptotic serine prot | N/A | no | 0.548 | 0.413 | 0.292 | 1e-49 |
| >sp|Q8RY22|DEGP7_ARATH Protease Do-like 7 OS=Arabidopsis thaliana GN=DEGP7 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 1155 bits (2989), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 559/747 (74%), Positives = 634/747 (84%), Gaps = 12/747 (1%)
Query: 25 SLVFQVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVPRH 84
S+ VQDLHSITPD+FLEVSGAVIHPLSYQQARNFRFPCGL YVA+PGYMLFRAGVPRH
Sbjct: 363 SVSVSVQDLHSITPDHFLEVSGAVIHPLSYQQARNFRFPCGLAYVADPGYMLFRAGVPRH 422
Query: 85 AIIKKFAGEEISRLEDLISVLSKLSRGARVPIEYSSYTDRHRRKSVLVTIDRHEWYAPPQ 144
AIIKK A E+IS L DL+SVLSKLSRGARVP+EY S+TDRHR+KSVLVTID HEWYAPPQ
Sbjct: 423 AIIKKVANEDISSLGDLVSVLSKLSRGARVPLEYMSHTDRHRKKSVLVTIDHHEWYAPPQ 482
Query: 145 IYTRNDSSGLWSANPAILSEVLMPSSGINGGVQGVASQTVSICGELVHMEHMHQRNNQEL 204
+YTRNDSSGLW A PAI + PS G NG SQ +S+C E MH+ N + +
Sbjct: 483 LYTRNDSSGLWDAKPAIEPASVSPSIGNNGFP---ISQDISLCHH--DTEPMHEVNVRGV 537
Query: 205 TDGVTSMETACEHASAESISRGESDNGRKKRRVEENISADGVVADCSPHESGDARLEDSS 264
TD MET S+ S+ + + KK+RV+E+ S+DG+ A+ S + S + + +D+
Sbjct: 538 TDIAAIMET-----SSGDGSQNDFGSEAKKQRVDED-SSDGIAANGSLYGS-EFKSDDAM 590
Query: 265 TMENAGSRDYFGAPAATTNASFAESVIEPTLVMFEVHVPPSCMIDGVHSQHFFGTGVIIY 324
+ RD+ GA A + NAS AE IEP LVMFEVHVPPSC +DGVHSQHFFGTG+IIY
Sbjct: 591 ETDTTVLRDFEGATALSANASLAERAIEPALVMFEVHVPPSCSLDGVHSQHFFGTGIIIY 650
Query: 325 HSQSMGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGVAG 384
HS +MGL VVDKNTVAISASDVMLSFAAFP+EIPGEVVFLHPVHN+ALIAY+PS++ A
Sbjct: 651 HSSNMGLAVVDKNTVAISASDVMLSFAAFPVEIPGEVVFLHPVHNYALIAYNPSAMDPAS 710
Query: 385 ASVVRAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNISSADCPRYRAMN 444
ASV+RAAELLPEPAL+RGDSVYLVGLSR+LQATSRKSIVTNPCAALNI SAD PRYRA N
Sbjct: 711 ASVIRAAELLPEPALQRGDSVYLVGLSRNLQATSRKSIVTNPCAALNIGSADSPRYRATN 770
Query: 445 MEVIELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQVKFGCSSSEDHQFVRGIPIYTISRV 504
MEVIELDTDFGS+FSG LTDE GR++AIWGSFSTQVK+ +SSEDHQFVRGIP+Y IS+V
Sbjct: 771 MEVIELDTDFGSSFSGALTDEQGRIRAIWGSFSTQVKYSSTSSEDHQFVRGIPVYAISQV 830
Query: 505 LDKIISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDPVR 564
L+KII+G +GP+LLINGVKRPMPLVRILEVELYPTLLSKARSFGLSD+W+Q LVKKDPVR
Sbjct: 831 LEKIITGGNGPALLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDEWIQVLVKKDPVR 890
Query: 565 RQVLRVKGCLAGSKAENMLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDITI 624
RQVLRVKGCLAGSKAEN+LEQGDM+LA+NK PVTCF+DIE ACQ LDK + L++TI
Sbjct: 891 RQVLRVKGCLAGSKAENLLEQGDMVLAVNKMPVTCFNDIEAACQTLDKGSYSDENLNLTI 950
Query: 625 FRQGREIELQVGTDVRDGNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWCHG 684
RQG+E+EL VGTD RDGNGTTRVINWCGC+VQDPHPAVRALGFLPEEGHGVYV RWCHG
Sbjct: 951 LRQGQELELVVGTDKRDGNGTTRVINWCGCVVQDPHPAVRALGFLPEEGHGVYVTRWCHG 1010
Query: 685 SPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHLNGKPRVLTLKQD 744
SP HRYGLYALQWIVE+NGK+TPDL AF + TKE+EHG+FVR+RTVHLNGKPRVLTLKQD
Sbjct: 1011 SPAHRYGLYALQWIVEVNGKKTPDLNAFADATKELEHGQFVRIRTVHLNGKPRVLTLKQD 1070
Query: 745 LHYWPTWELIFDPDTALWRRKSVKALN 771
LHYWPTWEL FDP+TALWRR +KAL
Sbjct: 1071 LHYWPTWELRFDPETALWRRNILKALQ 1097
|
Probable serine protease. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: - |
| >sp|Q0UY70|NM111_PHANO Pro-apoptotic serine protease NMA111 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NMA111 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q1E3N5|NM111_COCIM Pro-apoptotic serine protease NMA111 OS=Coccidioides immitis (strain RS) GN=NMA111 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q2H334|NM111_CHAGB Pro-apoptotic serine protease NMA111 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=NMA111 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q7S9D2|NM111_NEUCR Pro-apoptotic serine protease nma-111 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nma-111 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|A1CUK5|NM111_ASPCL Pro-apoptotic serine protease nma111 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nma111 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q0CSC0|NM111_ASPTN Pro-apoptotic serine protease nma111 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nma111 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|A1DP85|NM111_NEOFI Pro-apoptotic serine protease nma111 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nma111 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q4WLG1|NM111_ASPFU Pro-apoptotic serine protease nma111 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nma111 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|A6RG85|NM111_AJECN Pro-apoptotic serine protease NMA111 OS=Ajellomyces capsulata (strain NAm1 / WU24) GN=NMA111 PE=3 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 775 | ||||||
| 255584471 | 1112 | protein binding protein, putative [Ricin | 0.957 | 0.667 | 0.820 | 0.0 | |
| 359488197 | 1115 | PREDICTED: protease Do-like 7-like [Viti | 0.965 | 0.670 | 0.82 | 0.0 | |
| 449464156 | 1120 | PREDICTED: protease Do-like 7-like [Cucu | 0.983 | 0.680 | 0.782 | 0.0 | |
| 224069318 | 1128 | predicted protein [Populus trichocarpa] | 0.961 | 0.660 | 0.802 | 0.0 | |
| 356569531 | 1113 | PREDICTED: protease Do-like 7-like [Glyc | 0.967 | 0.673 | 0.803 | 0.0 | |
| 356539842 | 1113 | PREDICTED: protease Do-like 7-like [Glyc | 0.967 | 0.673 | 0.801 | 0.0 | |
| 449502347 | 713 | PREDICTED: protease Do-like 7-like [Cucu | 0.903 | 0.981 | 0.797 | 0.0 | |
| 30678834 | 1097 | protease Do-like 7 [Arabidopsis thaliana | 0.948 | 0.670 | 0.748 | 0.0 | |
| 297828818 | 1097 | hypothetical protein ARALYDRAFT_477585 [ | 0.943 | 0.666 | 0.743 | 0.0 | |
| 296087169 | 1052 | unnamed protein product [Vitis vinifera] | 0.886 | 0.653 | 0.758 | 0.0 |
| >gi|255584471|ref|XP_002532965.1| protein binding protein, putative [Ricinus communis] gi|223527258|gb|EEF29416.1| protein binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1276 bits (3302), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 610/743 (82%), Positives = 673/743 (90%), Gaps = 1/743 (0%)
Query: 30 VQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVPRHAIIKK 89
VQDLHSITPDYFLEVSGAVIHPLSYQQARNFRF CGLVYV+EPGYMLFRAGVPRHAIIKK
Sbjct: 366 VQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFQCGLVYVSEPGYMLFRAGVPRHAIIKK 425
Query: 90 FAGEEISRLEDLISVLSKLSRGARVPIEYSSYTDRHRRKSVLVTIDRHEWYAPPQIYTRN 149
FAGEEISR+++LISV+SKLSRGARVP+EY SY DRHRRKSVLVT+DRHEWYAPPQIYTR+
Sbjct: 426 FAGEEISRVDELISVISKLSRGARVPLEYLSYMDRHRRKSVLVTVDRHEWYAPPQIYTRD 485
Query: 150 DSSGLWSANPAILSEVLMPSSGINGGVQGVASQTVSICGELVHMEHMHQRNNQELTDGVT 209
DSSGLW+A PAI E L+ S+ IN QG+ SQTVS+ GE H EH++Q + ELTDGV
Sbjct: 486 DSSGLWTAKPAIQPEFLLQSTQINEIGQGLTSQTVSLSGEATHTEHVNQGDQPELTDGVI 545
Query: 210 SMETACEHASAESISRGESDNGRKKRRVEENISADGVVADCSP-HESGDARLEDSSTMEN 268
SMET+ E +S E + ESD G KKRRV + S D V+D S HESG +LED S++EN
Sbjct: 546 SMETSYEQSSGEPNFQDESDVGTKKRRVSDLASNDIAVSDRSLLHESGGVKLEDRSSVEN 605
Query: 269 AGSRDYFGAPAATTNASFAESVIEPTLVMFEVHVPPSCMIDGVHSQHFFGTGVIIYHSQS 328
RDY GA AAT NASFAESVIEPTLVMFEVHVPP+ M+DGVHSQHFFGTGVI+YHSQ
Sbjct: 606 DVFRDYQGATAATANASFAESVIEPTLVMFEVHVPPTIMLDGVHSQHFFGTGVIVYHSQD 665
Query: 329 MGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGVAGASVV 388
MGLV VD+NTVAISASDVMLSFAAFPIEIPGEV+FLHPVHN+AL+AY+P +LG GAS+V
Sbjct: 666 MGLVAVDRNTVAISASDVMLSFAAFPIEIPGEVIFLHPVHNYALVAYNPLALGAVGASMV 725
Query: 389 RAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNISSADCPRYRAMNMEVI 448
RAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNI SADCPRYRA NMEVI
Sbjct: 726 RAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNIGSADCPRYRATNMEVI 785
Query: 449 ELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQVKFGCSSSEDHQFVRGIPIYTISRVLDKI 508
ELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQ+K+GC++SEDHQFVRGIPIY+IS++L+KI
Sbjct: 786 ELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQLKYGCNTSEDHQFVRGIPIYSISQILEKI 845
Query: 509 ISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDPVRRQVL 568
I GA+GP LLINGV++PMPLVR LEVELYPTLLSKARSFGLSD WVQALVKKDPVRRQVL
Sbjct: 846 IHGANGPPLLINGVRKPMPLVRTLEVELYPTLLSKARSFGLSDHWVQALVKKDPVRRQVL 905
Query: 569 RVKGCLAGSKAENMLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDITIFRQG 628
RVK CLAGSKAEN+LEQGDM+LA+NK+PVTCFHDIE ACQALDK GE++GKL++TIFRQG
Sbjct: 906 RVKVCLAGSKAENLLEQGDMVLAVNKEPVTCFHDIECACQALDKSGENDGKLNMTIFRQG 965
Query: 629 REIELQVGTDVRDGNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWCHGSPVH 688
REI+L VGTDVR+GNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWCHGSPVH
Sbjct: 966 REIDLLVGTDVREGNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWCHGSPVH 1025
Query: 689 RYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHLNGKPRVLTLKQDLHYW 748
RYGLYALQWIVEINGK PDL+AF+NVTKE+ HGEFVRVRTVHLNGKPRVLTLKQDLHYW
Sbjct: 1026 RYGLYALQWIVEINGKPVPDLDAFINVTKELGHGEFVRVRTVHLNGKPRVLTLKQDLHYW 1085
Query: 749 PTWELIFDPDTALWRRKSVKALN 771
PTWEL FDP TA+W R+++KAL+
Sbjct: 1086 PTWELRFDPGTAMWSRETIKALD 1108
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359488197|ref|XP_002271823.2| PREDICTED: protease Do-like 7-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449464156|ref|XP_004149795.1| PREDICTED: protease Do-like 7-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224069318|ref|XP_002302954.1| predicted protein [Populus trichocarpa] gi|222844680|gb|EEE82227.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356569531|ref|XP_003552953.1| PREDICTED: protease Do-like 7-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356539842|ref|XP_003538402.1| PREDICTED: protease Do-like 7-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449502347|ref|XP_004161615.1| PREDICTED: protease Do-like 7-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|30678834|ref|NP_566204.2| protease Do-like 7 [Arabidopsis thaliana] gi|75330785|sp|Q8RY22.1|DEGP7_ARATH RecName: Full=Protease Do-like 7 gi|19310429|gb|AAL84951.1| AT3g03380/T21P5_20 [Arabidopsis thaliana] gi|27363448|gb|AAO11643.1| At3g03380/T21P5_20 [Arabidopsis thaliana] gi|332640417|gb|AEE73938.1| protease Do-like 7 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297828818|ref|XP_002882291.1| hypothetical protein ARALYDRAFT_477585 [Arabidopsis lyrata subsp. lyrata] gi|297328131|gb|EFH58550.1| hypothetical protein ARALYDRAFT_477585 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|296087169|emb|CBI33543.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 775 | ||||||
| TAIR|locus:2099619 | 1097 | DEG7 "degradation of periplasm | 0.947 | 0.669 | 0.749 | 4.5e-304 | |
| UNIPROTKB|A4RJH4 | 1029 | NMA111 "Pro-apoptotic serine p | 0.313 | 0.236 | 0.309 | 1.5e-59 | |
| POMBASE|SPAC23G3.12c | 996 | SPAC23G3.12c "serine protease | 0.283 | 0.220 | 0.322 | 3.3e-53 | |
| SGD|S000005067 | 997 | NMA111 "Serine protease and ge | 0.307 | 0.238 | 0.294 | 3.2e-51 | |
| ASPGD|ASPL0000026344 | 1026 | AN10673 [Emericella nidulans ( | 0.310 | 0.234 | 0.319 | 6.5e-41 | |
| POMBASE|SPBC1685.05 | 997 | SPBC1685.05 "serine protease ( | 0.179 | 0.139 | 0.369 | 8.3e-32 |
| TAIR|locus:2099619 DEG7 "degradation of periplasmic proteins 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2918 (1032.2 bits), Expect = 4.5e-304, P = 4.5e-304
Identities = 559/746 (74%), Positives = 635/746 (85%)
Query: 25 SLVFQVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVPRH 84
S+ VQDLHSITPD+FLEVSGAVIHPLSYQQARNFRFPCGL YVA+PGYMLFRAGVPRH
Sbjct: 363 SVSVSVQDLHSITPDHFLEVSGAVIHPLSYQQARNFRFPCGLAYVADPGYMLFRAGVPRH 422
Query: 85 AIIKKFAGEEISRLEDLISVLSKLSRGARVPIEYSSYTDRHRRKSVLVTIDRHEWYAPPQ 144
AIIKK A E+IS L DL+SVLSKLSRGARVP+EY S+TDRHR+KSVLVTID HEWYAPPQ
Sbjct: 423 AIIKKVANEDISSLGDLVSVLSKLSRGARVPLEYMSHTDRHRKKSVLVTIDHHEWYAPPQ 482
Query: 145 IYTRNDSSGLWSANPAILSEVLMPSSGINGGVQGVASQTVSICGELVHMEHMHQRNNQEL 204
+YTRNDSSGLW A PAI + PS G NG SQ +S+C E MH+ N + +
Sbjct: 483 LYTRNDSSGLWDAKPAIEPASVSPSIGNNGFP---ISQDISLCHH--DTEPMHEVNVRGV 537
Query: 205 TDGVTSMETACEHASAESISRGESDNGRKKRRVEENISADGVVADCSPHESGDARLEDSS 264
TD MET+ S + S+ + + KK+RV+E+ S+DG+ A+ S + S + + +D+
Sbjct: 538 TDIAAIMETS----SGDG-SQNDFGSEAKKQRVDED-SSDGIAANGSLYGS-EFKSDDAM 590
Query: 265 TMENAGSRDYFGAPAATTNASFAESVIEPTLVMFEVHVPPSCMIDGVHSQHFFGTGVIIY 324
+ RD+ GA A + NAS AE IEP LVMFEVHVPPSC +DGVHSQHFFGTG+IIY
Sbjct: 591 ETDTTVLRDFEGATALSANASLAERAIEPALVMFEVHVPPSCSLDGVHSQHFFGTGIIIY 650
Query: 325 HSQSMGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGVAG 384
HS +MGL VVDKNTVAISASDVMLSFAAFP+EIPGEVVFLHPVHN+ALIAY+PS++ A
Sbjct: 651 HSSNMGLAVVDKNTVAISASDVMLSFAAFPVEIPGEVVFLHPVHNYALIAYNPSAMDPAS 710
Query: 385 ASVVRAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNISSADCPRYRAMN 444
ASV+RAAELLPEPAL+RGDSVYLVGLSR+LQATSRKSIVTNPCAALNI SAD PRYRA N
Sbjct: 711 ASVIRAAELLPEPALQRGDSVYLVGLSRNLQATSRKSIVTNPCAALNIGSADSPRYRATN 770
Query: 445 MEVIELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQVKFGCSSSEDHQFVRGIPIYTISRV 504
MEVIELDTDFGS+FSG LTDE GR++AIWGSFSTQVK+ +SSEDHQFVRGIP+Y IS+V
Sbjct: 771 MEVIELDTDFGSSFSGALTDEQGRIRAIWGSFSTQVKYSSTSSEDHQFVRGIPVYAISQV 830
Query: 505 LDKIISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDPVR 564
L+KII+G +GP+LLINGVKRPMPLVRILEVELYPTLLSKARSFGLSD+W+Q LVKKDPVR
Sbjct: 831 LEKIITGGNGPALLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDEWIQVLVKKDPVR 890
Query: 565 RQVLRVKGCLAGSKAENMLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDITI 624
RQVLRVKGCLAGSKAEN+LEQGDM+LA+NK PVTCF+DIE ACQ LDK + L++TI
Sbjct: 891 RQVLRVKGCLAGSKAENLLEQGDMVLAVNKMPVTCFNDIEAACQTLDKGSYSDENLNLTI 950
Query: 625 FRQGREIELQVGTDVRDGNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWCHG 684
RQG+E+EL VGTD RDGNGTTRVINWCGC+VQDPHPAVRALGFLPEEGHGVYV RWCHG
Sbjct: 951 LRQGQELELVVGTDKRDGNGTTRVINWCGCVVQDPHPAVRALGFLPEEGHGVYVTRWCHG 1010
Query: 685 SPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHLNGKPRVLTLKQD 744
SP HRYGLYALQWIVE+NGK+TPDL AF + TKE+EHG+FVR+RTVHLNGKPRVLTLKQD
Sbjct: 1011 SPAHRYGLYALQWIVEVNGKKTPDLNAFADATKELEHGQFVRIRTVHLNGKPRVLTLKQD 1070
Query: 745 LHYWPTWELIFDPDTALWRRKSVKAL 770
LHYWPTWEL FDP+TALWRR +KAL
Sbjct: 1071 LHYWPTWELRFDPETALWRRNILKAL 1096
|
|
| UNIPROTKB|A4RJH4 NMA111 "Pro-apoptotic serine protease NMA111" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC23G3.12c SPAC23G3.12c "serine protease (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| SGD|S000005067 NMA111 "Serine protease and general molecular chaperone" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000026344 AN10673 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC1685.05 SPBC1685.05 "serine protease (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q8RY22 | DEGP7_ARATH | 3, ., 4, ., 2, 1, ., - | 0.7483 | 0.9483 | 0.6700 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
|||
 | GSVIVG00022376001 | SubName- Full=Chromosome chr14 scaffold_26, whole genome shotgun sequence; (1114 aa) | |||||||||
(Vitis vinifera) | |||||||||||
 | psbP1 | • | 0.479 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 775 | |||
| pfam12812 | 78 | pfam12812, PDZ_1, PDZ-like domain | 2e-26 | |
| TIGR02037 | 428 | TIGR02037, degP_htrA_DO, periplasmic serine protea | 2e-10 | |
| pfam12812 | 78 | pfam12812, PDZ_1, PDZ-like domain | 7e-08 | |
| cd00987 | 90 | cd00987, PDZ_serine_protease, PDZ domain of tryspi | 1e-04 | |
| cd00987 | 90 | cd00987, PDZ_serine_protease, PDZ domain of tryspi | 3e-04 |
| >gnl|CDD|193288 pfam12812, PDZ_1, PDZ-like domain | Back alignment and domain information |
|---|
Score = 102 bits (257), Expect = 2e-26
Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
Query: 35 SITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAG-VPRHAIIKKFAGE 93
+ITPD F+EV+GA H LSYQQAR++ P G VYVAE G AG VP+ II +
Sbjct: 1 AITPDRFVEVAGASFHDLSYQQARSYAIPVGGVYVAEAGGSFSLAGGVPKGWIITSVNNK 60
Query: 94 EISRLEDLISVLSKL 108
L+ I V+ K+
Sbjct: 61 PTPNLDTFIEVMKKI 75
|
PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates. this is a family of PDZ-like domains from bacteria, plants and fungi. Length = 78 |
| >gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >gnl|CDD|193288 pfam12812, PDZ_1, PDZ-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 775 | |||
| KOG1421 | 955 | consensus Predicted signaling-associated protein ( | 100.0 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 100.0 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 100.0 | |
| KOG1421 | 955 | consensus Predicted signaling-associated protein ( | 100.0 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 100.0 | |
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 100.0 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 100.0 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 99.97 | |
| PF12812 | 78 | PDZ_1: PDZ-like domain | 99.97 | |
| KOG1320 | 473 | consensus Serine protease [Posttranslational modif | 99.82 | |
| KOG1320 | 473 | consensus Serine protease [Posttranslational modif | 99.77 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 99.75 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 99.64 | |
| PF13180 | 82 | PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ | 99.26 | |
| PF12812 | 78 | PDZ_1: PDZ-like domain | 99.16 | |
| PF13365 | 120 | Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 | 99.12 | |
| PF13180 | 82 | PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ | 99.09 | |
| cd00987 | 90 | PDZ_serine_protease PDZ domain of tryspin-like ser | 99.08 | |
| cd00991 | 79 | PDZ_archaeal_metalloprotease PDZ domain of archaea | 99.0 | |
| cd00986 | 79 | PDZ_LON_protease PDZ domain of ATP-dependent LON s | 98.88 | |
| cd00989 | 79 | PDZ_metalloprotease PDZ domain of bacterial and pl | 98.87 | |
| cd00987 | 90 | PDZ_serine_protease PDZ domain of tryspin-like ser | 98.83 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 98.82 | |
| cd00986 | 79 | PDZ_LON_protease PDZ domain of ATP-dependent LON s | 98.82 | |
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 98.79 | |
| cd00991 | 79 | PDZ_archaeal_metalloprotease PDZ domain of archaea | 98.76 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 98.75 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 98.74 | |
| cd00988 | 85 | PDZ_CTP_protease PDZ domain of C-terminal processi | 98.72 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 98.72 | |
| cd00990 | 80 | PDZ_glycyl_aminopeptidase PDZ domain associated wi | 98.71 | |
| KOG3580 | 1027 | consensus Tight junction proteins [Signal transduc | 98.67 | |
| TIGR01713 | 259 | typeII_sec_gspC general secretion pathway protein | 98.54 | |
| KOG3209 | 984 | consensus WW domain-containing protein [General fu | 98.53 | |
| cd00989 | 79 | PDZ_metalloprotease PDZ domain of bacterial and pl | 98.49 | |
| cd00136 | 70 | PDZ PDZ domain, also called DHR (Dlg homologous re | 98.47 | |
| TIGR01713 | 259 | typeII_sec_gspC general secretion pathway protein | 98.46 | |
| KOG3209 | 984 | consensus WW domain-containing protein [General fu | 98.44 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 98.34 | |
| cd00990 | 80 | PDZ_glycyl_aminopeptidase PDZ domain associated wi | 98.32 | |
| cd00988 | 85 | PDZ_CTP_protease PDZ domain of C-terminal processi | 98.31 | |
| PLN00049 | 389 | carboxyl-terminal processing protease; Provisional | 98.18 | |
| TIGR03279 | 433 | cyano_FeS_chp putative FeS-containing Cyanobacteri | 98.16 | |
| PF00595 | 81 | PDZ: PDZ domain (Also known as DHR or GLGF) Coordi | 98.15 | |
| smart00228 | 85 | PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als | 98.15 | |
| cd00992 | 82 | PDZ_signaling PDZ domain found in a variety of Eum | 98.14 | |
| TIGR00225 | 334 | prc C-terminal peptidase (prc). A C-terminal pepti | 98.12 | |
| TIGR02860 | 402 | spore_IV_B stage IV sporulation protein B. SpoIVB, | 98.09 | |
| PF04495 | 138 | GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: | 98.05 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 98.03 | |
| cd00136 | 70 | PDZ PDZ domain, also called DHR (Dlg homologous re | 97.98 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 97.94 | |
| PF00089 | 220 | Trypsin: Trypsin; InterPro: IPR001254 In the MEROP | 97.91 | |
| TIGR03279 | 433 | cyano_FeS_chp putative FeS-containing Cyanobacteri | 97.85 | |
| COG0793 | 406 | Prc Periplasmic protease [Cell envelope biogenesis | 97.84 | |
| smart00228 | 85 | PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als | 97.76 | |
| TIGR02860 | 402 | spore_IV_B stage IV sporulation protein B. SpoIVB, | 97.71 | |
| KOG3580 | 1027 | consensus Tight junction proteins [Signal transduc | 97.68 | |
| PF00595 | 81 | PDZ: PDZ domain (Also known as DHR or GLGF) Coordi | 97.62 | |
| TIGR00225 | 334 | prc C-terminal peptidase (prc). A C-terminal pepti | 97.61 | |
| PLN00049 | 389 | carboxyl-terminal processing protease; Provisional | 97.56 | |
| KOG3553 | 124 | consensus Tax interaction protein TIP1 [Cell wall/ | 97.56 | |
| KOG3834 | 462 | consensus Golgi reassembly stacking protein GRASP6 | 97.54 | |
| cd00992 | 82 | PDZ_signaling PDZ domain found in a variety of Eum | 97.51 | |
| PRK11186 | 667 | carboxy-terminal protease; Provisional | 97.46 | |
| KOG3605 | 829 | consensus Beta amyloid precursor-binding protein [ | 97.42 | |
| PRK09681 | 276 | putative type II secretion protein GspC; Provision | 97.4 | |
| cd00190 | 232 | Tryp_SPc Trypsin-like serine protease; Many of the | 97.39 | |
| KOG3129 | 231 | consensus 26S proteasome regulatory complex, subun | 97.16 | |
| PF14685 | 88 | Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 | 97.15 | |
| PRK09681 | 276 | putative type II secretion protein GspC; Provision | 97.13 | |
| COG3480 | 342 | SdrC Predicted secreted protein containing a PDZ d | 97.11 | |
| KOG3129 | 231 | consensus 26S proteasome regulatory complex, subun | 97.1 | |
| smart00020 | 229 | Tryp_SPc Trypsin-like serine protease. Many of the | 97.04 | |
| PF14685 | 88 | Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 | 96.8 | |
| PF00863 | 235 | Peptidase_C4: Peptidase family C4 This family belo | 96.75 | |
| COG3480 | 342 | SdrC Predicted secreted protein containing a PDZ d | 96.7 | |
| COG0793 | 406 | Prc Periplasmic protease [Cell envelope biogenesis | 96.66 | |
| COG3031 | 275 | PulC Type II secretory pathway, component PulC [In | 96.63 | |
| COG3975 | 558 | Predicted protease with the C-terminal PDZ domain | 96.15 | |
| PF04495 | 138 | GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: | 95.95 | |
| PRK11186 | 667 | carboxy-terminal protease; Provisional | 95.61 | |
| COG3975 | 558 | Predicted protease with the C-terminal PDZ domain | 95.06 | |
| COG3591 | 251 | V8-like Glu-specific endopeptidase [Amino acid tra | 94.9 | |
| KOG3542 | 1283 | consensus cAMP-regulated guanine nucleotide exchan | 94.52 | |
| KOG3532 | 1051 | consensus Predicted protein kinase [General functi | 94.43 | |
| COG3031 | 275 | PulC Type II secretory pathway, component PulC [In | 94.4 | |
| KOG3553 | 124 | consensus Tax interaction protein TIP1 [Cell wall/ | 93.45 | |
| KOG3550 | 207 | consensus Receptor targeting protein Lin-7 [Extrac | 93.42 | |
| KOG3571 | 626 | consensus Dishevelled 3 and related proteins [Gene | 93.23 | |
| KOG3532 | 1051 | consensus Predicted protein kinase [General functi | 92.83 | |
| KOG3552 | 1298 | consensus FERM domain protein FRM-8 [General funct | 92.57 | |
| PF10459 | 698 | Peptidase_S46: Peptidase S46; InterPro: IPR019500 | 92.45 | |
| KOG3552 | 1298 | consensus FERM domain protein FRM-8 [General funct | 92.02 | |
| KOG3606 | 358 | consensus Cell polarity protein PAR6 [Signal trans | 91.28 | |
| KOG3550 | 207 | consensus Receptor targeting protein Lin-7 [Extrac | 90.93 | |
| COG0750 | 375 | Predicted membrane-associated Zn-dependent proteas | 90.84 | |
| KOG1892 | 1629 | consensus Actin filament-binding protein Afadin [C | 90.83 | |
| PF00548 | 172 | Peptidase_C3: 3C cysteine protease (picornain 3C); | 89.85 | |
| KOG0609 | 542 | consensus Calcium/calmodulin-dependent serine prot | 88.97 | |
| PF11874 | 183 | DUF3394: Domain of unknown function (DUF3394); Int | 88.69 | |
| KOG0606 | 1205 | consensus Microtubule-associated serine/threonine | 88.43 | |
| KOG3605 | 829 | consensus Beta amyloid precursor-binding protein [ | 86.34 | |
| COG0750 | 375 | Predicted membrane-associated Zn-dependent proteas | 85.58 | |
| PF08192 | 695 | Peptidase_S64: Peptidase family S64; InterPro: IPR | 84.81 | |
| KOG3834 | 462 | consensus Golgi reassembly stacking protein GRASP6 | 84.18 | |
| KOG3551 | 506 | consensus Syntrophins (type beta) [Extracellular s | 83.2 | |
| KOG2921 | 484 | consensus Intramembrane metalloprotease (sterol-re | 82.25 | |
| KOG3651 | 429 | consensus Protein kinase C, alpha binding protein | 80.29 | |
| KOG3542 | 1283 | consensus cAMP-regulated guanine nucleotide exchan | 80.12 |
| >KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.2e-117 Score=973.87 Aligned_cols=594 Identities=34% Similarity=0.536 Sum_probs=541.6
Q ss_pred ecCCeeEEEEEeccccccCCceeEEecCeeeecCCHHHHhhcccccCeEEEeCCCcccccCCCCcceEEEccCCccCCCH
Q 004068 19 AEPNTSSLVFQVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVPRHAIIKKFAGEEISRL 98 (775)
Q Consensus 19 ~~~~~~~~~~~v~dlh~itp~~f~~v~g~~~h~lsyq~ar~~~~~~~gv~v~~~g~~~~~~~~~~~~ii~~~~~~~~~~l 98 (775)
..|.+++++|+|||||+|||+||||||||+|||||||+||+|++||+||||++||++|...+-.++|||++|||||||||
T Consensus 358 Rggqelel~vtvqdlh~itp~R~levcGav~hdlsyq~ar~y~lP~~GvyVa~~~gsf~~~~~~y~~ii~~vanK~tPdL 437 (955)
T KOG1421|consen 358 RGGQELELTVTVQDLHGITPDRFLEVCGAVFHDLSYQLARLYALPVEGVYVASPGGSFRHRGPRYGQIIDSVANKPTPDL 437 (955)
T ss_pred eCCEEEEEEEEeccccCCCCceEEEEcceEecCCCHHHHhhcccccCcEEEccCCCCccccCCcceEEEEeecCCcCCCH
Confidence 56789999999999999999999999999999999999999999999999999995554444434999999999999999
Q ss_pred HHHHHHHhcCCCCceeeEEEeeeccccccceEEEEEccCCCCCCCeeEEecCCCCCCccCCCCcccCCCCCCCCCCCCcc
Q 004068 99 EDLISVLSKLSRGARVPIEYSSYTDRHRRKSVLVTIDRHEWYAPPQIYTRNDSSGLWSANPAILSEVLMPSSGINGGVQG 178 (775)
Q Consensus 99 ~~fi~v~~~~~~~~rv~~~y~~~~d~h~~~~~~~~idr~~w~~~~~~~~rnd~tg~w~~~~~~~p~~~~~~~~~~~~~~~ 178 (775)
|+||+|||+||||+||+++|+|++|+|++++.+|+||| |||.+|++|+|||+|||||++++.+|.|+
T Consensus 438 daFidvlk~L~dg~rV~vry~hl~dkh~p~v~~v~iDr-Hwy~p~~~~trndetglWdrk~L~~pqPa------------ 504 (955)
T KOG1421|consen 438 DAFIDVLKELPDGARVPVRYHHLTDKHSPRVTTVTIDR-HWYWPFREYTRNDETGLWDRKNLKDPQPA------------ 504 (955)
T ss_pred HHHHHHHHhccCCCeeeEEEEEecCCCCceEEEEEEec-cccccceeeeeCCCcccccccccCCCCcc------------
Confidence 99999999999999999999999999999999999999 99999999999999999999999999986
Q ss_pred ccccccccccccceeccccccCccccccccccchhhcccccccccccCCccccccccceeecccccCccccCCCCCCCCc
Q 004068 179 VASQTVSICGELVHMEHMHQRNNQELTDGVTSMETACEHASAESISRGESDNGRKKRRVEENISADGVVADCSPHESGDA 258 (775)
Q Consensus 179 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~ 258 (775)
.+.+|.+.+..+
T Consensus 505 --~~~kP~s~~ip~------------------------------------------------------------------ 516 (955)
T KOG1421|consen 505 --ISIKPASVSIPS------------------------------------------------------------------ 516 (955)
T ss_pred --cccCCccccCCC------------------------------------------------------------------
Confidence 456666554220
Q ss_pred cccccccccccCCCCcCCCCccCCChhhhhhhhcCcEEEEEEeecCccccCCccccceeEEEEEEEecCCceEEEEecce
Q 004068 259 RLEDSSTMENAGSRDYFGAPAATTNASFAESVIEPTLVMFEVHVPPSCMIDGVHSQHFFGTGVIIYHSQSMGLVVVDKNT 338 (775)
Q Consensus 259 ~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~l~~SvV~V~~~~~~~~~~Dg~~~~~~~GSGvVId~~~~~GlVLTnr~~ 338 (775)
+ .+.++..+++..|+|.|.+.+| ..+||..+....|||+|++ .++||++++|.+
T Consensus 517 -i---------------------~~~~~~~~~i~~~~~~v~~~~~--~~l~g~s~~i~kgt~~i~d--~~~g~~vvsr~~ 570 (955)
T KOG1421|consen 517 -I---------------------GVNNFPSADISNCLVDVEPMMP--VNLDGVSSDIYKGTALIMD--TSKGLGVVSRSV 570 (955)
T ss_pred -c---------------------CcCCcchhHHhhhhhhheecee--eccccchhhhhcCceEEEE--ccCCceeEeccc
Confidence 1 1113345678899999999999 5999999888999999999 579999999999
Q ss_pred eccCCceEEEEEcCCCeEEeEEEEEEeCCCcEEEEEeCCCCCCcccccceeeeeeCCCCCCCCCCEEEEEEeCCCCCCee
Q 004068 339 VAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGVAGASVVRAAELLPEPALRRGDSVYLVGLSRSLQATS 418 (775)
Q Consensus 339 V~~~~~~I~Vt~~d~~~~~~A~Vv~~dp~~DlAILk~d~~~l~~~~~~~v~~~~lg~s~~l~~Gd~V~aiG~p~g~~~~~ 418 (775)
|+.+++|++|++++ +..++|.+.|+||.+|+|++||||++.- .++|.+.. +++||++.+.|+..+.+..+
T Consensus 571 vp~d~~d~~vt~~d-S~~i~a~~~fL~~t~n~a~~kydp~~~~--------~~kl~~~~-v~~gD~~~f~g~~~~~r~lt 640 (955)
T KOG1421|consen 571 VPSDAKDQRVTEAD-SDGIPANVSFLHPTENVASFKYDPALEV--------QLKLTDTT-VLRGDECTFEGFTEDLRALT 640 (955)
T ss_pred CCchhhceEEeecc-cccccceeeEecCccceeEeccChhHhh--------hhccceee-EecCCceeEecccccchhhc
Confidence 99999999999998 9999999999999999999999998653 27887776 99999999999999999999
Q ss_pred EEEEEeCCccccccCCCCcccccccceEEEEEeeccCCCC-CceEEccCceEEEEeeeecccccccCCCCCCceeeeccc
Q 004068 419 RKSIVTNPCAALNISSADCPRYRAMNMEVIELDTDFGSTF-SGVLTDEHGRVQAIWGSFSTQVKFGCSSSEDHQFVRGIP 497 (775)
Q Consensus 419 ~~g~VS~~~~~~~~~~~~~pryra~n~e~I~~Da~i~~~~-GGpL~d~~G~VvGI~~~~~~~~~~~~~~~~~~~f~~aIP 497 (775)
+++.|+++. .+.++++..||||++|+++|.++++++.+| +|.|.|.||+|+|+|..+.++. .++++..|.+|+.
T Consensus 641 aktsv~dvs-~~~~ps~~~pr~r~~n~e~Is~~~nlsT~c~sg~ltdddg~vvalwl~~~ge~----~~~kd~~y~~gl~ 715 (955)
T KOG1421|consen 641 AKTSVTDVS-VVIIPSSVMPRFRATNLEVISFMDNLSTSCLSGRLTDDDGEVVALWLSVVGED----VGGKDYTYKYGLS 715 (955)
T ss_pred ccceeeeeE-EEEecCCCCcceeecceEEEEEeccccccccceEEECCCCeEEEEEeeeeccc----cCCceeEEEeccc
Confidence 999999875 566778889999999999999999999999 9999999999999999999884 4468888999999
Q ss_pred cchhhhHHHHHHcCCCCCCccccccccCCCcceEEEEEEEEcChhhhhhcCCChhHHhhhhhcCCCccceEEEEEEcCCC
Q 004068 498 IYTISRVLDKIISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDPVRRQVLRVKGCLAGS 577 (775)
Q Consensus 498 i~~i~~vl~~l~~g~~~~~~~~~~v~r~~p~~~~Lgve~~~i~~~~ar~lGls~~wi~~v~~~~~~~~q~l~V~~V~~gS 577 (775)
+.+++++|++|+.|.+ +..+++|++|..++..+||.+|+|.||+-+.+.....++|+++|..|.+..
T Consensus 716 ~~~~l~vl~rlk~g~~-------------~rp~i~~vef~~i~laqar~lglp~e~imk~e~es~~~~ql~~ishv~~~~ 782 (955)
T KOG1421|consen 716 MSYILPVLERLKLGPS-------------ARPTIAGVEFSHITLAQARTLGLPSEFIMKSEEESTIPRQLYVISHVRPLL 782 (955)
T ss_pred hHHHHHHHHHHhcCCC-------------CCceeeccceeeEEeehhhccCCCHHHHhhhhhcCCCcceEEEEEeeccCc
Confidence 9999999999999943 334699999999999999999999999999999999999999999998865
Q ss_pred hHhhhccCCCEEEEECCEEeCChhhHHHHHHhcCCCCCCCCeEEEEEEecCeEEEEEEEecccCCCCcceeeeeeeeeec
Q 004068 578 KAENMLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDITIFRQGREIELQVGTDVRDGNGTTRVINWCGCIVQ 657 (775)
Q Consensus 578 pA~~aLq~GDiILsVNGk~V~s~~dl~~~l~~~~~~~~~g~~v~l~V~R~Gk~~~l~V~l~~~~~~~t~r~v~~~G~~lq 657 (775)
+- -|..||+||++|||.|+.++||.. + ..++++|+|+|.++++++++-... +++|++.|.|+++|
T Consensus 783 ~k--il~~gdiilsvngk~itr~~dl~d-~----------~eid~~ilrdg~~~~ikipt~p~~--et~r~vi~~gailq 847 (955)
T KOG1421|consen 783 HK--ILGVGDIILSVNGKMITRLSDLHD-F----------EEIDAVILRDGIEMEIKIPTYPEY--ETSRAVIWMGAILQ 847 (955)
T ss_pred cc--ccccccEEEEecCeEEeeehhhhh-h----------hhhheeeeecCcEEEEEecccccc--ccceEEEEEecccc
Confidence 43 399999999999999999999996 3 248899999999999999988665 79999999999999
Q ss_pred CChhhHhh-hCCCCCCCCceEEEEEcCCCHHhHcCCCCCCEEEEECCeeCCCHHHHHHHHHhcCCCCEEEEEEEEeCCeE
Q 004068 658 DPHPAVRA-LGFLPEEGHGVYVARWCHGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHLNGKP 736 (775)
Q Consensus 658 ~p~~~vrq-l~~lps~~~gV~Vs~V~~GSPA~~aGL~~GD~I~~VNG~pV~dl~~f~~~v~~i~~g~~V~L~~V~Rdg~~ 736 (775)
.||+++++ ...+|+ ||||+.+..||||.| +|++..||++|||..++++++|..+++++++++||+++.++|||.|
T Consensus 848 ~ph~av~~q~edlp~---gvyvt~rg~gspalq-~l~aa~fitavng~~t~~lddf~~~~~~ipdnsyv~v~~mtfd~vp 923 (955)
T KOG1421|consen 848 PPHSAVFEQVEDLPE---GVYVTSRGYGSPALQ-MLRAAHFITAVNGHDTNTLDDFYHMLLEIPDNSYVQVKQMTFDGVP 923 (955)
T ss_pred CchHHHHHHHhccCC---ceEEeecccCChhHh-hcchheeEEEecccccCcHHHHHHHHhhCCCCceEEEEEeccCCCc
Confidence 99999998 588998 999999999999999 9999999999999999999999999999999999999999999999
Q ss_pred EEEEEEeCCCCCCceeEEecCCCCCcEEEEe
Q 004068 737 RVLTLKQDLHYWPTWELIFDPDTALWRRKSV 767 (775)
Q Consensus 737 ~~ltlk~d~~y~pt~e~~~~~~~~~W~~~~~ 767 (775)
..+++|+|+|||||.+|.+|..+. |+..+.
T Consensus 924 ~~~s~k~n~hyfpt~~l~rd~~~~-wi~kev 953 (955)
T KOG1421|consen 924 SIVSVKPNPHYFPTCILERDSNGR-WITKEV 953 (955)
T ss_pred eEEEeccCCccCceeEEEecccCc-eeeeec
Confidence 999999999999999999998655 976653
|
|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12812 PDZ_1: PDZ-like domain | Back alignment and domain information |
|---|
| >KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C | Back alignment and domain information |
|---|
| >PF12812 PDZ_1: PDZ-like domain | Back alignment and domain information |
|---|
| >PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A | Back alignment and domain information |
|---|
| >PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C | Back alignment and domain information |
|---|
| >cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases | Back alignment and domain information |
|---|
| >cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases | Back alignment and domain information |
|---|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases | Back alignment and domain information |
|---|
| >KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01713 typeII_sec_gspC general secretion pathway protein C | Back alignment and domain information |
|---|
| >KOG3209 consensus WW domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) | Back alignment and domain information |
|---|
| >TIGR01713 typeII_sec_gspC general secretion pathway protein C | Back alignment and domain information |
|---|
| >KOG3209 consensus WW domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases | Back alignment and domain information |
|---|
| >cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts | Back alignment and domain information |
|---|
| >PLN00049 carboxyl-terminal processing protease; Provisional | Back alignment and domain information |
|---|
| >TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase | Back alignment and domain information |
|---|
| >PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] | Back alignment and domain information |
|---|
| >smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 | Back alignment and domain information |
|---|
| >cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
| >TIGR00225 prc C-terminal peptidase (prc) | Back alignment and domain information |
|---|
| >TIGR02860 spore_IV_B stage IV sporulation protein B | Back alignment and domain information |
|---|
| >PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase | Back alignment and domain information |
|---|
| >COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 | Back alignment and domain information |
|---|
| >TIGR02860 spore_IV_B stage IV sporulation protein B | Back alignment and domain information |
|---|
| >KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] | Back alignment and domain information |
|---|
| >TIGR00225 prc C-terminal peptidase (prc) | Back alignment and domain information |
|---|
| >PLN00049 carboxyl-terminal processing protease; Provisional | Back alignment and domain information |
|---|
| >KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
| >PRK11186 carboxy-terminal protease; Provisional | Back alignment and domain information |
|---|
| >KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09681 putative type II secretion protein GspC; Provisional | Back alignment and domain information |
|---|
| >cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
| >KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A | Back alignment and domain information |
|---|
| >PRK09681 putative type II secretion protein GspC; Provisional | Back alignment and domain information |
|---|
| >COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00020 Tryp_SPc Trypsin-like serine protease | Back alignment and domain information |
|---|
| >PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A | Back alignment and domain information |
|---|
| >PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification | Back alignment and domain information |
|---|
| >COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous | Back alignment and domain information |
|---|
| >PRK11186 carboxy-terminal protease; Provisional | Back alignment and domain information |
|---|
| >COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3532 consensus Predicted protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG3571 consensus Dishevelled 3 and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3532 consensus Predicted protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] | Back alignment and domain information |
|---|
| >PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures] | Back alignment and domain information |
|---|
| >COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG0609 consensus Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF11874 DUF3394: Domain of unknown function (DUF3394); InterPro: IPR021814 This domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3551 consensus Syntrophins (type beta) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG2921 consensus Intramembrane metalloprotease (sterol-regulatory element-binding protein (SREBP) protease) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3651 consensus Protein kinase C, alpha binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 | Back alignment and structure |
|---|
Score = 55.7 bits (135), Expect = 3e-08
Identities = 45/250 (18%), Positives = 94/250 (37%), Gaps = 43/250 (17%)
Query: 496 IPIYTISRVLDKIISGASGPSLLINGVKRPMPLVRILEV--ELYPTLLSKARSFGLSDDW 553
IP + ++I +KR + ++ E+ ++ A++F L D
Sbjct: 219 IPSNMARTLAQQLIDFGE--------IKRGLLGIKGTEMSADI-------AKAFNL-DVQ 262
Query: 554 VQALVKKDPVRRQVLRVKGCLAGSKAENM-LEQGDMMLAINKQPVTCFHDIENACQALDK 612
A V +VL GS + ++ GD++ ++N +P+ F ++ + A +
Sbjct: 263 RGAFV------SEVL------PGSGSAKAGVKAGDIITSLNGKPLNSFAELRSRI-ATTE 309
Query: 613 DGEDNGKLDITIFRQGREIELQVGTDVRDGNGTTRVINWCGCIVQDPHPAVRALGFLPEE 672
G K+ + + R G+ +E++V D + + I A + G L +
Sbjct: 310 PGT---KVKLGLLRNGKPLEVEVTLDTSTSSSASA-----EMITPALEGATLSDGQLKDG 361
Query: 673 GHGVYVARWCHGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHL 732
G G+ + GSP + GL I+ +N R + V +++
Sbjct: 362 GKGIKIDEVVKGSPAAQAGLQKDDVIIGVNRDRVNSIAEMRKVLAAKPAIIALQIVR--- 418
Query: 733 NGKPRVLTLK 742
+ L ++
Sbjct: 419 GNESIYLLMR 428
|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 | Back alignment and structure |
|---|
| >2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Length = 134 | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 | Back alignment and structure |
|---|
| >2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348 | Back alignment and structure |
|---|
| >2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 775 | |||
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 100.0 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 100.0 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 100.0 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 100.0 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 100.0 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 100.0 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 100.0 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 100.0 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 100.0 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 100.0 | |
| 1l1j_A | 239 | Heat shock protease HTRA; hydrolase, serine protei | 99.92 | |
| 3lgi_A | 237 | Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro | 99.92 | |
| 3sti_A | 245 | Protease DEGQ; serine protease, PDZ domain, chaper | 99.92 | |
| 3tjo_A | 231 | Serine protease HTRA1; peptidase, hydrolase; HET: | 99.91 | |
| 3k6y_A | 237 | Serine protease, possible membrane-associated seri | 99.86 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 99.8 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 99.73 | |
| 2w5e_A | 163 | Putative serine protease; coiled coil, transmembra | 99.68 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 99.68 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 99.66 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 99.63 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 99.62 | |
| 2l97_A | 134 | HTRA, putative serine protease; HTRA-PDZ, protein | 99.59 | |
| 2as9_A | 210 | Serine protease; trypsin-like fold, hydrolase; 1.7 | 99.52 | |
| 2h5c_A | 198 | Alpha-lytic protease; serine protease, acylation t | 99.46 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 99.35 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 99.32 | |
| 2w7s_A | 200 | Serine protease SPLA; hydrolase, family S1; 1.80A | 99.31 | |
| 1agj_A | 242 | Epidermolytic toxin A; hydrolase, serine protease; | 99.31 | |
| 2oua_A | 188 | Serine protease, protein NAPA; kinetic stability, | 99.31 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 99.28 | |
| 1hpg_A | 187 | Glutamic acid specific protease; serine protease, | 99.26 | |
| 2o8l_A | 274 | V8 protease, taphylococcal serine; serine protease | 99.24 | |
| 1uf1_A | 128 | KIAA1526 protein; PDZ domain, structural genomics, | 99.24 | |
| 2pzd_A | 113 | Serine protease HTRA2; PDZ domain, apoptosis, mito | 99.22 | |
| 1qtf_A | 246 | Exfoliative toxin B; serine protease, superantigen | 99.19 | |
| 2vid_A | 204 | Serine protease SPLB; hydrolase; 1.80A {Staphyloco | 99.17 | |
| 1wcz_A | 268 | Glutamyl endopeptidase; virulence factor, hydrolas | 99.15 | |
| 2l97_A | 134 | HTRA, putative serine protease; HTRA-PDZ, protein | 99.15 | |
| 2ea3_A | 189 | Chymotrypsin; celloulomonas, protease, hydrolase; | 99.15 | |
| 2pfe_A | 186 | Protease A, alkaline serine protease, TFPA; beta-b | 99.09 | |
| 2i6v_A | 87 | General secretion pathway protein C; EPSC, GSPC, P | 99.06 | |
| 2pzd_A | 113 | Serine protease HTRA2; PDZ domain, apoptosis, mito | 99.06 | |
| 3i18_A | 100 | LMO2051 protein; alpha-beta protein, structural ge | 99.05 | |
| 2p3w_A | 112 | Probable serine protease HTRA3; PDZ domain, phage | 99.05 | |
| 2p3w_A | 112 | Probable serine protease HTRA3; PDZ domain, phage | 99.02 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 99.01 | |
| 2qa9_E | 185 | Streptogrisin-B; chymotrypsin-type serine peptidas | 99.0 | |
| 2kjp_A | 91 | Uncharacterized protein YLBL; mixed alpha-beta pro | 98.98 | |
| 2kl1_A | 94 | YLBL protein; structure genomics, structural genom | 98.97 | |
| 2i4s_A | 105 | General secretion pathway protein C; EPSC, GSPC, P | 98.96 | |
| 3id1_A | 95 | Regulator of sigma E protease; hydrolase, cell inn | 98.94 | |
| 3id1_A | 95 | Regulator of sigma E protease; hydrolase, cell inn | 98.94 | |
| 3i18_A | 100 | LMO2051 protein; alpha-beta protein, structural ge | 98.92 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 98.9 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 98.9 | |
| 2vz5_A | 139 | TAX1-binding protein 3; WNT signaling pathway, pro | 98.89 | |
| 2zpm_A | 91 | Regulator of sigma E protease; metalloproteinase, | 98.89 | |
| 2eaq_A | 90 | LIM domain only protein 7; conserved hypothetical | 98.86 | |
| 3cyy_A | 92 | Tight junction protein ZO-1; protein-ligand comple | 98.84 | |
| 2kl1_A | 94 | YLBL protein; structure genomics, structural genom | 98.83 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 98.83 | |
| 1qau_A | 112 | Neuronal nitric oxide synthase (residues 1-130); b | 98.83 | |
| 2pkt_A | 91 | PDZ and LIM domain protein 1; PDZ domain, structur | 98.8 | |
| 1mbm_A | 198 | NSP4 proteinase, chymotrypsin-like serine protease | 98.8 | |
| 2i6v_A | 87 | General secretion pathway protein C; EPSC, GSPC, P | 98.8 | |
| 2kjp_A | 91 | Uncharacterized protein YLBL; mixed alpha-beta pro | 98.78 | |
| 2pa1_A | 87 | PDZ and LIM domain protein 2; PDZ domain, structur | 98.76 | |
| 2vsp_A | 91 | PDZ domain-containing protein 1; membrane, cytopla | 98.76 | |
| 2v90_A | 96 | PDZ domain-containing protein 3; membrane, protein | 98.75 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 98.75 | |
| 2w4f_A | 97 | Protein LAP4; structural protein, phosphoprotein, | 98.74 | |
| 1wh1_A | 124 | KIAA1095 protein; PDZ domain, structural genomics, | 98.74 | |
| 2jil_A | 97 | GRIP1 protein, glutamate receptor interacting prot | 98.74 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 98.72 | |
| 2sga_A | 181 | Proteinase A; hydrolase (serine proteinase); 1.50A | 98.72 | |
| 2zpm_A | 91 | Regulator of sigma E protease; metalloproteinase, | 98.71 | |
| 3qik_A | 101 | Phosphatidylinositol 3,4,5-trisphosphate-dependen | 98.71 | |
| 2dls_A | 93 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 98.7 | |
| 3tsv_A | 124 | Tight junction protein ZO-1; PDZ, scaffolding, JAM | 98.7 | |
| 2koj_A | 111 | Partitioning defective 3 homolog; PDZ domain, stru | 98.69 | |
| 2uzc_A | 88 | Human pdlim5, PDZ and LIM domain 5; metal-binding, | 98.69 | |
| 2i4s_A | 105 | General secretion pathway protein C; EPSC, GSPC, P | 98.69 | |
| 2jxo_A | 98 | Ezrin-radixin-moesin-binding phosphoprotein 50; nh | 98.69 | |
| 1ihj_A | 98 | INAD; intermolecular disulfide bond, PDZ domain, s | 98.69 | |
| 2hga_A | 125 | Conserved protein MTH1368; GFT structural genomics | 98.68 | |
| 2kom_A | 121 | Partitioning defective 3 homolog; PAR-3B, PDZ doma | 98.68 | |
| 2eeh_A | 100 | PDZ domain-containing protein 7; structural genomi | 98.67 | |
| 2i04_A | 85 | Membrane-associated guanylate kinase, WW and PDZ d | 98.67 | |
| 3sfj_A | 104 | TAX1-binding protein 3; PDZ:peptide complex, signa | 98.67 | |
| 2fcf_A | 103 | Multiple PDZ domain protein; adaptor molecule, pro | 98.66 | |
| 2he4_A | 90 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p | 98.66 | |
| 3khf_A | 99 | Microtubule-associated serine/threonine-protein ki | 98.66 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 98.65 | |
| 1rgw_A | 85 | ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, | 98.65 | |
| 2awx_A | 105 | Synapse associated protein 97; membrane protein, s | 98.64 | |
| 1x5q_A | 110 | LAP4 protein; PDZ domain, scribble homolog protein | 98.64 | |
| 1wf7_A | 103 | Enigma homologue protein; PDZ domain, structural g | 98.64 | |
| 2q3g_A | 89 | PDZ and LIM domain protein 7; structural genomics, | 98.63 | |
| 1v5q_A | 122 | GRIP1 homolog, glutamate receptor interacting prot | 98.63 | |
| 2vsv_A | 109 | Rhophilin-2; scaffold protein, RHO GTPase binding, | 98.62 | |
| 2f5y_A | 91 | Regulator of G-protein signalling 3 isoform 1; PDZ | 98.62 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 98.62 | |
| 2rcz_A | 81 | Tight junction protein ZO-1; PDZ, domain-swapping, | 98.61 | |
| 1vb7_A | 94 | PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, | 98.61 | |
| 3r68_A | 95 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P | 98.61 | |
| 3bpu_A | 88 | Membrane-associated guanylate kinase, WW and PDZ c | 98.61 | |
| 4amh_A | 106 | Disks large homolog 1; permutation, protein foldin | 98.6 | |
| 1d5g_A | 96 | Human phosphatase HPTP1E; protein-peptide complex, | 98.6 | |
| 2opg_A | 98 | Multiple PDZ domain protein; structural protein, s | 98.6 | |
| 2iwq_A | 123 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 98.6 | |
| 3fan_A | 213 | Non-structural protein; chymotrypsin-like, N-termi | 98.6 | |
| 2q9v_A | 90 | Membrane-associated guanylate kinase, WW and PDZ c | 98.6 | |
| 1uit_A | 117 | Human discs large 5 protein; PDZ domain, HDLG5, ma | 98.59 | |
| 2o2t_A | 117 | Multiple PDZ domain protein; structural protein, s | 98.59 | |
| 1ueq_A | 123 | Membrane associated guanylate kinase inverted-2 (M | 98.59 | |
| 2fne_A | 117 | Multiple PDZ domain protein; structural protein, s | 98.59 | |
| 1g9o_A | 91 | NHE-RF; PDZ domain, complex, signaling protein; 1. | 98.59 | |
| 3cbz_A | 108 | Dishevelled-2; PDZ domain, phage derived high affi | 98.58 | |
| 2yub_A | 118 | LIMK-2, LIM domain kinase 2; PDZ domain, structura | 98.58 | |
| 1kwa_A | 88 | Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca | 98.58 | |
| 1uez_A | 101 | KIAA1526 protein; PDZ domain, structural genomics, | 98.58 | |
| 3cyy_A | 92 | Tight junction protein ZO-1; protein-ligand comple | 98.58 | |
| 1wi2_A | 104 | Riken cDNA 2700099C19; structural genomics, riken | 98.58 | |
| 2d90_A | 102 | PDZ domain containing protein 1; structural genomi | 98.57 | |
| 2jre_A | 108 | C60-1 PDZ domain peptide; de novo protein; NMR {Sy | 98.57 | |
| 2i1n_A | 102 | Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig | 98.57 | |
| 2ejy_A | 97 | 55 kDa erythrocyte membrane protein; GPC, maguk, P | 98.57 | |
| 1n7e_A | 97 | AMPA receptor interacting protein GRIP; PDZ, prote | 98.55 | |
| 1v5l_A | 103 | PDZ and LIM domain 3; actinin alpha 2 associated L | 98.55 | |
| 1b8q_A | 127 | Protein (neuronal nitric oxide synthase); PDZ doma | 98.55 | |
| 2kjd_A | 128 | Sodium/hydrogen exchange regulatory cofactor NHE- | 98.55 | |
| 1uep_A | 103 | Membrane associated guanylate kinase inverted-2 (M | 98.55 | |
| 2fe5_A | 94 | Presynaptic protein SAP102; PDZ domain, DLG3, huma | 98.55 | |
| 2vwr_A | 95 | Ligand of NUMB protein X 2; protein-binding, metal | 98.55 | |
| 1m5z_A | 91 | GRIP, AMPA receptor interacting protein; six beta- | 98.55 | |
| 1q3o_A | 109 | Shank1; PDZ, GKAP, peptide binding protein; 1.80A | 98.54 | |
| 2eeg_A | 94 | PDZ and LIM domain protein 4; PDZ domain, structur | 98.53 | |
| 3ngh_A | 106 | PDZ domain-containing protein 1; adaptor protein, | 98.53 | |
| 1um1_A | 110 | KIAA1849 protein, RSGI RUH-007; PDZ domain, human | 98.53 | |
| 2h2b_A | 107 | Tight junction protein ZO-1; PDZ domain, phage der | 98.53 | |
| 4fgm_A | 597 | Aminopeptidase N family protein; structural genomi | 98.53 | |
| 1wfg_A | 131 | Regulating synaptic membrane exocytosis protein 2; | 98.53 | |
| 2byg_A | 117 | Channel associated protein of synapse-110; DLG2, P | 98.53 | |
| 3e17_A | 88 | Tight junction protein ZO-2; domain swapping, alte | 98.52 | |
| 2g5m_B | 113 | Neurabin-2; spinophilin, PDZ domain, CNS, synaptic | 98.52 | |
| 2jik_A | 101 | Synaptojanin-2 binding protein; transmembrane, out | 98.52 | |
| 2pkt_A | 91 | PDZ and LIM domain protein 1; PDZ domain, structur | 98.52 | |
| 2djt_A | 104 | Unnamed protein product; PDZ domain, structural ge | 98.52 | |
| 2eaq_A | 90 | LIM domain only protein 7; conserved hypothetical | 98.51 | |
| 2yt7_A | 101 | Amyloid beta A4 precursor protein-binding family A | 98.51 | |
| 1wif_A | 126 | RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s | 98.51 | |
| 1x5n_A | 114 | Harmonin; PDZ domain, usher syndrome 1C protein, a | 98.51 | |
| 2ego_A | 96 | General receptor for phosphoinositides 1- associat | 98.51 | |
| 1wi4_A | 109 | Synip, syntaxin binding protein 4; syntaxin4-inter | 98.5 | |
| 2dmz_A | 129 | INAD-like protein; PDZ domain, inadl protein, hina | 98.5 | |
| 2kpk_A | 129 | Membrane-associated guanylate kinase, WW and PDZ c | 98.5 | |
| 1va8_A | 113 | Maguk P55 subfamily member 5; PDZ domain, palmitoy | 98.5 | |
| 2rcz_A | 81 | Tight junction protein ZO-1; PDZ, domain-swapping, | 98.5 | |
| 2edz_A | 114 | PDZ domain-containing protein 1; CFTR-associated p | 98.5 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 98.49 | |
| 2vz5_A | 139 | TAX1-binding protein 3; WNT signaling pathway, pro | 98.49 | |
| 1q7x_A | 108 | PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str | 98.49 | |
| 2la8_A | 106 | Inactivation-NO-after-potential D protein, KON-TI | 98.49 | |
| 3qe1_A | 107 | Sorting nexin-27, G protein-activated inward RECT | 98.48 | |
| 2iwo_A | 120 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 98.48 | |
| 2qg1_A | 92 | Multiple PDZ domain protein; MPDZ, MUPP1, structur | 98.48 | |
| 2hga_A | 125 | Conserved protein MTH1368; GFT structural genomics | 98.47 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 98.47 | |
| 1whd_A | 100 | RGS3, regulator of G-protein signaling 3; PDZ doma | 98.47 | |
| 1x6d_A | 119 | Interleukin-16; PDZ domain, lymphocyte chemoattrac | 98.46 | |
| 2e7k_A | 91 | Maguk P55 subfamily member 2; PDZ domain, MPP2 pro | 98.46 | |
| 1wha_A | 105 | KIAA0147 protein, scribble; PDZ domain, cellular s | 98.46 | |
| 3axa_A | 106 | Afadin, nectin-3, protein AF-6; PDZ domain, fusion | 98.45 | |
| 2w4f_A | 97 | Protein LAP4; structural protein, phosphoprotein, | 98.45 | |
| 2r4h_A | 112 | Membrane-associated guanylate kinase, WW and PDZ c | 98.45 | |
| 2kv8_A | 83 | RGS12, regulator of G-protein signaling 12; PDZ do | 98.45 | |
| 1v62_A | 117 | KIAA1719 protein; structural genomics, synaptic tr | 98.45 | |
| 1nf3_C | 128 | PAR-6B; semi-CRIB motif, switch I and II, PDZ doma | 98.45 | |
| 1y7n_A | 90 | Amyloid beta A4 precursor protein-binding family A | 98.45 | |
| 1ujd_A | 117 | KIAA0559 protein; PDZ domain, structural genomics, | 98.45 | |
| 1uew_A | 114 | Membrane associated guanylate kinase inverted-2 (M | 98.44 | |
| 3o46_A | 93 | Maguk P55 subfamily member 7; PDZ domain, structur | 98.43 | |
| 2iwn_A | 97 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 98.42 | |
| 3hpk_A | 125 | Protein interacting with PRKCA 1; oxidized, PDZ do | 98.42 | |
| 1uit_A | 117 | Human discs large 5 protein; PDZ domain, HDLG5, ma | 98.42 | |
| 2dm8_A | 116 | INAD-like protein; PDZ domain, inadl protein, hina | 98.41 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 98.41 | |
| 2z17_A | 104 | Pleckstrin homology SEC7 and coiled-coil domains- | 98.41 | |
| 2dkr_A | 93 | LIN-7 homolog B; LIN-7B, PDZ, structural genomics, | 98.41 | |
| 2dlu_A | 111 | INAD-like protein; PDZ domain, inadl protein, hina | 98.4 | |
| 1qau_A | 112 | Neuronal nitric oxide synthase (residues 1-130); b | 98.4 | |
| 2db5_A | 128 | INAD-like protein; PDZ domain, hinadl, PALS1- asso | 98.39 | |
| 3b76_A | 118 | E3 ubiquitin-protein ligase LNX; PDZ, bound ligand | 98.39 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 98.39 | |
| 1x5q_A | 110 | LAP4 protein; PDZ domain, scribble homolog protein | 98.39 | |
| 1wg6_A | 127 | Hypothetical protein (riken cDNA 2810455B10); stru | 98.39 | |
| 3i4w_A | 104 | Disks large homolog 4; alpha and beta protein, alt | 98.39 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 98.39 | |
| 2edp_A | 100 | Fragment, shroom family member 4; APX/shroom famil | 98.39 | |
| 2yuy_A | 126 | RHO GTPase activating protein 21; PDZ domain, stru | 98.38 | |
| 3l4f_D | 132 | SH3 and multiple ankyrin repeat domains protein 1; | 98.38 | |
| 1wf8_A | 107 | Neurabin-I; PDZ domain, structural genomics, NPPSF | 98.37 | |
| 2pa1_A | 87 | PDZ and LIM domain protein 2; PDZ domain, structur | 98.37 | |
| 1mfg_A | 95 | ERB-B2 interacting protein; PDZ domain, protein-pe | 98.37 | |
| 2eno_A | 120 | Synaptojanin-2-binding protein; mitochondrial oute | 98.37 | |
| 4e34_A | 87 | Golgi-associated PDZ and coiled-coil motif-contai | 98.36 | |
| 1vae_A | 111 | Rhophilin 2, rhophilin, RHO GTPase binding protein | 98.36 | |
| 2fcf_A | 103 | Multiple PDZ domain protein; adaptor molecule, pro | 98.36 | |
| 2d92_A | 108 | INAD-like protein; PDZ domain, inadl protein, hina | 98.36 | |
| 1wfv_A | 103 | Membrane associated guanylate kinase inverted-2; a | 98.36 | |
| 3kzd_A | 94 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 98.36 | |
| 3k1r_A | 192 | Harmonin; protein-protein complex, alternative spl | 98.36 | |
| 2qkv_A | 96 | Inactivation-NO-after-potential D protein; PDZ dom | 98.35 | |
| 1ujv_A | 96 | Membrane associated guanylate kinase inverted-2 (M | 98.35 | |
| 1qav_A | 90 | Alpha-1 syntrophin (residues 77-171); beta-finger, | 98.35 | |
| 3nfk_A | 107 | Tyrosine-protein phosphatase non-receptor type 4; | 98.35 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 98.34 | |
| 2jil_A | 97 | GRIP1 protein, glutamate receptor interacting prot | 98.34 | |
| 2daz_A | 124 | INAD-like protein; PDZ domain, inadl protein, hina | 98.34 | |
| 2gzv_A | 114 | PRKCA-binding protein; protein kinase C, PDZ domai | 98.34 | |
| 1uhp_A | 107 | Hypothetical protein KIAA1095; PDZ domain, semapho | 98.34 | |
| 2v90_A | 96 | PDZ domain-containing protein 3; membrane, protein | 98.34 | |
| 1tp5_A | 119 | Presynaptic density protein 95; PDZ-peptide ligand | 98.32 | |
| 1ihj_A | 98 | INAD; intermolecular disulfide bond, PDZ domain, s | 98.31 | |
| 1r6j_A | 82 | Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap | 98.3 | |
| 2eeh_A | 100 | PDZ domain-containing protein 7; structural genomi | 98.3 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 98.3 | |
| 1fc6_A | 388 | Photosystem II D1 protease; D1 C-terminal processi | 98.3 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 98.29 | |
| 1v6b_A | 118 | Harmonin isoform A1; structural genomics, usher sy | 98.29 | |
| 2uzc_A | 88 | Human pdlim5, PDZ and LIM domain 5; metal-binding, | 98.28 | |
| 1uju_A | 111 | Scribble; PDZ domain, cellular signaling, structur | 98.28 | |
| 2jxo_A | 98 | Ezrin-radixin-moesin-binding phosphoprotein 50; nh | 98.28 | |
| 1uf1_A | 128 | KIAA1526 protein; PDZ domain, structural genomics, | 98.28 | |
| 2ehr_A | 117 | INAD-like protein; PDZ domain, inadl protein, hina | 98.27 | |
| 2h2b_A | 107 | Tight junction protein ZO-1; PDZ domain, phage der | 98.27 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 98.27 | |
| 2eei_A | 106 | PDZ domain-containing protein 1; regulatory factor | 98.26 | |
| 2dc2_A | 103 | GOPC, golgi associated PDZ and coiled-coil motif c | 98.25 | |
| 1vb7_A | 94 | PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, | 98.25 | |
| 1wf7_A | 103 | Enigma homologue protein; PDZ domain, structural g | 98.25 | |
| 1wh1_A | 124 | KIAA1095 protein; PDZ domain, structural genomics, | 98.25 | |
| 1kwa_A | 88 | Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca | 98.24 | |
| 3khf_A | 99 | Microtubule-associated serine/threonine-protein ki | 98.24 | |
| 3tsv_A | 124 | Tight junction protein ZO-1; PDZ, scaffolding, JAM | 98.23 | |
| 1i16_A | 130 | Interleukin 16, LCF; cytokine, lymphocyte chemoatt | 98.23 | |
| 3egg_C | 170 | Spinophilin; PP1, serine/threonine phosphatase, po | 98.23 | |
| 2iwq_A | 123 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 98.23 | |
| 2dls_A | 93 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 98.23 | |
| 3sfj_A | 104 | TAX1-binding protein 3; PDZ:peptide complex, signa | 98.22 | |
| 1rgw_A | 85 | ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, | 98.22 | |
| 2vsp_A | 91 | PDZ domain-containing protein 1; membrane, cytopla | 98.22 | |
| 2awx_A | 105 | Synapse associated protein 97; membrane protein, s | 98.22 | |
| 2krg_A | 216 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a | 98.22 | |
| 1n7t_A | 103 | 99-MER peptide of densin-180-like protein; PDZ dom | 98.22 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 98.22 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 98.21 | |
| 2q3g_A | 89 | PDZ and LIM domain protein 7; structural genomics, | 98.21 | |
| 2cs5_A | 119 | Tyrosine-protein phosphatase, non-receptor type 4; | 98.21 | |
| 1uez_A | 101 | KIAA1526 protein; PDZ domain, structural genomics, | 98.2 | |
| 2edv_A | 96 | FERM and PDZ domain-containing protein 1; cytoskel | 98.2 | |
| 2d8i_A | 114 | T-cell lymphoma invasion and metastasis 1 variant; | 98.2 | |
| 1ufx_A | 103 | KIAA1526 protein; PDZ domain, structural genomics, | 98.19 | |
| 1m5z_A | 91 | GRIP, AMPA receptor interacting protein; six beta- | 98.19 | |
| 2he4_A | 90 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p | 98.18 | |
| 3bpu_A | 88 | Membrane-associated guanylate kinase, WW and PDZ c | 98.18 | |
| 2csj_A | 117 | TJP2 protein; PDZ domain, structural genomics, NPP | 98.17 | |
| 4amh_A | 106 | Disks large homolog 1; permutation, protein foldin | 98.17 | |
| 2eeg_A | 94 | PDZ and LIM domain protein 4; PDZ domain, structur | 98.16 | |
| 2kom_A | 121 | Partitioning defective 3 homolog; PAR-3B, PDZ doma | 98.16 | |
| 2koj_A | 111 | Partitioning defective 3 homolog; PDZ domain, stru | 98.15 | |
| 1nf3_C | 128 | PAR-6B; semi-CRIB motif, switch I and II, PDZ doma | 98.15 | |
| 2fne_A | 117 | Multiple PDZ domain protein; structural protein, s | 98.14 | |
| 2yub_A | 118 | LIMK-2, LIM domain kinase 2; PDZ domain, structura | 98.13 | |
| 1b8q_A | 127 | Protein (neuronal nitric oxide synthase); PDZ doma | 98.13 | |
| 3soe_A | 113 | Membrane-associated guanylate kinase, WW and PDZ c | 98.13 | |
| 1um7_A | 113 | Synapse-associated protein 102; PDZ, discs large h | 98.13 | |
| 2opg_A | 98 | Multiple PDZ domain protein; structural protein, s | 98.13 | |
| 2o2t_A | 117 | Multiple PDZ domain protein; structural protein, s | 98.13 | |
| 2vwr_A | 95 | Ligand of NUMB protein X 2; protein-binding, metal | 98.13 | |
| 2f5y_A | 91 | Regulator of G-protein signalling 3 isoform 1; PDZ | 98.12 | |
| 2i04_A | 85 | Membrane-associated guanylate kinase, WW and PDZ d | 98.12 | |
| 2fe5_A | 94 | Presynaptic protein SAP102; PDZ domain, DLG3, huma | 98.11 | |
| 3gge_A | 95 | PDZ domain-containing protein GIPC2; structural ge | 98.1 | |
| 1um1_A | 110 | KIAA1849 protein, RSGI RUH-007; PDZ domain, human | 98.1 | |
| 2jre_A | 108 | C60-1 PDZ domain peptide; de novo protein; NMR {Sy | 98.1 | |
| 2iwo_A | 120 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 98.1 | |
| 1v5q_A | 122 | GRIP1 homolog, glutamate receptor interacting prot | 98.09 | |
| 3cbz_A | 108 | Dishevelled-2; PDZ domain, phage derived high affi | 98.09 | |
| 1v5l_A | 103 | PDZ and LIM domain 3; actinin alpha 2 associated L | 98.09 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 98.08 | |
| 2vsv_A | 109 | Rhophilin-2; scaffold protein, RHO GTPase binding, | 98.08 | |
| 4fgm_A | 597 | Aminopeptidase N family protein; structural genomi | 98.08 | |
| 1zyo_A | 191 | Serine protease; beta-barrel, glutamyl endopeptida | 98.08 | |
| 2yt7_A | 101 | Amyloid beta A4 precursor protein-binding family A | 98.07 | |
| 3ngh_A | 106 | PDZ domain-containing protein 1; adaptor protein, | 98.06 | |
| 1va8_A | 113 | Maguk P55 subfamily member 5; PDZ domain, palmitoy | 98.06 | |
| 3axa_A | 106 | Afadin, nectin-3, protein AF-6; PDZ domain, fusion | 98.06 | |
| 2g5m_B | 113 | Neurabin-2; spinophilin, PDZ domain, CNS, synaptic | 98.06 | |
| 1g9o_A | 91 | NHE-RF; PDZ domain, complex, signaling protein; 1. | 98.05 | |
| 2ego_A | 96 | General receptor for phosphoinositides 1- associat | 98.05 | |
| 2jik_A | 101 | Synaptojanin-2 binding protein; transmembrane, out | 98.04 | |
| 1n7e_A | 97 | AMPA receptor interacting protein GRIP; PDZ, prote | 98.04 | |
| 3r68_A | 95 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P | 98.04 | |
| 1mfg_A | 95 | ERB-B2 interacting protein; PDZ domain, protein-pe | 98.04 | |
| 1d5g_A | 96 | Human phosphatase HPTP1E; protein-peptide complex, | 98.04 | |
| 2i1n_A | 102 | Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig | 98.03 | |
| 3qe1_A | 107 | Sorting nexin-27, G protein-activated inward RECT | 98.03 | |
| 1wi2_A | 104 | Riken cDNA 2700099C19; structural genomics, riken | 98.03 | |
| 2r4h_A | 112 | Membrane-associated guanylate kinase, WW and PDZ c | 98.01 | |
| 1ueq_A | 123 | Membrane associated guanylate kinase inverted-2 (M | 98.01 | |
| 2q9v_A | 90 | Membrane-associated guanylate kinase, WW and PDZ c | 98.01 | |
| 3kzd_A | 94 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 98.0 | |
| 2djt_A | 104 | Unnamed protein product; PDZ domain, structural ge | 98.0 | |
| 1wfg_A | 131 | Regulating synaptic membrane exocytosis protein 2; | 98.0 | |
| 1uep_A | 103 | Membrane associated guanylate kinase inverted-2 (M | 97.99 | |
| 2byg_A | 117 | Channel associated protein of synapse-110; DLG2, P | 97.99 | |
| 2kjd_A | 128 | Sodium/hydrogen exchange regulatory cofactor NHE- | 97.99 | |
| 2dmz_A | 129 | INAD-like protein; PDZ domain, inadl protein, hina | 97.98 | |
| 3qik_A | 101 | Phosphatidylinositol 3,4,5-trisphosphate-dependen | 97.98 | |
| 2ejy_A | 97 | 55 kDa erythrocyte membrane protein; GPC, maguk, P | 97.97 | |
| 2qkv_A | 96 | Inactivation-NO-after-potential D protein; PDZ dom | 97.97 | |
| 2edz_A | 114 | PDZ domain-containing protein 1; CFTR-associated p | 97.96 | |
| 3i4w_A | 104 | Disks large homolog 4; alpha and beta protein, alt | 97.96 | |
| 1q3o_A | 109 | Shank1; PDZ, GKAP, peptide binding protein; 1.80A | 97.95 | |
| 1wf8_A | 107 | Neurabin-I; PDZ domain, structural genomics, NPPSF | 97.95 | |
| 2kpk_A | 129 | Membrane-associated guanylate kinase, WW and PDZ c | 97.95 | |
| 3o46_A | 93 | Maguk P55 subfamily member 7; PDZ domain, structur | 97.94 | |
| 1uew_A | 114 | Membrane associated guanylate kinase inverted-2 (M | 97.94 | |
| 1y7n_A | 90 | Amyloid beta A4 precursor protein-binding family A | 97.94 | |
| 1q7x_A | 108 | PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str | 97.94 | |
| 2d90_A | 102 | PDZ domain containing protein 1; structural genomi | 97.94 | |
| 1v62_A | 117 | KIAA1719 protein; structural genomics, synaptic tr | 97.93 | |
| 2iwn_A | 97 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 97.93 | |
| 2kv8_A | 83 | RGS12, regulator of G-protein signaling 12; PDZ do | 97.93 | |
| 1ujd_A | 117 | KIAA0559 protein; PDZ domain, structural genomics, | 97.93 | |
| 1x5n_A | 114 | Harmonin; PDZ domain, usher syndrome 1C protein, a | 97.93 | |
| 2e7k_A | 91 | Maguk P55 subfamily member 2; PDZ domain, MPP2 pro | 97.93 | |
| 1whd_A | 100 | RGS3, regulator of G-protein signaling 3; PDZ doma | 97.92 | |
| 2lob_A | 112 | Golgi-associated PDZ and coiled-coil motif-contai | 97.16 | |
| 2qg1_A | 92 | Multiple PDZ domain protein; MPDZ, MUPP1, structur | 97.92 | |
| 1vae_A | 111 | Rhophilin 2, rhophilin, RHO GTPase binding protein | 97.91 | |
| 1tp5_A | 119 | Presynaptic density protein 95; PDZ-peptide ligand | 97.91 | |
| 3mmg_A | 241 | Nuclear inclusion protein A; 3C-type protease, TEV | 97.9 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 97.9 | |
| 1x6d_A | 119 | Interleukin-16; PDZ domain, lymphocyte chemoattrac | 97.9 | |
| 2d8i_A | 114 | T-cell lymphoma invasion and metastasis 1 variant; | 97.89 | |
| 1wif_A | 126 | RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s | 97.88 | |
| 2la8_A | 106 | Inactivation-NO-after-potential D protein, KON-TI | 97.88 | |
| 1qav_A | 90 | Alpha-1 syntrophin (residues 77-171); beta-finger, | 97.88 | |
| 2edp_A | 100 | Fragment, shroom family member 4; APX/shroom famil | 97.87 | |
| 2dm8_A | 116 | INAD-like protein; PDZ domain, inadl protein, hina | 97.85 | |
| 2dkr_A | 93 | LIN-7 homolog B; LIN-7B, PDZ, structural genomics, | 97.84 | |
| 2csj_A | 117 | TJP2 protein; PDZ domain, structural genomics, NPP | 97.84 | |
| 1ujv_A | 96 | Membrane associated guanylate kinase inverted-2 (M | 97.84 | |
| 1wfv_A | 103 | Membrane associated guanylate kinase inverted-2; a | 97.84 | |
| 1n7t_A | 103 | 99-MER peptide of densin-180-like protein; PDZ dom | 97.82 | |
| 2eno_A | 120 | Synaptojanin-2-binding protein; mitochondrial oute | 97.82 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 97.82 | |
| 3b76_A | 118 | E3 ubiquitin-protein ligase LNX; PDZ, bound ligand | 97.82 | |
| 2d92_A | 108 | INAD-like protein; PDZ domain, inadl protein, hina | 97.81 | |
| 2daz_A | 124 | INAD-like protein; PDZ domain, inadl protein, hina | 97.81 | |
| 3e17_A | 88 | Tight junction protein ZO-2; domain swapping, alte | 97.81 | |
| 3k50_A | 403 | Putative S41 protease; structural genomics, joint | 97.8 | |
| 2db5_A | 128 | INAD-like protein; PDZ domain, hinadl, PALS1- asso | 97.8 | |
| 2yuy_A | 126 | RHO GTPase activating protein 21; PDZ domain, stru | 97.79 | |
| 3k1r_A | 192 | Harmonin; protein-protein complex, alternative spl | 97.79 | |
| 1wi4_A | 109 | Synip, syntaxin binding protein 4; syntaxin4-inter | 97.79 | |
| 4e34_A | 87 | Golgi-associated PDZ and coiled-coil motif-contai | 97.79 | |
| 1wg6_A | 127 | Hypothetical protein (riken cDNA 2810455B10); stru | 97.78 | |
| 1uhp_A | 107 | Hypothetical protein KIAA1095; PDZ domain, semapho | 97.78 | |
| 1wha_A | 105 | KIAA0147 protein, scribble; PDZ domain, cellular s | 97.78 | |
| 2dlu_A | 111 | INAD-like protein; PDZ domain, inadl protein, hina | 97.78 | |
| 3nfk_A | 107 | Tyrosine-protein phosphatase non-receptor type 4; | 97.77 | |
| 2gzv_A | 114 | PRKCA-binding protein; protein kinase C, PDZ domai | 97.74 | |
| 2edv_A | 96 | FERM and PDZ domain-containing protein 1; cytoskel | 97.74 | |
| 2dc2_A | 103 | GOPC, golgi associated PDZ and coiled-coil motif c | 97.74 | |
| 3l4f_D | 132 | SH3 and multiple ankyrin repeat domains protein 1; | 97.73 | |
| 2z17_A | 104 | Pleckstrin homology SEC7 and coiled-coil domains- | 97.69 | |
| 2eei_A | 106 | PDZ domain-containing protein 1; regulatory factor | 97.68 | |
| 1v6b_A | 118 | Harmonin isoform A1; structural genomics, usher sy | 97.66 | |
| 1fc6_A | 388 | Photosystem II D1 protease; D1 C-terminal processi | 97.66 | |
| 3hpk_A | 125 | Protein interacting with PRKCA 1; oxidized, PDZ do | 97.65 | |
| 2ehr_A | 117 | INAD-like protein; PDZ domain, inadl protein, hina | 97.63 | |
| 1ufx_A | 103 | KIAA1526 protein; PDZ domain, structural genomics, | 97.63 | |
| 1uju_A | 111 | Scribble; PDZ domain, cellular signaling, structur | 97.62 | |
| 3egg_C | 170 | Spinophilin; PP1, serine/threonine phosphatase, po | 97.59 | |
| 1p3c_A | 215 | Glutamyl-endopeptidase; serine protease, hydrolase | 97.57 | |
| 1i16_A | 130 | Interleukin 16, LCF; cytokine, lymphocyte chemoatt | 97.56 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 97.5 | |
| 3soe_A | 113 | Membrane-associated guanylate kinase, WW and PDZ c | 97.49 | |
| 1pq7_A | 224 | Trypsin; ultra-high resolution, catalysis, hydrola | 97.49 | |
| 1um7_A | 113 | Synapse-associated protein 102; PDZ, discs large h | 97.49 | |
| 2cs5_A | 119 | Tyrosine-protein phosphatase, non-receptor type 4; | 97.48 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 97.42 | |
| 2lob_A | 112 | Golgi-associated PDZ and coiled-coil motif-contai | 96.5 | |
| 1gvz_A | 237 | Kallikrein-1E2; antigen, prostate specific antigen | 97.37 | |
| 1r6j_A | 82 | Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap | 97.36 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 97.33 | |
| 2krg_A | 216 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a | 97.29 | |
| 3k50_A | 403 | Putative S41 protease; structural genomics, joint | 97.24 | |
| 3gge_A | 95 | PDZ domain-containing protein GIPC2; structural ge | 97.24 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 97.23 | |
| 4ag1_A | 226 | Chymase; hydrolase-de novo protein complex, inhibi | 97.23 | |
| 3rp2_A | 224 | RAT MAST cell protease II; serine proteinase; 1.90 | 97.2 | |
| 1hj8_A | 222 | Trypsin I; hydrolase, radiation damage, disulphide | 97.15 | |
| 1cgh_A | 224 | Cathepsin G; inflammation, specificity, serine pro | 97.11 | |
| 1azz_A | 226 | Collagenase; complex (serine protease/inhibitor), | 97.08 | |
| 1iau_A | 227 | Granzyme B; hydrolase-hydrolase inhibitor complex; | 97.06 | |
| 2xw9_A | 228 | Complement factor D; immune system, hydrolase, ser | 97.04 | |
| 1npm_A | 225 | Neuropsin; serine proteinase, glycoprotein; HET: N | 97.03 | |
| 1ton_A | 235 | Tonin; hydrolase(serine proteinase); 1.80A {Rattus | 97.03 | |
| 1mza_A | 240 | Pro-granzyme K; apoptosis, serine protease, S1 fam | 97.03 | |
| 4i8h_A | 223 | Cationic trypsin, beta-trypsin; serine protease, h | 97.02 | |
| 3mfj_A | 223 | Cationic trypsin; serine proteinase, hydrolase; 0. | 97.0 | |
| 1eq9_A | 222 | Chymotrypsin; FIRE ANT, serine proteinase, hydrola | 96.98 | |
| 1fuj_A | 221 | PR3, myeloblastin; hydrolase, serine protease, gly | 96.97 | |
| 1a7s_A | 225 | Heparin binding protein; serine protease homolog, | 96.96 | |
| 1si5_H | 240 | Scatter factor, hepatocyte growth factor, SF, hepa | 96.96 | |
| 3fzz_A | 227 | Granzyme C; hydrolase, cytolysis, protease, serine | 96.94 | |
| 1euf_A | 227 | Duodenase; serine protease, dual specificity, hydr | 96.92 | |
| 3s9c_A | 234 | Vipera russelli proteinase RVV-V gamma; serine pro | 96.91 | |
| 2hlc_A | 230 | Collagenase; serine protease, hydrolase, collagen | 96.88 | |
| 1fxy_A | 228 | Coagulation factor XA-trypsin chimera; protease, c | 96.86 | |
| 1ao5_A | 237 | Glandular kallikrein-13; serine protease, protein | 96.83 | |
| 2z7f_E | 218 | Leukocyte elastase; serine protease, serine protea | 96.83 | |
| 1lo6_A | 223 | Kallikrein 6, HK6; serine protease, human kallikre | 96.82 | |
| 4e7n_A | 238 | Snake-venom thrombin-like enzyme; beta-barrel, hyd | 96.79 | |
| 2aiq_A | 231 | Protein C activator; snake venom serine proteinase | 96.77 | |
| 2qxi_A | 224 | Kallikrein-7; S1 pocket, chloromethyl ketone, alte | 96.73 | |
| 3ncl_A | 241 | Suppressor of tumorigenicity 14 protein; proteinas | 96.72 | |
| 3h7t_A | 235 | Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 | 96.72 | |
| 3s69_A | 234 | Thrombin-like enzyme defibrase; beta-barrel, serin | 96.7 | |
| 3gov_B | 251 | MAsp-1; complement, serine protease, beta barrel, | 96.7 | |
| 2bdg_A | 223 | Kallikrein-4; serine proteinase, S1 subsite, 70-80 | 96.69 | |
| 1m9u_A | 241 | Earthworm fibrinolytic enzyme; hydrolase, serine p | 96.65 | |
| 1sgf_A | 240 | 7S NGF, nerve growth factor; growth factor (beta-N | 96.65 | |
| 1orf_A | 234 | Granzyme A; hydrolase-hydrolase inhibitor complex; | 96.6 | |
| 2any_A | 241 | Kininogenin, plasma kallikrein, light chain, fletc | 96.6 | |
| 2psx_A | 227 | Kallikrein-5; zinc inhibition, stratum corneum, gl | 96.59 | |
| 2zgc_A | 240 | Granzyme M; serine protease, cytolysis, glycoprote | 96.55 | |
| 2zch_P | 237 | Prostate-specific antigen; human PSA, kallikrein r | 96.52 | |
| 3h7o_A | 228 | Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 | 96.51 | |
| 1lvm_A | 229 | Catalytic domain of the nuclear inclusion protein | 96.48 | |
| 2f91_A | 237 | Hepatopancreas trypsin; trypsin, canonical inhibit | 96.47 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 96.47 | |
| 3mhw_U | 247 | Urokinase-type plasminogen activator; hydrolase, b | 96.45 | |
| 2asu_B | 234 | Hepatocyte growth factor-like protein; serine prot | 96.42 | |
| 2oq5_A | 232 | Transmembrane protease, serine 11E; type II trans- | 96.38 | |
| 3bg8_A | 238 | Coagulation factor XIA light chain; protease inhib | 96.31 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 96.28 | |
| 3gyl_B | 261 | Prostasin; ENAC, zymogen, divalent cation, channel | 96.25 | |
| 1spj_A | 238 | Kallikrein 1; serine protease, KLK1, HK1, hydrolas | 96.24 | |
| 1pyt_D | 251 | TC, PCPA-TC, chymotrypsinogen C; ternary complex ( | 96.21 | |
| 1arb_A | 268 | Achromobacter protease I; hydrolase(serine proteas | 96.17 | |
| 3beu_A | 224 | Trypsin, SGT; beta sheets, serine protease, hydrol | 96.16 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 96.14 | |
| 2r0l_A | 248 | Hepatocyte growth factor activator; serine proteas | 96.14 | |
| 4dgj_A | 235 | Enteropeptidase catalytic light chain; serine prot | 96.08 | |
| 1rtf_B | 252 | (TC)-T-PA, two chain tissue plasminogen activator; | 96.07 | |
| 3tvj_B | 242 | Mannan-binding lectin serine protease 2 B chain; i | 95.92 | |
| 1ym0_A | 238 | Fibrinotic enzyme component B; two chains, glycosy | 95.88 | |
| 2jde_A | 276 | Urokinase-type plasminogen activator; plasminogen | 95.85 | |
| 1t8o_A | 245 | Chymotrypsin A; chymotrypsin, serine proteinase, B | 95.71 | |
| 1aut_C | 250 | Activated protein C; serine proteinase, plasma cal | 95.68 | |
| 1yph_C | 131 | Chymotrypsin A, chain B; serine protease, hydrolas | 95.59 | |
| 1yc0_A | 283 | Hepatocyte growth factor activator; hydrolase/inhi | 95.56 | |
| 1fon_A | 240 | Procarboxypeptidase A-S6; truncated zymogen E, ser | 95.32 | |
| 3cp7_A | 218 | Alkaline serine protease Al20; trypsin-like, hydro | 95.19 | |
| 2jkh_A | 241 | Activated factor XA heavy chain; plasma, calcium, | 95.17 | |
| 2bz6_H | 254 | Blood coagulation factor VIIA; serine protease, en | 95.17 | |
| 1bru_P | 241 | Elastase, PPE; serine protease, hydrolase; HET: 1N | 94.93 | |
| 3rm2_H | 259 | Thrombin heavy chain; serine protease, kringle, hy | 94.81 | |
| 1elt_A | 236 | Elastase; serine proteinase; 1.61A {Salmo salar} S | 94.48 | |
| 1gvk_B | 240 | Elastase 1, peptide inhibitor; hydrolase, serine p | 94.23 | |
| 2f9n_A | 245 | Alpha I tryptase; serine proteinase, trypsin-like, | 93.22 | |
| 1ddj_A | 247 | Plasminogen; catalytic domain, blood clotting; 2.0 | 93.15 | |
| 4dur_A | 791 | Plasminogen, serine protease; fibrinolysis, hydrol | 92.8 | |
| 2olg_A | 278 | Pro-phenoloxidase activating enzyme-I; prophenolox | 92.46 | |
| 2bhg_A | 209 | Foot-and-mouth disease virus 3C protease; chymotry | 92.38 | |
| 2b9l_A | 394 | Prophenoloxidase activating factor; CLIP domain, e | 91.38 | |
| 1z8g_A | 372 | Serine protease hepsin; serine protease hepsin, pr | 91.18 | |
| 2qy0_B | 242 | Complement C1R subcomponent; serine protease, beta | 91.14 | |
| 1fiw_A | 290 | Beta-acrosin heavy chain; anti-parallel beta-barre | 90.66 | |
| 3qzr_A | 187 | 3C protein; chymotrypsin-fold, beta-ribbon, hydrol | 90.47 | |
| 4dcd_A | 190 | Protease 3C, genome polyprotein; antiviral inhibit | 90.25 | |
| 2bdy_A | 289 | Thrombin; thrombin, complex structure, hydrolase, | 89.82 | |
| 1zjk_A | 403 | Mannan-binding lectin serine protease 2; beta barr | 89.63 | |
| 2vnt_A | 276 | Urokinase-type plasminogen activator; UPA, inhibit | 89.11 | |
| 2b0f_A | 182 | Picornain 3C (protease 3C) (P3C); beta barrel, hyd | 88.63 | |
| 4f4o_C | 347 | Haptoglobin; globin fold, serine protease fold, co | 88.2 | |
| 2wph_S | 235 | Coagulation factor IXA heavy chain; serine proteas | 88.05 | |
| 2xxl_A | 408 | GRAM-positive specific serine protease, isoform B; | 87.53 | |
| 3q3y_A | 191 | HEVB EV93 3C protease; cysteine trypsin-like prote | 87.49 | |
| 3zve_A | 190 | 3C protease; hydrolase, michael inhibitor; HET: G8 | 87.06 | |
| 1md8_A | 329 | C1R complement serine protease; innate immunity, a | 85.84 | |
| 1rrk_A | 497 | Complement factor B; BB, hydrolase; 2.00A {Homo sa | 82.88 | |
| 2hal_A | 212 | Hepatitis A protease 3C; 3C protease, inhibitor de | 82.59 | |
| 1elv_A | 333 | Complement C1S component; trypsin-like serin prote | 82.37 |
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1e-50 Score=458.23 Aligned_cols=395 Identities=19% Similarity=0.287 Sum_probs=315.9
Q ss_pred hhhhhhcCcEEEEEEeecCcc----------ccCC------ccccceeEEEEEEEecCCceEEEEecceeccCCceEEEE
Q 004068 286 FAESVIEPTLVMFEVHVPPSC----------MIDG------VHSQHFFGTGVIIYHSQSMGLVVVDKNTVAISASDVMLS 349 (775)
Q Consensus 286 ~~~~~l~~SvV~V~~~~~~~~----------~~Dg------~~~~~~~GSGvVId~~~~~GlVLTnr~~V~~~~~~I~Vt 349 (775)
.+++++.||||.|.+...... .++. .....+.||||||+. ++||||||+| |..++.++.|+
T Consensus 17 ~~~~~~~paVV~I~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~GSGfii~~--~~G~IlTn~H-vv~~a~~i~V~ 93 (436)
T 4a8c_A 17 PMLEKVLPAVVSVRVEGTASQGQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIINA--SKGYVLTNNH-VINQAQKISIQ 93 (436)
T ss_pred HHHHhhCCcEEEEEEEEeecccccCcchhhhhcccccccccCCcCceEEEEEEEEC--CCCEEEECHH-HhCCCCEEEEE
Confidence 389999999999988653210 1111 112357899999992 3499999966 55678899999
Q ss_pred EcCCCeEEeEEEEEEeCCCcEEEEEeC-CCCCCcccccceeeeeeCCCCCCCCCCEEEEEEeCCCCCCeeEEEEEeCCcc
Q 004068 350 FAAFPIEIPGEVVFLHPVHNFALIAYD-PSSLGVAGASVVRAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCA 428 (775)
Q Consensus 350 ~~d~~~~~~A~Vv~~dp~~DlAILk~d-~~~l~~~~~~~v~~~~lg~s~~l~~Gd~V~aiG~p~g~~~~~~~g~VS~~~~ 428 (775)
+.+ +..++|++++.|+.+||||||++ +..++ +++|+++..++.||.|+++|||+++..+++.|+|+....
T Consensus 94 ~~d-g~~~~a~vv~~d~~~DlAllkv~~~~~l~--------~~~l~~s~~~~~G~~v~aiG~P~g~~~~vt~G~vs~~~r 164 (436)
T 4a8c_A 94 LND-GREFDAKLIGSDDQSDIALLQIQNPSKLT--------QIAIADSDKLRVGDFAVAVGNPFGLGQTATSGIVSALGR 164 (436)
T ss_pred eCC-CCEEEEEEEEEcCCCCEEEEEecCCCCCc--------eEeccCcccCCCCCEEEEEEcCCCCCccEEEEEEeeecc
Confidence 998 99999999999999999999995 44554 489998878999999999999999999999999997542
Q ss_pred ccccCCCCcccccccceEEEEEeeccCCCC-CceEEccCceEEEEeeeecccccccCCCCCCceeeeccccchhhhHHHH
Q 004068 429 ALNISSADCPRYRAMNMEVIELDTDFGSTF-SGVLTDEHGRVQAIWGSFSTQVKFGCSSSEDHQFVRGIPIYTISRVLDK 507 (775)
Q Consensus 429 ~~~~~~~~~pryra~n~e~I~~Da~i~~~~-GGpL~d~~G~VvGI~~~~~~~~~~~~~~~~~~~f~~aIPi~~i~~vl~~ 507 (775)
. ... ...| .++||+|+++++|+ ||||+|.+|+||||+++..... ....++.||||++.+++++++
T Consensus 165 ~-~~~---~~~~----~~~iq~da~i~~GnSGGPl~n~~G~vvGI~~~~~~~~------~~~~g~gfaIP~~~~~~~~~~ 230 (436)
T 4a8c_A 165 S-GLN---LEGL----ENFIQTDASINRGNAGGALLNLNGELIGINTAILAPG------GGSVGIGFAIPSNMARTLAQQ 230 (436)
T ss_pred c-ccC---CCCc----cCEEEEcCccCCCCCcCcccCCCCEEEEEEeeeccCC------CCceeEEEEEehHHHHHHHHH
Confidence 2 111 1223 37899999999998 9999999999999998765431 122345569999999999999
Q ss_pred HHcCCCCCCccccccccCCCcceEEEEEEEEcChhhhhhcCCChhHHhhhhhcCCCccceEEEEEEcCCChHhhh-ccCC
Q 004068 508 IISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDPVRRQVLRVKGCLAGSKAENM-LEQG 586 (775)
Q Consensus 508 l~~g~~~~~~~~~~v~r~~p~~~~Lgve~~~i~~~~ar~lGls~~wi~~v~~~~~~~~q~l~V~~V~~gSpA~~a-Lq~G 586 (775)
|++.++ +.|+ |||+.++.++...++.+|++.. .+++|..|.++|||+++ |+.|
T Consensus 231 l~~~g~--------v~r~-----~lGv~~~~~~~~~a~~~gl~~~-------------~G~~V~~V~~~spA~~aGL~~G 284 (436)
T 4a8c_A 231 LIDFGE--------IKRG-----LLGIKGTEMSADIAKAFNLDVQ-------------RGAFVSEVLPGSGSAKAGVKAG 284 (436)
T ss_pred HHhccc--------cccc-----cCceEecccCHHHHHHhCCCCC-------------cceEEEEECCCChHHHCCCCCC
Confidence 998864 5566 9999999999999999998753 56779999999999996 9999
Q ss_pred CEEEEECCEEeCChhhHHHHHHhcCCCCCCCCeEEEEEEecCeEEEEEEEecccCCCCcce---eeeeeeeeecCChhhH
Q 004068 587 DMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDITIFRQGREIELQVGTDVRDGNGTTR---VINWCGCIVQDPHPAV 663 (775)
Q Consensus 587 DiILsVNGk~V~s~~dl~~~l~~~~~~~~~g~~v~l~V~R~Gk~~~l~V~l~~~~~~~t~r---~v~~~G~~lq~p~~~v 663 (775)
|+|++|||++|.+|.++..++.... .++++.++|.|+|+++++++++.......... ...+.|..+....
T Consensus 285 D~I~~vnG~~v~~~~~l~~~l~~~~----~g~~v~l~v~R~g~~~~~~v~l~~~~~~~~~~~~~~~gl~~~~~~~~~--- 357 (436)
T 4a8c_A 285 DIITSLNGKPLNSFAELRSRIATTE----PGTKVKLGLLRNGKPLEVEVTLDTSTSSSASAEMITPALEGATLSDGQ--- 357 (436)
T ss_pred CEEEEECCEECCCHHHHHHHHHhcC----CCCEEEEEEEECCEEEEEEEEECCCCcccccccccccCceeeeccccc---
Confidence 9999999999999999999886544 37899999999999999999988765322111 1222333322111
Q ss_pred hhhCCCCCCCCceEEEEEcCCCHHhHcCCCCCCEEEEECCeeCCCHHHHHHHHHhcCCCCEEEEEEEEeCCeEEEEEEEe
Q 004068 664 RALGFLPEEGHGVYVARWCHGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHLNGKPRVLTLKQ 743 (775)
Q Consensus 664 rql~~lps~~~gV~Vs~V~~GSPA~~aGL~~GD~I~~VNG~pV~dl~~f~~~v~~i~~g~~V~L~~V~Rdg~~~~ltlk~ 743 (775)
......|++|..|.++|||+++||++||+|++|||+++.++++|.+++++ . ++.+.|+ +.|+|+.+.+++.+
T Consensus 358 -----~~~~~~gv~V~~V~~~spA~~aGL~~GD~I~~vng~~v~~~~~~~~~l~~-~-~~~v~l~-v~R~g~~~~~~~~~ 429 (436)
T 4a8c_A 358 -----LKDGGKGIKIDEVVKGSPAAQAGLQKDDVIIGVNRDRVNSIAEMRKVLAA-K-PAIIALQ-IVRGNESIYLLMRL 429 (436)
T ss_pred -----ccCCCCCEEEEEeCCCCHHHHcCCCCCCEEEEECCEECCCHHHHHHHHHh-C-CCeEEEE-EEECCEEEEEEEEe
Confidence 01112489999999999999999999999999999999999999999998 3 4589998 79999999999988
Q ss_pred CCCC
Q 004068 744 DLHY 747 (775)
Q Consensus 744 d~~y 747 (775)
.+.+
T Consensus 430 ~~~~ 433 (436)
T 4a8c_A 430 EHHH 433 (436)
T ss_pred cccC
Confidence 7554
|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A | Back alignment and structure |
|---|
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A | Back alignment and structure |
|---|
| >2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A | Back alignment and structure |
|---|
| >2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A | Back alignment and structure |
|---|
| >1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} | Back alignment and structure |
|---|
| >2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} | Back alignment and structure |
|---|
| >2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 | Back alignment and structure |
|---|
| >3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A | Back alignment and structure |
|---|
| >2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... | Back alignment and structure |
|---|
| >2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} | Back alignment and structure |
|---|
| >2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A | Back alignment and structure |
|---|
| >3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A | Back alignment and structure |
|---|
| >3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A | Back alignment and structure |
|---|
| >2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A | Back alignment and structure |
|---|
| >2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} | Back alignment and structure |
|---|
| >3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* | Back alignment and structure |
|---|
| >1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A | Back alignment and structure |
|---|
| >2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A | Back alignment and structure |
|---|
| >2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A | Back alignment and structure |
|---|
| >2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A | Back alignment and structure |
|---|
| >3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A | Back alignment and structure |
|---|
| >3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A | Back alignment and structure |
|---|
| >2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A | Back alignment and structure |
|---|
| >2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 | Back alignment and structure |
|---|
| >2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} | Back alignment and structure |
|---|
| >3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A | Back alignment and structure |
|---|
| >2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A | Back alignment and structure |
|---|
| >3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A | Back alignment and structure |
|---|
| >2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A | Back alignment and structure |
|---|
| >1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} | Back alignment and structure |
|---|
| >1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A | Back alignment and structure |
|---|
| >2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A | Back alignment and structure |
|---|
| >1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* | Back alignment and structure |
|---|
| >3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A | Back alignment and structure |
|---|
| >2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A | Back alignment and structure |
|---|
| >2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A | Back alignment and structure |
|---|
| >3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A | Back alignment and structure |
|---|
| >2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A | Back alignment and structure |
|---|
| >2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A | Back alignment and structure |
|---|
| >1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A | Back alignment and structure |
|---|
| >1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A | Back alignment and structure |
|---|
| >2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* | Back alignment and structure |
|---|
| >2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A | Back alignment and structure |
|---|
| >4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} | Back alignment and structure |
|---|
| >1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A | Back alignment and structure |
|---|
| >2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* | Back alignment and structure |
|---|
| >2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} | Back alignment and structure |
|---|
| >2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A | Back alignment and structure |
|---|
| >1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A | Back alignment and structure |
|---|
| >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A | Back alignment and structure |
|---|
| >1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A | Back alignment and structure |
|---|
| >2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A | Back alignment and structure |
|---|
| >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A | Back alignment and structure |
|---|
| >2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A | Back alignment and structure |
|---|
| >1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A | Back alignment and structure |
|---|
| >1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B | Back alignment and structure |
|---|
| >2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A | Back alignment and structure |
|---|
| >3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A | Back alignment and structure |
|---|
| >2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A | Back alignment and structure |
|---|
| >1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A | Back alignment and structure |
|---|
| >2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A | Back alignment and structure |
|---|
| >1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A | Back alignment and structure |
|---|
| >3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A | Back alignment and structure |
|---|
| >2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A | Back alignment and structure |
|---|
| >1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A | Back alignment and structure |
|---|
| >3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A | Back alignment and structure |
|---|
| >1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A | Back alignment and structure |
|---|
| >1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A | Back alignment and structure |
|---|
| >2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A | Back alignment and structure |
|---|
| >3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A | Back alignment and structure |
|---|
| >1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A | Back alignment and structure |
|---|
| >2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A | Back alignment and structure |
|---|
| >3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A | Back alignment and structure |
|---|
| >1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A | Back alignment and structure |
|---|
| >2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A | Back alignment and structure |
|---|
| >2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A | Back alignment and structure |
|---|
| >2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} | Back alignment and structure |
|---|
| >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A | Back alignment and structure |
|---|
| >3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A | Back alignment and structure |
|---|
| >2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} | Back alignment and structure |
|---|
| >2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A | Back alignment and structure |
|---|
| >3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A | Back alignment and structure |
|---|
| >1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A | Back alignment and structure |
|---|
| >1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} | Back alignment and structure |
|---|
| >1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} | Back alignment and structure |
|---|
| >2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A | Back alignment and structure |
|---|
| >2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A | Back alignment and structure |
|---|
| >2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A | Back alignment and structure |
|---|
| >1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A | Back alignment and structure |
|---|
| >3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* | Back alignment and structure |
|---|
| >1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A | Back alignment and structure |
|---|
| >1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A | Back alignment and structure |
|---|
| >2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A | Back alignment and structure |
|---|
| >1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A | Back alignment and structure |
|---|
| >2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A | Back alignment and structure |
|---|
| >1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A | Back alignment and structure |
|---|
| >2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A | Back alignment and structure |
|---|
| >1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* | Back alignment and structure |
|---|
| >1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A | Back alignment and structure |
|---|
| >3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A | Back alignment and structure |
|---|
| >2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A | Back alignment and structure |
|---|
| >3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A | Back alignment and structure |
|---|
| >2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A | Back alignment and structure |
|---|
| >2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A | Back alignment and structure |
|---|
| >1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A | Back alignment and structure |
|---|
| >1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A | Back alignment and structure |
|---|
| >1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A | Back alignment and structure |
|---|
| >2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A | Back alignment and structure |
|---|
| >2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A | Back alignment and structure |
|---|
| >3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A | Back alignment and structure |
|---|
| >2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A | Back alignment and structure |
|---|
| >1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* | Back alignment and structure |
|---|
| >1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* | Back alignment and structure |
|---|
| >1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A | Back alignment and structure |
|---|
| >4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* | Back alignment and structure |
|---|
| >2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* | Back alignment and structure |
|---|
| >1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A | Back alignment and structure |
|---|
| >2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} | Back alignment and structure |
|---|
| >3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* | Back alignment and structure |
|---|
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B | Back alignment and structure |
|---|
| >1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* | Back alignment and structure |
|---|
| >1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} | Back alignment and structure |
|---|
| >1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... | Back alignment and structure |
|---|
| >1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* | Back alignment and structure |
|---|
| >1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... | Back alignment and structure |
|---|
| >1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A | Back alignment and structure |
|---|
| >1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C | Back alignment and structure |
|---|
| >3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} | Back alignment and structure |
|---|
| >2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... | Back alignment and structure |
|---|
| >2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... | Back alignment and structure |
|---|
| >1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... | Back alignment and structure |
|---|
| >1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... | Back alignment and structure |
|---|
| >2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* | Back alignment and structure |
|---|
| >1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A | Back alignment and structure |
|---|
| >4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A | Back alignment and structure |
|---|
| >2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A | Back alignment and structure |
|---|
| >2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* | Back alignment and structure |
|---|
| >2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* | Back alignment and structure |
|---|
| >3qzr_A 3C protein; chymotrypsin-fold, beta-ribbon, hydrolysis, nucleus, hydrola hydrolase inhibitor complex; HET: AG7; 1.04A {Human enterovirus 71} SCOP: b.47.1.0 PDB: 3osy_A 3qzq_A* 3r0f_A* 3sjo_A* 3sjk_A 3sji_A* 3sj8_A* 3sj9_A | Back alignment and structure |
|---|
| >4dcd_A Protease 3C, genome polyprotein; antiviral inhibitors, dipeptidyl inhib hydrolase-hydrolase inhibitor complex; HET: K36; 1.69A {Human poliovirus 1} PDB: 1l1n_A | Back alignment and structure |
|---|
| >2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A | Back alignment and structure |
|---|
| >2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} | Back alignment and structure |
|---|
| >2b0f_A Picornain 3C (protease 3C) (P3C); beta barrel, hydrolase-hydrolase inhibitor complex; HET: CA1; NMR {Human rhinovirus 14} PDB: 2in2_A | Back alignment and structure |
|---|
| >4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} | Back alignment and structure |
|---|
| >2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* | Back alignment and structure |
|---|
| >2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3q3y_A HEVB EV93 3C protease; cysteine trypsin-like protease, 3C cysteine protease (picorn antiviral compound 1 (AG7404); HET: XNV; 1.32A {Human enterovirus B} SCOP: b.47.1.4 PDB: 3q3x_A* 3ruo_A* 3zyd_A 3zz5_A* 3zz6_A* 3zz7_A* 3zz8_A* 3zz9_A* 3zza_A* 3zzb_A* 2ztx_A 2vb0_A 2zty_A 2ztz_A 2zu3_A* 3zye_A 3zz3_A 2zu1_A 3zz4_A 3zzc_A* ... | Back alignment and structure |
|---|
| >3zve_A 3C protease; hydrolase, michael inhibitor; HET: G84; 1.80A {Human enterovirus} PDB: 3zv8_A* 3zva_A* 3zvb_A* 3zv9_A* 3zvd_A* 3zvc_A* 3zvf_A* 3zvg_A* | Back alignment and structure |
|---|
| >1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A | Back alignment and structure |
|---|
| >2hal_A Hepatitis A protease 3C; 3C protease, inhibitor design; HET: BBL; 1.35A {Hepatitis a virus} SCOP: b.47.1.4 PDB: 2h6m_A* 2h9h_A* 2cxv_A* 2a4o_A* 1hav_A 1qa7_A* | Back alignment and structure |
|---|
| >1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 775 | ||||
| d2z9ia1 | 88 | b.36.1.4 (A:227-314) Protease PepD {Mycobacterium | 2e-06 | |
| d1lcya1 | 100 | b.36.1.4 (A:226-325) Mitochondrial serine protease | 7e-06 | |
| d1lcya1 | 100 | b.36.1.4 (A:226-325) Mitochondrial serine protease | 3e-05 | |
| d2i6va1 | 87 | b.36.1.5 (A:219-305) General secretion pathway pro | 5e-05 | |
| d2hgaa1 | 103 | b.36.1.6 (A:23-125) Uncharacterized protein MTH136 | 1e-04 | |
| d1ky9b2 | 88 | b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t | 0.001 | |
| d2f5ya1 | 77 | b.36.1.1 (A:19-95) Regulator of G-protein signalin | 0.002 |
| >d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 | Back information, alignment and structure |
|---|
class: All beta proteins fold: PDZ domain-like superfamily: PDZ domain-like family: HtrA-like serine proteases domain: Protease PepD species: Mycobacterium tuberculosis [TaxId: 1773]
Score = 44.5 bits (105), Expect = 2e-06
Identities = 10/83 (12%), Positives = 27/83 (32%)
Query: 660 HPAVRALGFLPEEGHGVYVARWCHGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEI 719
H ++ ++ G + G G+ + +++ + +A V +
Sbjct: 2 HASLGVQVTNDKDTLGAKIVEVVAGGAAANAGVPKGVVVTKVDDRPINSADALVAAVRSK 61
Query: 720 EHGEFVRVRTVHLNGKPRVLTLK 742
G V + +G R + +
Sbjct: 62 APGATVALTFQDPSGGSRTVQVT 84
|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 | Back information, alignment and structure |
|---|
| >d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 103 | Back information, alignment and structure |
|---|
| >d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 775 | |||
| d1ky9a2 | 249 | Protease Do (DegP, HtrA), catalytic domain {Escher | 99.95 | |
| d1l1ja_ | 228 | Protease Do (DegP, HtrA), catalytic domain {Thermo | 99.92 | |
| d2z9ia2 | 221 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 99.91 | |
| d2qf3a1 | 210 | Stress sensor protease DegS, catalytic domain {Esc | 99.91 | |
| d1lcya2 | 205 | Mitochondrial serine protease HtrA2, catalytic dom | 99.89 | |
| d1lvmb_ | 219 | TEV protease (nucleat inclusion protein A, NIA) {T | 99.7 | |
| d1agja_ | 242 | Epidermolytic (exfoliative) toxin A {Staphylococcu | 99.5 | |
| d2qaaa1 | 185 | Protease B {Streptomyces griseus, strain k1 [TaxId | 99.44 | |
| d1ky9a1 | 94 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 99.33 | |
| d1lcya1 | 100 | Mitochondrial serine protease HtrA2 {Human (Homo s | 99.33 | |
| d1lcya1 | 100 | Mitochondrial serine protease HtrA2 {Human (Homo s | 99.32 | |
| d2z9ia1 | 88 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 99.29 | |
| d1ky9a1 | 94 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 99.27 | |
| d1sota1 | 99 | Stress sensor protease DegS, C-terminal domain {Es | 99.26 | |
| d1sota1 | 99 | Stress sensor protease DegS, C-terminal domain {Es | 99.26 | |
| d2bhga1 | 199 | 3C cysteine protease (picornain 3C) {Foot-and-mout | 99.25 | |
| d1qtfa_ | 246 | Exfoliative toxin B {Staphylococcus aureus [TaxId: | 99.21 | |
| d2o8la1 | 216 | V8 protease {Staphylococcus aureus [TaxId: 1280]} | 99.14 | |
| d2hgaa1 | 103 | Uncharacterized protein MTH1368 {Methanobacterium | 99.09 | |
| d2i6va1 | 87 | General secretion pathway protein C, EpsC {Vibrio | 99.07 | |
| d1ky9b2 | 88 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 99.02 | |
| d2z9ia1 | 88 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 98.99 | |
| d2hgaa1 | 103 | Uncharacterized protein MTH1368 {Methanobacterium | 98.91 | |
| d1fc6a3 | 92 | Photosystem II D1 C-terminal processing protease { | 98.89 | |
| d2i6va1 | 87 | General secretion pathway protein C, EpsC {Vibrio | 98.88 | |
| d2sgaa_ | 181 | Protease A {Streptomyces griseus, strain k1 [TaxId | 98.82 | |
| d2h5ca1 | 198 | alpha-Lytic protease {Lysobacter enzymogenes, 495 | 98.8 | |
| d1k32a1 | 91 | Tricorn protease {Archaeon Thermoplasma acidophilu | 98.73 | |
| d2f5ya1 | 77 | Regulator of G-protein signaling 3, RGS3 {Human (H | 98.65 | |
| d1ky9b2 | 88 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 98.65 | |
| d1q3oa_ | 104 | Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId | 98.61 | |
| d1x5qa1 | 97 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 98.59 | |
| d1ozia_ | 99 | Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 | 98.58 | |
| d1w9ea1 | 85 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 98.57 | |
| d1m5za_ | 91 | Glutamate receptor interacting protein {Rat (Rattu | 98.56 | |
| d1g9oa_ | 91 | Na+/H+ exchanger regulatory factor, NHERF {Human ( | 98.55 | |
| d1rgwa_ | 85 | Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax | 98.54 | |
| d1t2ma1 | 92 | Afadin {Human (Homo sapiens) [TaxId: 9606]} | 98.46 | |
| d1k32a1 | 91 | Tricorn protease {Archaeon Thermoplasma acidophilu | 98.45 | |
| d2fe5a1 | 92 | Synapse-associated protein 102 {Human (Homo sapien | 98.45 | |
| d1fc6a3 | 92 | Photosystem II D1 C-terminal processing protease { | 98.44 | |
| d1rgra_ | 93 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 98.42 | |
| d1uf1a_ | 128 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 98.4 | |
| d1x45a1 | 85 | Amyloid beta A4 precursor protein-binding family A | 98.39 | |
| d1vaea_ | 111 | Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | 98.38 | |
| d2fcfa1 | 96 | Multiple PDZ domain protein {Human (Homo sapiens) | 98.37 | |
| d1ihja_ | 94 | Inad {Fruit fly (Drosophila melanogaster) [TaxId: | 98.35 | |
| d1vb7a_ | 94 | PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta | 98.33 | |
| d1r6ja_ | 82 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 98.31 | |
| d1wf8a1 | 94 | Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | 98.31 | |
| d1y7na1 | 79 | Amyloid beta A4 precursor protein-binding family A | 98.31 | |
| d1uhpa_ | 107 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 98.3 | |
| d1wi2a_ | 104 | PDZ domain containing protein 11, Pdzk11 {Mouse (M | 98.28 | |
| d1wifa_ | 126 | hypothetical PDZ domain containing protein Uqcrc2 | 98.28 | |
| d1hpga_ | 187 | Glutamic acid-specific protease {Streptomyces gris | 98.28 | |
| d1p1da2 | 99 | Glutamate receptor interacting protein {Rat (Rattu | 98.28 | |
| d1qaua_ | 112 | Neuronal nitric oxide synthase, NNOS {Rat (Rattus | 98.27 | |
| d1x5ra1 | 99 | Glutamate receptor interacting protein 2, GRIP2 (K | 98.27 | |
| d1kwaa_ | 88 | Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.24 | |
| d1qava_ | 90 | Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | 98.24 | |
| d1rzxa_ | 98 | GTPase-binding domain of the cell polarity protein | 98.23 | |
| d1um1a_ | 110 | Hypothetical protein KIAA1849 {Human (Homo sapiens | 98.23 | |
| d1ueqa_ | 123 | Membrane associated guanylate kinase inverted-2 (M | 98.23 | |
| d1rgwa_ | 85 | Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax | 98.23 | |
| d1whaa_ | 105 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 98.22 | |
| d2cssa1 | 108 | Regulating synaptic membrane exocytosis protein 1, | 98.21 | |
| d1wh1a_ | 124 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 98.21 | |
| d1uepa_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 98.2 | |
| d1x5na1 | 101 | Harmonin {Human (Homo sapiens) [TaxId: 9606]} | 98.19 | |
| d2fnea1 | 88 | Multiple PDZ domain protein {Human (Homo sapiens) | 98.19 | |
| d1p3ca_ | 215 | Glutamyl endopeptidase {Bacillus intermedius [TaxI | 98.16 | |
| d1tp5a1 | 102 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 98.15 | |
| d1n7ea_ | 95 | Glutamate receptor-interacting protein 1, GRIP1 {R | 98.15 | |
| d2f5ya1 | 77 | Regulator of G-protein signaling 3, RGS3 {Human (H | 98.15 | |
| d1wi4a1 | 96 | Syntaxin binding protein 4 {Mouse (Mus musculus) [ | 98.14 | |
| d1va8a1 | 100 | Maguk p55 subfamily member 5 {Mouse (Mus musculus) | 98.14 | |
| d1uita_ | 117 | Discs large 5 protein KIAA0583 {Human (Homo sapien | 98.13 | |
| d1ujda_ | 117 | Hypothetical protein KIAA0559 {Human (Homo sapiens | 98.13 | |
| d1uewa_ | 114 | Membrane associated guanylate kinase inverted-2 (M | 98.12 | |
| d2f0aa1 | 92 | Segment polarity protein dishevelled homolog Dvl-2 | 98.11 | |
| d1ueza_ | 101 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 98.08 | |
| d2h3la1 | 103 | Erbin {Human (Homo sapiens) [TaxId: 9606]} | 98.07 | |
| d1x5qa1 | 97 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 98.07 | |
| d1ujua_ | 111 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 98.07 | |
| d1wf7a_ | 103 | Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 | 98.05 | |
| d2csja1 | 104 | Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc | 98.05 | |
| d1t2ma1 | 92 | Afadin {Human (Homo sapiens) [TaxId: 9606]} | 98.04 | |
| d1v5qa_ | 122 | Glutamate receptor interacting protein {Mouse (Mus | 98.03 | |
| d1x6da1 | 107 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 98.01 | |
| d1m5za_ | 91 | Glutamate receptor interacting protein {Rat (Rattu | 97.98 | |
| d1v5la_ | 103 | Alpha-actinin-2 associated LIM protein {Mouse (Mus | 97.98 | |
| d1v62a_ | 117 | Glutamate receptor interacting protein 2, GRIP2 (K | 97.97 | |
| d1vb7a_ | 94 | PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta | 97.97 | |
| d1w9ea1 | 85 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 97.96 | |
| d2fe5a1 | 92 | Synapse-associated protein 102 {Human (Homo sapien | 97.94 | |
| d1i16a_ | 130 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 97.92 | |
| d1q3oa_ | 104 | Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId | 97.91 | |
| d2cs5a1 | 106 | Tyrosine-protein phosphatase non-receptor type 4, | 97.87 | |
| d1v6ba_ | 118 | Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | 97.86 | |
| d1ozia_ | 99 | Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 | 97.86 | |
| d1wfva_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 97.85 | |
| d2h3la1 | 103 | Erbin {Human (Homo sapiens) [TaxId: 9606]} | 97.84 | |
| d1wf8a1 | 94 | Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | 97.83 | |
| d1wg6a_ | 127 | Partitioning-defective 3-like protein, PAR3-L (RIK | 97.83 | |
| d2fcfa1 | 96 | Multiple PDZ domain protein {Human (Homo sapiens) | 97.81 | |
| d1ufxa_ | 103 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 97.79 | |
| d1ihja_ | 94 | Inad {Fruit fly (Drosophila melanogaster) [TaxId: | 97.75 | |
| d1rgra_ | 93 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 97.74 | |
| d1wf7a_ | 103 | Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 | 97.74 | |
| d1g9oa_ | 91 | Na+/H+ exchanger regulatory factor, NHERF {Human ( | 97.73 | |
| d1cqqa_ | 180 | 3C cysteine protease (picornain 3C) {Human rhinovi | 97.72 | |
| d1qava_ | 90 | Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | 97.72 | |
| d1v5la_ | 103 | Alpha-actinin-2 associated LIM protein {Mouse (Mus | 97.7 | |
| d1ueza_ | 101 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 97.69 | |
| d1uita_ | 117 | Discs large 5 protein KIAA0583 {Human (Homo sapien | 97.68 | |
| d2csja1 | 104 | Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc | 97.67 | |
| d1p1da2 | 99 | Glutamate receptor interacting protein {Rat (Rattu | 97.67 | |
| d1whaa_ | 105 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 97.66 | |
| d1ujda_ | 117 | Hypothetical protein KIAA0559 {Human (Homo sapiens | 97.64 | |
| d1vaea_ | 111 | Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | 97.63 | |
| d1uf1a_ | 128 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 97.63 | |
| d1n7ea_ | 95 | Glutamate receptor-interacting protein 1, GRIP1 {R | 97.62 | |
| d1wi2a_ | 104 | PDZ domain containing protein 11, Pdzk11 {Mouse (M | 97.61 | |
| d1uhpa_ | 107 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 97.6 | |
| d1y7na1 | 79 | Amyloid beta A4 precursor protein-binding family A | 97.59 | |
| d1ueqa_ | 123 | Membrane associated guanylate kinase inverted-2 (M | 97.58 | |
| d2cssa1 | 108 | Regulating synaptic membrane exocytosis protein 1, | 97.57 | |
| d1wh1a_ | 124 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 97.56 | |
| d2f0aa1 | 92 | Segment polarity protein dishevelled homolog Dvl-2 | 97.52 | |
| d1x45a1 | 85 | Amyloid beta A4 precursor protein-binding family A | 97.51 | |
| d1kwaa_ | 88 | Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | 97.5 | |
| d2fnea1 | 88 | Multiple PDZ domain protein {Human (Homo sapiens) | 97.48 | |
| d1r6ja_ | 82 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 97.48 | |
| d1wifa_ | 126 | hypothetical PDZ domain containing protein Uqcrc2 | 97.47 | |
| d1um1a_ | 110 | Hypothetical protein KIAA1849 {Human (Homo sapiens | 97.46 | |
| d1rzxa_ | 98 | GTPase-binding domain of the cell polarity protein | 97.43 | |
| d1uepa_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 97.42 | |
| d1uewa_ | 114 | Membrane associated guanylate kinase inverted-2 (M | 97.41 | |
| d1qaua_ | 112 | Neuronal nitric oxide synthase, NNOS {Rat (Rattus | 97.41 | |
| d1ujua_ | 111 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 97.4 | |
| d1tp5a1 | 102 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 97.38 | |
| d1x5na1 | 101 | Harmonin {Human (Homo sapiens) [TaxId: 9606]} | 97.36 | |
| d1v62a_ | 117 | Glutamate receptor interacting protein 2, GRIP2 (K | 97.36 | |
| d1wi4a1 | 96 | Syntaxin binding protein 4 {Mouse (Mus musculus) [ | 97.34 | |
| d1ujva_ | 96 | Membrane associated guanylate kinase inverted-2 (M | 97.27 | |
| d1wfva_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 97.25 | |
| d1x5ra1 | 99 | Glutamate receptor interacting protein 2, GRIP2 (K | 97.16 | |
| d1x6da1 | 107 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 97.13 | |
| d1va8a1 | 100 | Maguk p55 subfamily member 5 {Mouse (Mus musculus) | 97.13 | |
| d1v5qa_ | 122 | Glutamate receptor interacting protein {Mouse (Mus | 97.11 | |
| d2cs5a1 | 106 | Tyrosine-protein phosphatase non-receptor type 4, | 97.08 | |
| d1i16a_ | 130 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 96.98 | |
| d1v6ba_ | 118 | Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | 96.93 | |
| d1ufxa_ | 103 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 96.79 | |
| d1wg6a_ | 127 | Partitioning-defective 3-like protein, PAR3-L (RIK | 96.71 | |
| d1j16a_ | 223 | Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 | 96.42 | |
| d1lo6a_ | 221 | Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | 96.39 | |
| d1nn6a_ | 224 | Chymase (mast cell protease I) {Human (Homo sapien | 96.35 | |
| d1gdna_ | 224 | Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 | 96.13 | |
| d1eufa_ | 224 | Duodenase {Cow (Bos taurus) [TaxId: 9913]} | 96.07 | |
| d1ujva_ | 96 | Membrane associated guanylate kinase inverted-2 (M | 96.02 | |
| d1fuja_ | 221 | Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 | 95.97 | |
| g1fiw.1 | 274 | Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} | 95.94 | |
| d3rp2a_ | 224 | Chymase II (mast cell proteinase II) {Rat (Rattus | 95.86 | |
| d1azza_ | 226 | Crab collagenase {Atlantic sand fiddler crab (Uca | 95.82 | |
| d1bioa_ | 228 | Factor D {Human (Homo sapiens) [TaxId: 9606]} | 95.8 | |
| d1a7sa_ | 225 | Heparin binding protein, HBP {Human (Homo sapiens) | 95.76 | |
| d2z7fe1 | 218 | Elastase {Human (Homo sapiens) [TaxId: 9606]} | 95.73 | |
| d1si5h_ | 234 | Hepatocyte growth factor, HGF {Human (Homo sapiens | 95.65 | |
| d1eq9a_ | 222 | (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So | 95.65 | |
| d1op0a_ | 234 | Venom serine protease {Hundred-pace snake (Agkistr | 95.64 | |
| d1hj8a_ | 222 | Trypsin(ogen) {North atlantic salmon (Salmo salar) | 95.44 | |
| d1fxya_ | 228 | Coagulation factor Xa-trypsin chimera {Synthetic, | 95.43 | |
| d1mzaa_ | 240 | Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | 95.33 | |
| d1fi8a_ | 227 | Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] | 95.27 | |
| d1orfa_ | 232 | Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | 95.2 | |
| d1ao5a_ | 237 | Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] | 95.19 | |
| d2hlca_ | 230 | HL collagenase {Common cattle grub (Hypoderma line | 95.15 | |
| g1gg6.1 | 238 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 95.0 | |
| d1gvza_ | 237 | Prostate specific antigen (PSA kallikrein) {Horse | 94.95 | |
| d1brup_ | 241 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 94.92 | |
| d1xx9a_ | 237 | Coagulation factor XI {Human (Homo sapiens) [TaxId | 94.79 | |
| d2bz6h1 | 254 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 94.79 | |
| d1t32a1 | 224 | Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | 94.77 | |
| d1npma_ | 225 | Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | 94.76 | |
| d1elva1 | 259 | Complement C1S protease, catalytic domain {Human ( | 94.71 | |
| g2pka.1 | 232 | Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} | 94.7 | |
| d1hj9a_ | 223 | Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | 94.68 | |
| d1elta_ | 236 | Elastase {Salmon (Salmo salar) [TaxId: 8030]} | 94.56 | |
| d2fpza1 | 243 | beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | 94.22 | |
| d1z8ga1 | 255 | Hepsin, catalytic domain {Human (Homo sapiens) [Ta | 94.1 | |
| g1rtf.1 | 260 | Two-chain tissue plasminogen activator (TC)-T-PA { | 94.07 | |
| d1fq3a_ | 227 | Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | 94.01 | |
| d1ekbb_ | 235 | Enteropeptidase (enterokinase light chain) {Cow (B | 93.98 | |
| d1arba_ | 263 | Achromobacter protease {Achromobacter lyticus, str | 93.8 | |
| d1pytd_ | 251 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 93.76 | |
| d1fona_ | 232 | Procarboxypeptidase A-S6 subunit III (zymogen E) { | 93.67 | |
| g1gj7.1 | 256 | Urokinase-type plasminogen activator (LMW U-PA), c | 93.66 | |
| d1autc_ | 240 | Activated protein c (autoprothrombin IIa) {Human ( | 93.32 | |
| d1rjxb_ | 247 | Plasmin(ogen), catalytic domain {Human (Homo sapie | 93.3 | |
| d1eaxa_ | 241 | Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 | 93.15 | |
| d1rrka1 | 287 | Factor B {Human (Homo sapiens) [TaxId: 9606]} | 93.09 | |
| d1tona_ | 235 | Tonin {Rat (Rattus rattus) [TaxId: 10117]} | 92.34 | |
| d1rfna_ | 235 | Coagulation factor IXa, protease domain {Human (Ho | 91.74 | |
| d1m9ua_ | 241 | Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | 91.55 | |
| d1l1na_ | 180 | 3C cysteine protease (picornain 3C) {Human poliovi | 90.88 | |
| d1sgfa_ | 228 | 7S NGF protease subunits {Mouse (Mus musculus) [Ta | 90.61 | |
| d1q3xa1 | 242 | Mannan-binding lectin serine protease 2 (MASP-2), | 90.33 | |
| d2f91a1 | 237 | Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus | 90.11 | |
| g1h8d.1 | 289 | Thrombin {Human (Homo sapiens) [TaxId: 9606]} | 89.48 | |
| d1gvkb_ | 240 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 86.95 | |
| d2p3ub1 | 233 | Coagulation factor Xa, protease domain {Human (Hom | 84.46 | |
| d1os8a_ | 223 | Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 | 84.19 | |
| d2h6ma1 | 212 | 3C cysteine protease (picornain 3C) {Human hepatit | 81.79 |
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Trypsin-like serine proteases superfamily: Trypsin-like serine proteases family: Prokaryotic proteases domain: Protease Do (DegP, HtrA), catalytic domain species: Escherichia coli [TaxId: 562]
Probab=99.95 E-value=5.4e-27 Score=243.09 Aligned_cols=172 Identities=20% Similarity=0.243 Sum_probs=139.4
Q ss_pred ceeEEEEEEEecCCceEEEEecceeccCCceEEEEEcCCCeEEeEEEEEEeCCCcEEEEEeCC-CCCCcccccceeeeee
Q 004068 315 HFFGTGVIIYHSQSMGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDP-SSLGVAGASVVRAAEL 393 (775)
Q Consensus 315 ~~~GSGvVId~~~~~GlVLTnr~~V~~~~~~I~Vt~~d~~~~~~A~Vv~~dp~~DlAILk~d~-~~l~~~~~~~v~~~~l 393 (775)
.+.||||+|+ .++||||||+| |+.++..+.|++.+ +..++|++++.|+.+|+|+|+++. +.+++ ++|
T Consensus 75 ~~~GSG~iI~--~~~g~IlTn~H-Vv~~~~~~~v~~~~-~~~~~a~~~~~d~~~dlavl~i~~~~~~~~--------~~l 142 (249)
T d1ky9a2 75 MALGSGVIID--ADKGYVVTNNH-VVDNATVIKVQLSD-GRKFDAKMVGKDPRSDIALIQIQNPKNLTA--------IKM 142 (249)
T ss_dssp EEEEEEEEEE--TTTTEEEEEHH-HHTTEEEEEEEETT-SCEEEEEEEEEETTTTEEEEEESSCCSCCC--------CCB
T ss_pred cccccEEEEe--ccCceEEeecc-ccccceeeeeeecc-cccccceeeEeccchhhceeeecccccceE--------EEc
Confidence 3579999999 35699999966 55788899999998 999999999999999999999974 45554 899
Q ss_pred CCCCCCCCCCEEEEEEeCCCCCCeeEEEEEeCCccccccCCCCcccccccceEEEEEeeccCCCC-CceEEccCceEEEE
Q 004068 394 LPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNISSADCPRYRAMNMEVIELDTDFGSTF-SGVLTDEHGRVQAI 472 (775)
Q Consensus 394 g~s~~l~~Gd~V~aiG~p~g~~~~~~~g~VS~~~~~~~~~~~~~pryra~n~e~I~~Da~i~~~~-GGpL~d~~G~VvGI 472 (775)
+++..++.||.|+++|+|+++..+.+.++++......... .....+||+|+++++|+ ||||+|.+|+||||
T Consensus 143 ~~~~~~~~G~~v~aiG~P~g~~~tvt~~~~~~~~~~~~~~--------~~~~~~iqtda~i~~GnSGGPl~n~~G~vIGI 214 (249)
T d1ky9a2 143 ADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNA--------ENYENFIQTDAAINRGNAGGALVNLNGELIGI 214 (249)
T ss_dssp CCGGGCCTTCEEEEEECTTSSSCEEEEEEEEEESSCC-------------CCCCEEESCCCTTSCCCSEEECTTSCEEEE
T ss_pred CCcCcCCcCCEEEEEecccccCCceeecceeecccccccC--------ccccceEEEeeeecCCCCCceEECCCCEEEEE
Confidence 9988899999999999999999999999888543111111 11246899999999997 99999999999999
Q ss_pred eeeecccccccCCCCCCceeeeccccchhhhHHHHHHcCC
Q 004068 473 WGSFSTQVKFGCSSSEDHQFVRGIPIYTISRVLDKIISGA 512 (775)
Q Consensus 473 ~~~~~~~~~~~~~~~~~~~f~~aIPi~~i~~vl~~l~~g~ 512 (775)
+++..... ....+.+| |||++.+++++++|++.|
T Consensus 215 ~t~~~~~~----~~~~gi~f--aIP~~~~~~~~~~l~~~G 248 (249)
T d1ky9a2 215 NTAILAPD----GGNIGIGF--AIPSNMVKNLTSQMVEYG 248 (249)
T ss_dssp EECSSTTS----CCCSSSEE--EEEHHHHHHHHHHHHHHS
T ss_pred EEEEeccC----CCcccEEE--EEEHHHHHHHHHHHHHhC
Confidence 98655431 12345554 999999999999998754
|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} | Back information, alignment and structure |
|---|
| >d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} | Back information, alignment and structure |
|---|
| >d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} | Back information, alignment and structure |
|---|
| >d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} | Back information, alignment and structure |
|---|
| >d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} | Back information, alignment and structure |
|---|
| >d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} | Back information, alignment and structure |
|---|
| >d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} | Back information, alignment and structure |
|---|
| >d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} | Back information, alignment and structure |
|---|
| >d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} | Back information, alignment and structure |
|---|
| >d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} | Back information, alignment and structure |
|---|
| >d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | Back information, alignment and structure |
|---|
| >d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} | Back information, alignment and structure |
|---|
| >d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} | Back information, alignment and structure |
|---|
| >d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2h6ma1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} | Back information, alignment and structure |
|---|