Citrus Sinensis ID: 004100


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770---
MRPPLEEFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDPYVEVKMGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQSSVLEVTVKDKDFVKDDFMGRVLFDLNEIPKRVPPDSPLAPQWYRLEDRKGDKVRGELMLAVWMGTQADEAFPEAWHSDAATVTGIEGLANIRSKVYLSPKLWYLRVNVIEAQDLQPTDKGRFPEVYVKAQLGNQALRTRVSASRTINPMWNEDLMFVAAEPFEEHLILTVEDRVAPNKDEVLGKCMIPLQYVDKRLDHKPVNTRWYNLEKHIVVEGEKKKDTKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGILNAQGLMPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSPTPKWNEQYTWEVFDPCTVITIGVFDNCHLHGGDKAGGARDSRIGKVRIRLSTLETDRVYTHSYPLLVLYPNGVKKMGEIHLAVRFTCSSLLNMMHMYSQPLLPKMHYLHPLTVSQLDSLRHQATQIVSMRLSRAEPPLRKEVVEYMLDVGSHMWSMRRSKANFFRIMGVLSGIIAVGKWFDQICNWKNPITTVLIHILFIILVLYPELILPTVFLYLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVALLTGFYVLRHPRFRHKLPSVPLNFFRRLPARTDCML
ccccccccccccccccccccccccccccccccccccccEEEEEEEEEccccccccccccccEEEEEEccEEEEEEEEccccccEEEEEEEEEEccccccEEEEEEEEcccccccEEEEEEEEcccccccccccccccccEEEcccccccEEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEcccccccccccccEEEEEEccEEEEEEcccccccccccccEEEEEEcccccccEEEEEEEccccccccEEEEEEEEcccccccccccccccEEEEccccccccccccccccEEEEEEEEEEEccccccccccccccccccccccccccccccEEEEEEEEEcccccccccccccccccEEEEEEccEEEEEEEcccccccccccEEEEEEEccccEEEEEEEEccccccccccccccccccEEEEEEccccccccEEEEEEEccccccccccccEEEEEEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHEEEEEcccccEEEEHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccEEHHHHHHHHHHHHHEEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccccccccccccccccccccccccc
ccccccccccEEccccccccccccccccccccccHcccEEEEEEEEcccccccccccccccEEEEEEccEEEEEEEEEccccccccEEEEEEcccccccEEEEEEEEccccccccEEEEEEEccccccccccccccccEEEEccccccccccEEEEEEEEEcccccccccHHHccccccccccccHHcccccccccccEEEEEEEEEEcccccccccccccccEEEEEEccEEEEEEEccccccccccccEEEEEEEcccccEEEEEEEEccccccccEEEEEEEEHHHccccccccccccHEccccccccccccccccccEccEEEEEEEcccccccccccccccccccccHHHccccccEEEEEEEEEccccccccccccccccccEEEEEEcccEEEEEEEcccccccccEEEEEEEEccccEEEEEEEEccccccccccccccccccEEEEEEccEcccccEEEEEEcHHHccccccccccEEEEEEEEccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEHHHHcccccHHcccccccHHHHHHccccccccc
mrppleefslketkphlgggkitgdkltsTYDLVEQMQYLYVRVVKakdlppkdvtgscdpyvevkmgnykgttrhfekktnpewnQVFAFSKDRIQSSVLEVtvkdkdfvkddfmGRVLFdlneipkrvppdsplapqwyrledrkgdkVRGELMLAVWMGtqadeafpeawhsdaatVTGIEGLANIrskvylspklwYLRVNVIeaqdlqptdkgrfpeVYVKAQLGNQALRTRvsasrtinpmwnedlmfvaaepfeehLILTvedrvapnkdevlgkcmiplqyvdkrldhkpvntrwynLEKHIVVEGEKKKDTKFASRIHMRICLEggyhvldesthyssdlrpTAKQLWKSSIGVLELGIlnaqglmpmktkdgrgttdaYCVAKYGqkwvrtrtiidsptpkwneqytwevfdpctvitigvfdnchlhggdkaggardsriGKVRIRLSTletdrvythsypllvlypngvkkmGEIHLAVRFTCSSLLNMMhmysqpllpkmhylhpltvsqldsLRHQATQIVSMRlsraepplrKEVVEYMLDVGSHMWSMRRSKANFFRIMGVLSGIIAVGKWFDQicnwknpiTTVLIHILFIILVLYPELILPTVFLYLFLIGVWyyrwrprhpphmdtrlshadsahpdeldeefdtfptsrpsdivRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVALLTGFyvlrhprfrhklpsvplnffrrlpartdcml
mrppleefslketkphlgggkitgdkLTSTYDLVEQMQYLYVRVVkakdlppkdvtgscdpyveVKMGNYKGTtrhfekktnpeWNQVFAfskdriqssvlevtvkdkdfvkddFMGRVLFdlneipkrvppdsplapqwyrledrkgDKVRGELMLAVWMGTQADEAFPEAWHSDAATVTGIEGLANIRSKVYLSPKLWYLRVNVIEaqdlqptdkgrfPEVYVKAqlgnqalrtrvsasrtiNPMWNEDLMFVAAEPFEEHLILTVedrvapnkdevLGKCMIplqyvdkrldhkpvntrwynlekhivvegekkkdtkfASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGILNAQGLMPMKTKDGRGTTDAYCVAkygqkwvrtrtiidsptpkwneqyTWEVFDPCTVITIGVFDNCHLHGgdkaggardsrigkVRIRlstletdrvythsyplLVLYPNGVKKMGEIHLAVRFTCSSLLNMMHMYSQPLLPKMHYLHPLTVSQLDSLRHQATQIVSmrlsraepplrkEVVEYMLDVGSHMWSMRRSKANFFRIMGVLSGIIAVGKWFDQICNWKNPITTVLIHILFIILVLYPELILPTVFLYLFLIGVWYYRWRPRHPPHMDTRLSHADSAHpdeldeefdtfptsrpsdivRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVALLTGFYVLRHprfrhklpsvplnffrrlpartdcml
MRPPLEEFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDPYVEVKMGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQSSVLEVTvkdkdfvkddfMGRVLFDLNEIPKRVPPDSPLAPQWYRLEDRKGDKVRGELMLAVWMGTQADEAFPEAWHSDAATVTGIEGLANIRSKVYLSPKLWYLRVNVIEAQDLQPTDKGRFPEVYVKAQLGNQALRTRVSASRTINPMWNEDLMFVAAEPFEEHLILTVEDRVAPNKDEVLGKCMIPLQYVDKRLDHKPVNTRWYNLEKHIVVEGEKKKDTKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGILNAQGLMPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSPTPKWNEQYTWEVFDPCTVITIGVFDNCHLHGGDKAGGARDSRIGKVRIRLSTLETDRVYTHSYPLLVLYPNGVKKMGEIHLAVRFTCSSLLNMMHMYSQPLLPKMHYLHPLTVSQLDSLRHQATQIVSMRLSRAEPPLRKEVVEYMLDVGSHMWSMRRSKANFFRIMGVLSGIIAVGKWFDQICNWKNPittvlihilfiilvlYPELILPTVFLYLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVALLTGFYVLRHPRFRHKLPSVPLNFFRRLPARTDCML
*********************ITGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDPYVEVKMGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQSSVLEVTVKDKDFVKDDFMGRVLFDLNEIPKR******LAPQWYRLEDRKGDKVRGELMLAVWMGTQADEAFPEAWHSDAATVTGIEGLANIRSKVYLSPKLWYLRVNVIEAQDLQPTDKGRFPEVYVKAQLGNQALRTRVSASRTINPMWNEDLMFVAAEPFEEHLILTVEDRVAPNKDEVLGKCMIPLQYVDKRLDHKPVNTRWYNLEKHIVVEGEKKKDTKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGILNAQGLMPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSPTPKWNEQYTWEVFDPCTVITIGVFDNCHLHGGDKAGGARDSRIGKVRIRLSTLETDRVYTHSYPLLVLYPNGVKKMGEIHLAVRFTCSSLLNMMHMYSQPLLPKMHYLHPLTVSQLDSLRHQATQIV*********************************ANFFRIMGVLSGIIAVGKWFDQICNWKNPITTVLIHILFIILVLYPELILPTVFLYLFLIGVWYYRWR************************************IVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVALLTGFYVLRHPRFRHKLPSVPLNFFRRL********
*R****************************YDLVEQMQYLYVRVVKAKDLPPKDVTGSCDPYVEVKMGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQSSVLEVTVKDKDFVKDDFMGRVLFDLNEIPKRVPPDSPLAPQWY**********RGELMLAVWMGTQADEAFPEAW*****************SKVYLSPKLWYLRVNVIEAQDLQPTDKGRFPEVYVKAQLGNQALRTRVSASRTINPMWNEDLMFVAAEPFEEHLILTVEDRVAPNKDEVLGKCMIPLQYVDKRLDHKPVNTRWYNLEKHIVV*GEKKKDTKFASRIHMRIC****************************SIGVLELGILNAQGL**********T*DAYCVAKYGQKWVRTRTIIDSPTPKWNEQYTWEVFDPCTVITIGVFDNCHLHGGDKAGGARDSRIGKVRIRLSTLETDRVYTHSYPLLVLYPN*V*KMGEIHLAVRFTCSSLLNMMHMYSQPLLPKMHYLHPLTV*******************************YMLDVGSHMWSMRRSKANFFRIMGVLSGIIAVGKWFDQICNWKNPITTVLIHILFIILVLYPELILPTVFLYLFLIGVWYYRWRPRH**************************************YDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVALLTGFYVLRHPRFRHKLPSVPLNFFRRLPARTDCML
MRPPLEEFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDPYVEVKMGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQSSVLEVTVKDKDFVKDDFMGRVLFDLNEIPKRVPPDSPLAPQWYRLEDRKGDKVRGELMLAVWMGTQADEAFPEAWHSDAATVTGIEGLANIRSKVYLSPKLWYLRVNVIEAQDLQPTDKGRFPEVYVKAQLGNQALRTRVSASRTINPMWNEDLMFVAAEPFEEHLILTVEDRVAPNKDEVLGKCMIPLQYVDKRLDHKPVNTRWYNLEKHIVVEGEKKKDTKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGILNAQGLMPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSPTPKWNEQYTWEVFDPCTVITIGVFDNCHLHGGDKAGGARDSRIGKVRIRLSTLETDRVYTHSYPLLVLYPNGVKKMGEIHLAVRFTCSSLLNMMHMYSQPLLPKMHYLHPLTVSQLDSLRHQATQIVSMRLSRAEPPLRKEVVEYMLDVGSHMWSMRRSKANFFRIMGVLSGIIAVGKWFDQICNWKNPITTVLIHILFIILVLYPELILPTVFLYLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVALLTGFYVLRHPRFRHKLPSVPLNFFRRLPARTDCML
******EFSLKETKPHLG*********TSTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDPYVEVKMGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQSSVLEVTVKDKDFVKDDFMGRVLFDLNEIPKRVPPDSPLAPQWYRLEDRKGDKVRGELMLAVWMGTQADEAFPEAWHSDAAT***IEGLANIRSKVYLSPKLWYLRVNVIEAQDLQPTDKGRFPEVYVKAQLGNQALRTRVSASRTINPMWNEDLMFVAAEPFEEHLILTVEDRVAPNKDEVLGKCMIPLQYVDKRLDHKPVNTRWYNLEKHIVVEGEKKKDTKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGILNAQGLMPMKT**GRGTTDAYCVAKYGQKWVRTRTIIDSPTPKWNEQYTWEVFDPCTVITIGVFDNCHLH*******ARDSRIGKVRIRLSTLETDRVYTHSYPLLVLYPNGVKKMGEIHLAVRFTCSSLLNMMHMYSQPLLPKMHYLHPLTVSQLDSLRHQATQIVSMRLSRAEPPLRKEVVEYMLDVGSHMWSMRRSKANFFRIMGVLSGIIAVGKWFDQICNWKNPITTVLIHILFIILVLYPELILPTVFLYLFLIGVWYYRWRPRHP**************PDELDEEFDTFPTSRPSDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVALLTGFYVLRHPRFRHKLPSVPLNFFRRLP*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRPPLEEFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDPYVEVKMGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQSSVLEVTVKDKDFVKDDFMGRVLFDLNEIPKRVPPDSPLAPQWYRLEDRKGDKVRGELMLAVWMGTQADEAFPEAWHSDAATVTGIEGLANIRSKVYLSPKLWYLRVNVIEAQDLQPTDKGRFPEVYVKAQLGNQALRTRVSASRTINPMWNEDLMFVAAEPFEEHLILTVEDRVAPNKDEVLGKCMIPLQYVDKRLDHKPVNTRWYNLEKHIVVEGEKKKDTKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGILNAQGLMPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSPTPKWNEQYTWEVFDPCTVITIGVFDNCHLHGGDKAGGARDSRIGKVRIRLSTLETDRVYTHSYPLLVLYPNGVKKMGEIHLAVRFTCSSLLNMMHMYSQPLLPKMHYLHPLTVSQLDSLRHQATQIVSMRLSRAEPPLRKEVVEYMLDVGSHMWSMRRSKANFFRIMGVLSGIIAVGKWFDQICNWKNPITTVLIHILFIILVLYPELILPTVFLYLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVALLTGFYVLRHPRFRHKLPSVPLNFFRRLPARTDCML
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query773 2.2.26 [Sep-21-2011]
Q6DN14999 Multiple C2 and transmemb no no 0.495 0.383 0.216 9e-17
Q5RJH2878 Multiple C2 and transmemb no no 0.507 0.446 0.224 1e-13
Q6DN12878 Multiple C2 and transmemb no no 0.510 0.449 0.222 3e-13
O43581403 Synaptotagmin-7 OS=Homo s no no 0.269 0.516 0.264 5e-13
Q9R0N7403 Synaptotagmin-7 OS=Mus mu no no 0.269 0.516 0.272 2e-12
P40748588 Synaptotagmin-3 OS=Rattus no no 0.280 0.369 0.294 2e-12
O35681587 Synaptotagmin-3 OS=Mus mu no no 0.278 0.366 0.295 2e-12
Q9BQG1590 Synaptotagmin-3 OS=Homo s no no 0.272 0.357 0.297 5e-12
P418851106 Rabphilin-1 OS=Caenorhabd no no 0.306 0.214 0.272 1e-11
Q9Y6V05065 Protein piccolo OS=Homo s no no 0.156 0.023 0.349 2e-11
>sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 Back     alignment and function desciption
 Score = 89.4 bits (220), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 102/471 (21%), Positives = 196/471 (41%), Gaps = 88/471 (18%)

Query: 37  MQYLYVRVVKAKDLPPKDVTGSCDPYVEVKMGNYK-GTTRHFEKKTNPEWNQVFAFSKDR 95
           M  L + + + + L  +D  G+ DPYV+ K+G  +   ++   K  NP W +      D 
Sbjct: 260 MYQLDITLRRGQSLAARDRGGTSDPYVKFKIGGKEVFRSKIIHKNLNPVWEEKACILVDH 319

Query: 96  IQSSVLEVTVKDKDF-VKDDFMGRVLFDLNEIPKRVPPDSPLAPQWYRLED-RKGDKVRG 153
           ++   L + V D DF ++DDFMG    DL ++    P D  L      L+D    D   G
Sbjct: 320 LREP-LYIKVFDYDFGLQDDFMGSAFLDLTQLELNRPTDVTLT-----LKDPHYPDHDLG 373

Query: 154 ELMLAVWMGTQADEA------FPEAWHSDAATVTGIEGLA---NIRSKVYLS------PK 198
            ++L+V +  +  E+        ++W   +  ++  E +    +++S  + +      P 
Sbjct: 374 IILLSVILTPKEGESRDVTMLMRKSWKRSSKELSENEVVGSYFSVKSLFWRTCGRPALPV 433

Query: 199 LWYLRVNV---------IEAQDLQPTD-----------------KGR---------FPEV 223
           L + R  +          + Q L+ +D                 +GR           + 
Sbjct: 434 LGFCRAELQNPYCKNVQFQTQSLRLSDLHRKSHLWRGIVSITLIEGRDLKAMDSNGLSDP 493

Query: 224 YVKAQLGNQALRTRVSASRTINPMWNEDLMFVAAEPFEEHLILTVEDRVAPNKDEVLGKC 283
           YVK +LG+Q  ++++   +T+NP W E   F   E     + +T  D+ A  +D+ +G+C
Sbjct: 494 YVKFRLGHQKYKSKI-MPKTLNPQWREQFDFHLYEERGGVIDITAWDKDAGKRDDFIGRC 552

Query: 284 MIPLQYVDKRLDHKPVNTRWYNLEKHIVVEGEKKKDTKFASRIHMRICLEGGYHVLDEST 343
            + L  + +   HK +  +    E H+V              + + +       + D S 
Sbjct: 553 QVDLSALSREQTHK-LELQLEEGEGHLV--------------LLVTLTASATVSISDLSV 597

Query: 344 HYSSDLRPTAKQLWKSS----------IGVLELGILNAQGLMPMKTKDGRGTTDAYCVAK 393
           +   D +   + L + S          +G L++ ++ A+GLM     D  G +D +CV +
Sbjct: 598 NSLEDQKEREEILKRYSPLRIFHNLKDVGFLQVKVIRAEGLM---AADVTGKSDPFCVVE 654

Query: 394 YGQKWVRTRTIIDSPTPKWNEQYTWEVFDPCTVITIGVFDNCHLHGGDKAG 444
                + T T+  +  P+WN+ +T+ + D  +V+ + V+D       D  G
Sbjct: 655 LNNDRLLTHTVYKNLNPEWNKVFTFNIKDIHSVLEVTVYDEDRDRSADFLG 705





Homo sapiens (taxid: 9606)
>sp|Q5RJH2|MCTP2_MOUSE Multiple C2 and transmembrane domain-containing protein 2 OS=Mus musculus GN=Mctp2 PE=2 SV=1 Back     alignment and function description
>sp|Q6DN12|MCTP2_HUMAN Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens GN=MCTP2 PE=1 SV=3 Back     alignment and function description
>sp|O43581|SYT7_HUMAN Synaptotagmin-7 OS=Homo sapiens GN=SYT7 PE=1 SV=3 Back     alignment and function description
>sp|Q9R0N7|SYT7_MOUSE Synaptotagmin-7 OS=Mus musculus GN=Syt7 PE=1 SV=1 Back     alignment and function description
>sp|P40748|SYT3_RAT Synaptotagmin-3 OS=Rattus norvegicus GN=Syt3 PE=1 SV=1 Back     alignment and function description
>sp|O35681|SYT3_MOUSE Synaptotagmin-3 OS=Mus musculus GN=Syt3 PE=1 SV=2 Back     alignment and function description
>sp|Q9BQG1|SYT3_HUMAN Synaptotagmin-3 OS=Homo sapiens GN=SYT3 PE=2 SV=1 Back     alignment and function description
>sp|P41885|RBF1_CAEEL Rabphilin-1 OS=Caenorhabditis elegans GN=rbf-1 PE=1 SV=2 Back     alignment and function description
>sp|Q9Y6V0|PCLO_HUMAN Protein piccolo OS=Homo sapiens GN=PCLO PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query773
449453842776 PREDICTED: uncharacterized protein LOC10 0.998 0.994 0.909 0.0
449437599774 PREDICTED: multiple C2 and transmembrane 0.998 0.997 0.928 0.0
15230882773 calcium-dependent lipid-binding domain-c 0.997 0.997 0.909 0.0
110739553773 anthranilate phosphoribosyltransferase-l 0.997 0.997 0.908 0.0
14030691773 AT3g57880/T10K17_90 [Arabidopsis thalian 0.997 0.997 0.908 0.0
357509865775 Anthranilate phosphoribosyltransferase-l 0.997 0.994 0.914 0.0
225441389777 PREDICTED: multiple C2 and transmembrane 0.998 0.993 0.907 0.0
356504837775 PREDICTED: multiple C2 and transmembrane 0.998 0.996 0.913 0.0
356572078775 PREDICTED: multiple C2 and transmembrane 0.998 0.996 0.910 0.0
224120414775 predicted protein [Populus trichocarpa] 0.998 0.996 0.901 0.0
>gi|449453842|ref|XP_004144665.1| PREDICTED: uncharacterized protein LOC101203090 isoform 1 [Cucumis sativus] gi|449453844|ref|XP_004144666.1| PREDICTED: uncharacterized protein LOC101203090 isoform 2 [Cucumis sativus] gi|449522819|ref|XP_004168423.1| PREDICTED: uncharacterized LOC101203090 [Cucumis sativus] Back     alignment and taxonomy information
 Score = 1491 bits (3859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 703/773 (90%), Positives = 751/773 (97%), Gaps = 1/773 (0%)

Query: 2   RPPLEEFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDP 61
           +PP E+F LKET PHLGGGK+ GDKL STYDLVEQM YLYVRVVKAKDLP KDVTGSCDP
Sbjct: 4   KPPPEDFLLKETNPHLGGGKVAGDKLASTYDLVEQMYYLYVRVVKAKDLPGKDVTGSCDP 63

Query: 62  YVEVKMGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQSSVLEVTVKDKDFVKDDFMGRVLF 121
           YVEVK+GNYKGTTRHFEKK+NPEWNQVFAFSKDRIQ+SVLEV+VKDKDFVKDDFMGRVLF
Sbjct: 64  YVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASVLEVSVKDKDFVKDDFMGRVLF 123

Query: 122 DLNEIPKRVPPDSPLAPQWYRLEDRKGDKVRGELMLAVWMGTQADEAFPEAWHSDAATVT 181
           DLNE+P+RVPPDSPLAPQWYRL+DRKGDKV+GELMLAVWMGTQADEAFPEAW+SDAATV+
Sbjct: 124 DLNEVPRRVPPDSPLAPQWYRLDDRKGDKVKGELMLAVWMGTQADEAFPEAWNSDAATVS 183

Query: 182 GIEGLANIRSKVYLSPKLWYLRVNVIEAQDLQPTDKGRFPEVYVKAQLGNQALRTRVSAS 241
           G +GLANIRSKVYLSPKLWYLRVN+IEAQDLQPTDKGR+PEV+VKA LGNQALRTR+S S
Sbjct: 184 GADGLANIRSKVYLSPKLWYLRVNIIEAQDLQPTDKGRYPEVFVKAILGNQALRTRISQS 243

Query: 242 RTINPMWNEDLMFVAAEPFEEHLILTVEDRVAPNKDEVLGKCMIPLQYVDKRLDHKPVNT 301
           RTINPMWNEDLMFVAAEPFEE LIL+VEDRVAPNKDEVLG+C I LQY+D+RLDH+ VNT
Sbjct: 244 RTINPMWNEDLMFVAAEPFEEPLILSVEDRVAPNKDEVLGRCAIQLQYIDRRLDHRAVNT 303

Query: 302 RWYNLEKHIVV-EGEKKKDTKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKSS 360
           RW+NLEKH+VV EGEKKK+ KF+SRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWK+S
Sbjct: 304 RWFNLEKHVVVVEGEKKKEIKFSSRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKNS 363

Query: 361 IGVLELGILNAQGLMPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSPTPKWNEQYTWEV 420
           IGVLELGILNAQGLMPMKTKDGRGTTDAYCVAKYGQKW+RTRTIIDS  PKWNEQYTWEV
Sbjct: 364 IGVLELGILNAQGLMPMKTKDGRGTTDAYCVAKYGQKWIRTRTIIDSFIPKWNEQYTWEV 423

Query: 421 FDPCTVITIGVFDNCHLHGGDKAGGARDSRIGKVRIRLSTLETDRVYTHSYPLLVLYPNG 480
           FDPCTVITIGVFDNCHLHGG+KAG ++D+RIGKVRIRLSTLETDRVYTHSYPLLVL+PNG
Sbjct: 424 FDPCTVITIGVFDNCHLHGGEKAGVSKDARIGKVRIRLSTLETDRVYTHSYPLLVLHPNG 483

Query: 481 VKKMGEIHLAVRFTCSSLLNMMHMYSQPLLPKMHYLHPLTVSQLDSLRHQATQIVSMRLS 540
           VKKMGEIHLAVRFTCSSLLNM+HMYS PLLPKMHY+HPLTVSQLDSLRHQATQIVSMRLS
Sbjct: 484 VKKMGEIHLAVRFTCSSLLNMLHMYSHPLLPKMHYIHPLTVSQLDSLRHQATQIVSMRLS 543

Query: 541 RAEPPLRKEVVEYMLDVGSHMWSMRRSKANFFRIMGVLSGIIAVGKWFDQICNWKNPITT 600
           RAEPPLRKEVVEYMLDVGSHMWSMRRSKANFFRIMGV SG+IAVGKWFDQICNW+NPITT
Sbjct: 544 RAEPPLRKEVVEYMLDVGSHMWSMRRSKANFFRIMGVFSGLIAVGKWFDQICNWRNPITT 603

Query: 601 VLIHILFIILVLYPELILPTVFLYLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDE 660
           VLIHILFIILV+YPELILPT+FLYLFLIGVW+YRWRPRHPPHMDTRLSHADS+HPDELDE
Sbjct: 604 VLIHILFIILVMYPELILPTIFLYLFLIGVWHYRWRPRHPPHMDTRLSHADSSHPDELDE 663

Query: 661 EFDTFPTSRPSDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIF 720
           EFDTFPTSRP+DIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRA+ALFVIF
Sbjct: 664 EFDTFPTSRPADIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRASALFVIF 723

Query: 721 CLIAAIVLYVTPFQVVALLTGFYVLRHPRFRHKLPSVPLNFFRRLPARTDCML 773
           CL++AIVLYVTPFQVVALL+G YVLRHPRFR+KLPSVPLNFFRRLPARTDCML
Sbjct: 724 CLVSAIVLYVTPFQVVALLSGIYVLRHPRFRYKLPSVPLNFFRRLPARTDCML 776




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449437599|ref|XP_004136579.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like [Cucumis sativus] gi|449501897|ref|XP_004161488.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15230882|ref|NP_191347.1| calcium-dependent lipid-binding domain-containing plant phosphoribosyltransferase-like protein [Arabidopsis thaliana] gi|6729531|emb|CAB67616.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis thaliana] gi|332646191|gb|AEE79712.1| calcium-dependent lipid-binding domain-containing plant phosphoribosyltransferase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110739553|dbj|BAF01685.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|14030691|gb|AAK53020.1|AF375436_1 AT3g57880/T10K17_90 [Arabidopsis thaliana] gi|21464555|gb|AAM52232.1| AT3g57880/T10K17_90 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357509865|ref|XP_003625221.1| Anthranilate phosphoribosyltransferase-like protein [Medicago truncatula] gi|124360660|gb|ABN08649.1| C2 [Medicago truncatula] gi|355500236|gb|AES81439.1| Anthranilate phosphoribosyltransferase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|225441389|ref|XP_002278165.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356504837|ref|XP_003521201.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like isoform 1 [Glycine max] gi|356504839|ref|XP_003521202.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356572078|ref|XP_003554197.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|224120414|ref|XP_002331042.1| predicted protein [Populus trichocarpa] gi|222872972|gb|EEF10103.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query773
TAIR|locus:2095853773 AT3G57880 "AT3G57880" [Arabido 0.997 0.997 0.878 0.0
TAIR|locus:2017627776 AT1G51570 [Arabidopsis thalian 0.998 0.994 0.848 0.0
TAIR|locus:2182305769 AT5G12970 "AT5G12970" [Arabido 0.984 0.989 0.788 0.0
TAIR|locus:21397271011 AT4G11610 "AT4G11610" [Arabido 0.987 0.754 0.670 8e-298
TAIR|locus:21627121036 AT5G48060 "AT5G48060" [Arabido 0.992 0.740 0.654 3.5e-288
TAIR|locus:20094921029 AT1G22610 "AT1G22610" [Arabido 0.992 0.745 0.641 5.9e-279
TAIR|locus:21271031006 AT4G00700 "AT4G00700" [Arabido 0.992 0.762 0.586 2.5e-255
TAIR|locus:20202801012 AT1G04150 "AT1G04150" [Arabido 0.968 0.740 0.588 8.6e-246
TAIR|locus:2119742774 AT4G20080 [Arabidopsis thalian 0.976 0.975 0.571 5.1e-241
TAIR|locus:2098846972 AT3G61300 "AT3G61300" [Arabido 0.968 0.770 0.569 4.6e-240
TAIR|locus:2095853 AT3G57880 "AT3G57880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3671 (1297.3 bits), Expect = 0., P = 0.
 Identities = 678/772 (87%), Positives = 723/772 (93%)

Query:     2 RPPLEEFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDP 61
             RPP E+FSLKET+PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKAK+LP KD+TGSCDP
Sbjct:     3 RPPPEDFSLKETRPHLGGGKLSGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSCDP 62

Query:    62 YVEVKMGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQSSVLEVTXXXXXXXXXXXMGRVLF 121
             YVEVK+GNYKGTTRHFEKK+NPEWNQVFAFSKDRIQ+S LE T           +GRV+F
Sbjct:    63 YVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDFVKDDLIGRVVF 122

Query:   122 DLNEIPKRVPPDSPLAPQWYRLEDRKGDKVRGELMLAVWMGTQADEAFPEAWHSDAATVT 181
             DLNE+PKRVPPDSPLAPQWYRLEDRKGDKV+GELMLAVW GTQADEAFPEAWHSDAATV+
Sbjct:   123 DLNEVPKRVPPDSPLAPQWYRLEDRKGDKVKGELMLAVWFGTQADEAFPEAWHSDAATVS 182

Query:   182 GIEGLANIRSKVYLSPKLWYLRVNVIEAQDLQPTDKGRFPEVYVKAQLGNQALRTRVSAS 241
             G + LANIRSKVYLSPKLWYLRVNVIEAQDL PTDK R+PEVYVKA +GNQALRTRVS S
Sbjct:   183 GTDALANIRSKVYLSPKLWYLRVNVIEAQDLIPTDKQRYPEVYVKAIVGNQALRTRVSQS 242

Query:   242 RTINPMWNEDLMFVAAEPFEEHLILTVEDRVAPNKDEVLGKCMIPLQYVDKRLDHKPVNT 301
             RTINPMWNEDLMFVAAEPFEE LIL+VEDRVAPNKDEVLG+C IPLQY+D+R DHKPVN+
Sbjct:   243 RTINPMWNEDLMFVAAEPFEEPLILSVEDRVAPNKDEVLGRCAIPLQYLDRRFDHKPVNS 302

Query:   302 RWYNLEKHIVVEGEKKKDTKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKSSI 361
             RWYNLEKHI+V+GEKK +TKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWK +I
Sbjct:   303 RWYNLEKHIMVDGEKK-ETKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKPNI 361

Query:   362 GVLELGILNAQGLMPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSPTPKWNEQYTWEVF 421
             GVLELGILNA GLMPMKTKDGRGTTDAYCVAKYGQKW+RTRTIIDS TP+WNEQYTWEVF
Sbjct:   362 GVLELGILNATGLMPMKTKDGRGTTDAYCVAKYGQKWIRTRTIIDSFTPRWNEQYTWEVF 421

Query:   422 DPCTVITIGVFDNCHLHGGDKAGGARDSRIGKVRIRLSTLETDRVYTHSYPLLVLYPNGV 481
             DPCTV+T+GVFDNCHLHGG+K GGA+DSRIGKVRIRLSTLETDRVYTHSYPLLVL+PNGV
Sbjct:   422 DPCTVVTVGVFDNCHLHGGEKIGGAKDSRIGKVRIRLSTLETDRVYTHSYPLLVLHPNGV 481

Query:   482 KKMGEIHLAVRFTCSSLLNMMHMYSQPLLPKMHYLHPLTVSQLDSLRHQATQIVSMRLSR 541
             KKMGEIHLAVRFTCSSLLNMM+MYSQPLLPKMHY+HPLTVSQLD+LRHQATQIVSMRL+R
Sbjct:   482 KKMGEIHLAVRFTCSSLLNMMYMYSQPLLPKMHYIHPLTVSQLDNLRHQATQIVSMRLTR 541

Query:   542 AEPPLRKEVVEYMLDVGSHMWSMRRSKANFFRIMGVLSGIIAVGKWFDQICNWKNPXXXX 601
             AEPPLRKEVVEYMLDVGSHMWSMRRSKANFFRIMGVLSG+IAVGKWF+QICNWKNP    
Sbjct:   542 AEPPLRKEVVEYMLDVGSHMWSMRRSKANFFRIMGVLSGLIAVGKWFEQICNWKNPITTV 601

Query:   602 XXXXXXXXXXXYPELILPTVFLYLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEE 661
                        YPELILPT+FLYLFLIG+WYYRWRPRHPPHMDTRLSHADSAHPDELDEE
Sbjct:   602 LIHLLFIILVLYPELILPTIFLYLFLIGIWYYRWRPRHPPHMDTRLSHADSAHPDELDEE 661

Query:   662 FDTFPTSRPSDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFC 721
             FDTFPTSRPSDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FC
Sbjct:   662 FDTFPTSRPSDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFC 721

Query:   722 LIAAIVLYVTPFQVVALLTGFYVLRHPRFRHKLPSVPLNFFRRLPARTDCML 773
             LIAA++LYVTPFQVVAL  G Y LRHPRFR+KLPSVPLNFFRRLPARTDCML
Sbjct:   722 LIAAVILYVTPFQVVALCIGIYALRHPRFRYKLPSVPLNFFRRLPARTDCML 773




GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0005618 "cell wall" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
TAIR|locus:2017627 AT1G51570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182305 AT5G12970 "AT5G12970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139727 AT4G11610 "AT4G11610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162712 AT5G48060 "AT5G48060" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009492 AT1G22610 "AT1G22610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2127103 AT4G00700 "AT4G00700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020280 AT1G04150 "AT1G04150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119742 AT4G20080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098846 AT3G61300 "AT3G61300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query773
pfam08372156 pfam08372, PRT_C, Plant phosphoribosyltransferase 1e-114
cd04019150 cd04019, C2C_MCTP_PRT_plant, C2 domain third repea 1e-89
cd08378121 cd08378, C2B_MCTP_PRT_plant, C2 domain second repe 2e-71
cd08379126 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repe 2e-65
cd00030102 cd00030, C2, C2 domain 3e-24
pfam0016885 pfam00168, C2, C2 domain 6e-24
smart00239101 smart00239, C2, Protein kinase C conserved region 1e-23
pfam0016885 pfam00168, C2, C2 domain 5e-21
cd08377119 cd08377, C2C_MCTP_PRT, C2 domain third repeat foun 5e-20
cd04036119 cd04036, C2_cPLA2, C2 domain present in cytosolic 2e-18
cd00030102 cd00030, C2, C2 domain 3e-18
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 1e-17
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 2e-17
cd04031125 cd04031, C2A_RIM1alpha, C2 domain first repeat con 1e-16
smart00239101 smart00239, C2, Protein kinase C conserved region 3e-16
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 9e-16
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 2e-15
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 5e-15
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 1e-14
cd08675137 cd08675, C2B_RasGAP, C2 domain second repeat of Ra 3e-14
pfam0016885 pfam00168, C2, C2 domain 6e-14
cd08386125 cd08386, C2A_Synaptotagmin-7, C2A domain first rep 1e-13
cd00030102 cd00030, C2, C2 domain 2e-13
cd04037124 cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer 2e-13
cd08688110 cd08688, C2_KIAA0528-like, C2 domain found in the 3e-13
cd04030127 cd04030, C2C_KIAA1228, C2 domain third repeat pres 4e-13
cd04031125 cd04031, C2A_RIM1alpha, C2 domain first repeat con 7e-13
cd08375136 cd08375, C2_Intersectin, C2 domain present in Inte 9e-13
smart00239101 smart00239, C2, Protein kinase C conserved region 2e-12
cd04026131 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein 2e-12
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 3e-12
cd04017135 cd04017, C2D_Ferlin, C2 domain fourth repeat in Fe 4e-12
cd04009133 cd04009, C2B_Munc13-like, C2 domain second repeat 4e-12
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 7e-12
cd04027127 cd04027, C2B_Munc13, C2 domain second repeat in Mu 1e-11
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 3e-11
cd04035123 cd04035, C2A_Rabphilin_Doc2, C2 domain first repea 3e-11
cd04033133 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the 5e-11
cd08385124 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain 6e-11
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 8e-11
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 2e-10
cd08681118 cd08681, C2_fungal_Inn1p-like, C2 domain found in 2e-10
cd08676153 cd08676, C2A_Munc13-like, C2 domain first repeat i 3e-10
cd08405136 cd08405, C2B_Synaptotagmin-7, C2 domain second rep 4e-10
cd08377119 cd08377, C2C_MCTP_PRT, C2 domain third repeat foun 5e-10
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 8e-10
cd04046126 cd04046, C2_Calpain, C2 domain present in Calpain 1e-09
cd08390123 cd08390, C2A_Synaptotagmin-15-17, C2A domain first 2e-09
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 2e-09
cd08404136 cd08404, C2B_Synaptotagmin-4, C2 domain second rep 2e-09
cd04043126 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma 3e-09
cd08682126 cd08682, C2_Rab11-FIP_classI, C2 domain found in R 3e-09
cd08384133 cd08384, C2B_Rabphilin_Doc2, C2 domain second repe 5e-09
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 8e-09
cd08387124 cd08387, C2A_Synaptotagmin-8, C2A domain first rep 1e-08
cd08402136 cd08402, C2B_Synaptotagmin-1, C2 domain second rep 2e-08
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 3e-08
cd04019150 cd04019, C2C_MCTP_PRT_plant, C2 domain third repea 4e-08
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 5e-08
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 8e-08
cd08378121 cd08378, C2B_MCTP_PRT_plant, C2 domain second repe 1e-07
cd08682126 cd08682, C2_Rab11-FIP_classI, C2 domain found in R 1e-07
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 2e-07
cd08375136 cd08375, C2_Intersectin, C2 domain present in Inte 2e-07
cd04050105 cd04050, C2B_Synaptotagmin-like, C2 domain second 2e-07
cd04020162 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat 2e-07
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 2e-07
cd08388128 cd08388, C2A_Synaptotagmin-4-11, C2A domain first 2e-07
cd04051125 cd04051, C2_SRC2_like, C2 domain present in Soybea 3e-07
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 4e-07
cd04018151 cd04018, C2C_Ferlin, C2 domain third repeat in Fer 6e-07
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 7e-07
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 9e-07
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 1e-06
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 1e-06
cd08402136 cd08402, C2B_Synaptotagmin-1, C2 domain second rep 2e-06
cd04051125 cd04051, C2_SRC2_like, C2 domain present in Soybea 2e-06
cd04010148 cd04010, C2B_RasA3, C2 domain second repeat presen 2e-06
cd08521123 cd08521, C2A_SLP, C2 domain first repeat present i 2e-06
cd04041111 cd04041, C2A_fungal, C2 domain first repeat; funga 2e-06
cd08381122 cd08381, C2B_PI3K_class_II, C2 domain second repea 2e-06
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 3e-06
cd04050105 cd04050, C2B_Synaptotagmin-like, C2 domain second 3e-06
cd04054121 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat 3e-06
cd08383117 cd08383, C2A_RasGAP, C2 domain (first repeat) of R 4e-06
cd08379126 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repe 5e-06
cd04027127 cd04027, C2B_Munc13, C2 domain second repeat in Mu 5e-06
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 5e-06
cd04052111 cd04052, C2B_Tricalbin-like, C2 domain second repe 5e-06
cd04017135 cd04017, C2D_Ferlin, C2 domain fourth repeat in Fe 6e-06
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 6e-06
cd08379126 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repe 8e-06
cd04035123 cd04035, C2A_Rabphilin_Doc2, C2 domain first repea 8e-06
cd08377119 cd08377, C2C_MCTP_PRT, C2 domain third repeat foun 1e-05
cd04037124 cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer 1e-05
cd04027127 cd04027, C2B_Munc13, C2 domain second repeat in Mu 1e-05
cd08401121 cd08401, C2A_RasA2_RasA3, C2 domain first repeat p 1e-05
cd04043126 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma 2e-05
cd08403134 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s 2e-05
cd00275128 cd00275, C2_PLC_like, C2 domain present in Phospho 4e-05
cd04011111 cd04011, C2B_Ferlin, C2 domain second repeat in Fe 4e-05
cd04014132 cd04014, C2_PKC_epsilon, C2 domain in Protein Kina 9e-05
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 1e-04
cd04046126 cd04046, C2_Calpain, C2 domain present in Calpain 1e-04
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 1e-04
cd08384133 cd08384, C2B_Rabphilin_Doc2, C2 domain second repe 1e-04
pfam06398 360 pfam06398, Pex24p, Integral peroxisomal membrane p 1e-04
cd04045120 cd04045, C2C_Tricalbin-like, C2 domain third repea 1e-04
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 2e-04
cd04011111 cd04011, C2B_Ferlin, C2 domain second repeat in Fe 2e-04
cd04045120 cd04045, C2C_Tricalbin-like, C2 domain third repea 2e-04
cd04032127 cd04032, C2_Perforin, C2 domain of Perforin 2e-04
cd08405136 cd08405, C2B_Synaptotagmin-7, C2 domain second rep 3e-04
cd08373127 cd08373, C2A_Ferlin, C2 domain first repeat in Fer 3e-04
cd08400126 cd08400, C2_Ras_p21A1, C2 domain present in RAS p2 3e-04
cd08675137 cd08675, C2B_RasGAP, C2 domain second repeat of Ra 4e-04
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 4e-04
cd04019150 cd04019, C2C_MCTP_PRT_plant, C2 domain third repea 5e-04
cd08394127 cd08394, C2A_Munc13, C2 domain first repeat in Mun 5e-04
cd08383117 cd08383, C2A_RasGAP, C2 domain (first repeat) of R 9e-04
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 0.001
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 0.001
cd04054121 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat 0.001
cd08375136 cd08375, C2_Intersectin, C2 domain present in Inte 0.002
cd08387124 cd08387, C2A_Synaptotagmin-8, C2A domain first rep 0.002
cd08407138 cd08407, C2B_Synaptotagmin-13, C2 domain second re 0.002
cd04048120 cd04048, C2A_Copine, C2 domain first repeat in Cop 0.002
cd04015158 cd04015, C2_plant_PLD, C2 domain present in plant 0.003
cd04039108 cd04039, C2_PSD, C2 domain present in Phosphatidyl 0.003
cd04009133 cd04009, C2B_Munc13-like, C2 domain second repeat 0.004
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 0.004
COG5038 1227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 0.004
>gnl|CDD|192017 pfam08372, PRT_C, Plant phosphoribosyltransferase C-terminal Back     alignment and domain information
 Score =  341 bits (876), Expect = e-114
 Identities = 131/156 (83%), Positives = 149/156 (95%)

Query: 618 LPTVFLYLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMR 677
           LPT+FLYLF+IG+W YR+RPRHPPHMDTRLSHAD+AHPDELDEEFDTFPTSRP D+VRMR
Sbjct: 1   LPTIFLYLFVIGLWNYRFRPRHPPHMDTRLSHADAAHPDELDEEFDTFPTSRPPDVVRMR 60

Query: 678 YDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVA 737
           YDRLRS+AGR+QTVVGD+ATQGERLQ+LLSWRDPRATA+FV+FCL+AA+VLYV PF+VVA
Sbjct: 61  YDRLRSVAGRVQTVVGDIATQGERLQALLSWRDPRATAIFVLFCLVAAVVLYVVPFKVVA 120

Query: 738 LLTGFYVLRHPRFRHKLPSVPLNFFRRLPARTDCML 773
           LL GFY LRHPRFR ++PSVPLNFFRRLP+RTD ML
Sbjct: 121 LLAGFYYLRHPRFRSRMPSVPLNFFRRLPSRTDSML 156


This domain is found at the C-terminus of phosphoribosyltransferases and phosphoribosyltransferase-like proteins. It contains putative transmembrane regions. It often appears together with calcium-ion dependent C2 domains (pfam00168). Length = 156

>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176025 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins Back     alignment and domain information
>gnl|CDD|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin Back     alignment and domain information
>gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175985 cd04018, C2C_Ferlin, C2 domain third repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>gnl|CDD|175977 cd04010, C2B_RasA3, C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176006 cd04041, C2A_fungal, C2 domain first repeat; fungal group Back     alignment and domain information
>gnl|CDD|176027 cd08381, C2B_PI3K_class_II, C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176018 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|176029 cd08383, C2A_RasGAP, C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|176025 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176025 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|176046 cd08401, C2A_RasA2_RasA3, C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175981 cd04014, C2_PKC_epsilon, C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|219008 pfam06398, Pex24p, Integral peroxisomal membrane peroxin Back     alignment and domain information
>gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175998 cd04032, C2_Perforin, C2 domain of Perforin Back     alignment and domain information
>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176045 cd08400, C2_Ras_p21A1, C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176040 cd08394, C2A_Munc13, C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|176029 cd08383, C2A_RasGAP, C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|176018 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin Back     alignment and domain information
>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>gnl|CDD|176052 cd08407, C2B_Synaptotagmin-13, C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>gnl|CDD|176013 cd04048, C2A_Copine, C2 domain first repeat in Copine Back     alignment and domain information
>gnl|CDD|175982 cd04015, C2_plant_PLD, C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>gnl|CDD|176004 cd04039, C2_PSD, C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 773
PF08372156 PRT_C: Plant phosphoribosyltransferase C-terminal; 100.0
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 99.96
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.96
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.94
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 99.94
KOG13261105 consensus Membrane-associated protein FER-1 and re 99.89
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.89
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.88
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 99.88
KOG2059800 consensus Ras GTPase-activating protein [Signal tr 99.88
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.86
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.86
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.85
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.83
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.83
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.82
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.82
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.82
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.81
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.8
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.8
PF04842683 DUF639: Plant protein of unknown function (DUF639) 99.8
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.8
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.8
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.8
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.79
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.79
PF11696 642 DUF3292: Protein of unknown function (DUF3292); In 99.79
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.79
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.79
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.79
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.78
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.77
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.77
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.77
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.77
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.77
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.77
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.77
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.77
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.77
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.76
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.76
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.76
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.76
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.76
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.75
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.75
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.75
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.75
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.75
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.75
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.75
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.75
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.74
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.74
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.74
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.74
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.74
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.74
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.74
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.74
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.74
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.74
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.74
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.73
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.73
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.73
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.73
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.73
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.73
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.73
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.73
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.73
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.72
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.72
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.72
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.72
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.72
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.71
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.71
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.71
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.71
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.71
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.71
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.71
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.71
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.71
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.7
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.7
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.7
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.7
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.7
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.7
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.7
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.7
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.7
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.7
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.7
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.69
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.69
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.69
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.69
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.69
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.69
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.68
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.68
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.68
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.68
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.68
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.68
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.68
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.68
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.67
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.67
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.67
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.67
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.67
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.67
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.67
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.67
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.66
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.66
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.66
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.65
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.65
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.65
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.65
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.65
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.65
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.64
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.64
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.64
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.64
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.64
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.64
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.64
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.64
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.64
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.63
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.63
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.63
PLN03008 868 Phospholipase D delta 99.63
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.62
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.62
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.62
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.62
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.62
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.61
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.61
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.61
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.61
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.61
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.61
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.61
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.6
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.6
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.6
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.6
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.6
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.59
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.59
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.59
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.59
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.59
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.59
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.58
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.58
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.58
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.58
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.58
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.58
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.58
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 99.57
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.57
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.57
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.56
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.56
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.56
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.56
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.56
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.55
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.55
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.55
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.55
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.54
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.53
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.53
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.52
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.51
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.51
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.51
PLN03008868 Phospholipase D delta 99.5
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.5
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.5
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.49
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.45
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.41
PF06398 359 Pex24p: Integral peroxisomal membrane peroxin; Int 99.4
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.39
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.39
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 99.38
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 99.35
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.3
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 99.29
PLN02270 808 phospholipase D alpha 99.29
KOG13261105 consensus Membrane-associated protein FER-1 and re 99.26
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.18
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.17
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.17
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.15
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.13
PLN02223537 phosphoinositide phospholipase C 99.13
PLN02270808 phospholipase D alpha 99.07
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.06
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 99.04
PLN02952599 phosphoinositide phospholipase C 99.02
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 99.02
PLN02223537 phosphoinositide phospholipase C 99.0
KOG1327529 consensus Copine [Signal transduction mechanisms] 98.96
PLN02230598 phosphoinositide phospholipase C 4 98.95
PLN02952599 phosphoinositide phospholipase C 98.95
PLN02222581 phosphoinositide phospholipase C 2 98.91
PLN02228567 Phosphoinositide phospholipase C 98.88
KOG0169746 consensus Phosphoinositide-specific phospholipase 98.82
PLN02230598 phosphoinositide phospholipase C 4 98.81
PLN02228567 Phosphoinositide phospholipase C 98.79
PLN02222581 phosphoinositide phospholipase C 2 98.78
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 98.76
KOG0169746 consensus Phosphoinositide-specific phospholipase 98.75
KOG1328 1103 consensus Synaptic vesicle protein BAIAP3, involve 98.73
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 98.71
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.64
KOG13281103 consensus Synaptic vesicle protein BAIAP3, involve 98.63
PLN02352 758 phospholipase D epsilon 98.59
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 98.58
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.58
KOG1327529 consensus Copine [Signal transduction mechanisms] 98.56
PLN02352758 phospholipase D epsilon 98.48
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 98.46
PF12416340 DUF3668: Cep120 protein; InterPro: IPR022136 This 98.42
PF08372156 PRT_C: Plant phosphoribosyltransferase C-terminal; 98.41
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 98.31
PF12416340 DUF3668: Cep120 protein; InterPro: IPR022136 This 98.11
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 97.79
PLN02964 644 phosphatidylserine decarboxylase 97.71
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 97.66
PLN02964644 phosphatidylserine decarboxylase 97.65
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 97.41
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 97.26
KOG3837523 consensus Uncharacterized conserved protein, conta 97.13
KOG3837523 consensus Uncharacterized conserved protein, conta 97.07
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 97.03
PF15627156 CEP76-C2: CEP76 C2 domain 96.56
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 95.99
PF15627156 CEP76-C2: CEP76 C2 domain 95.95
KOG12651189 consensus Phospholipase C [Lipid transport and met 95.8
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 95.67
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 95.33
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 95.03
cd08397159 C2_PI3K_class_III C2 domain present in class III p 94.54
KOG12651189 consensus Phospholipase C [Lipid transport and met 94.52
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 94.41
PF02453169 Reticulon: Reticulon; InterPro: IPR003388 Eukaryot 94.19
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 94.16
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 93.94
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 93.26
cd08397159 C2_PI3K_class_III C2 domain present in class III p 93.17
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 92.59
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 91.65
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 91.61
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 91.48
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 90.98
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 90.97
KOG1452442 consensus Predicted Rho GTPase-activating protein 90.57
KOG1329 887 consensus Phospholipase D1 [Lipid transport and me 88.4
cd08694196 C2_Dock-A C2 domains found in Dedicator Of CytoKin 87.61
PF0815172 FerI: FerI (NUC094) domain; InterPro: IPR012968 Th 87.17
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 87.11
KOG1452442 consensus Predicted Rho GTPase-activating protein 86.86
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 86.42
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 86.12
PF15625168 CC2D2AN-C2: CC2D2A N-terminal C2 domain 84.18
cd08695189 C2_Dock-B C2 domains found in Dedicator Of CytoKin 83.51
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 83.26
PF11618107 DUF3250: Protein of unknown function (DUF3250); In 83.12
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 81.87
PF11618107 DUF3250: Protein of unknown function (DUF3250); In 81.68
>PF08372 PRT_C: Plant phosphoribosyltransferase C-terminal; InterPro: IPR013583 This domain is found at the C terminus of phosphoribosyltransferases and phosphoribosyltransferase-like proteins Back     alignment and domain information
Probab=100.00  E-value=4.8e-41  Score=304.75  Aligned_cols=156  Identities=79%  Similarity=1.402  Sum_probs=153.1

Q ss_pred             HHHHHHHHHHHHhhccccCCCCCCCCCCCcCCCCCCCCCCCCCCCCCCCCCCChhhHHHHHHHHHHHHHHHHHHHHHHHh
Q 004100          618 LPTVFLYLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRSIAGRIQTVVGDLAT  697 (773)
Q Consensus       618 ~p~~~l~l~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~l~~~~~~vQ~~l~~~a~  697 (773)
                      +|+++++++++++|+|+++|+.|+|+|.++|+.+.+++||+|||+|..|++++.+.+++||+++++++++|||.||++|+
T Consensus         1 lp~~~l~~~~~~~w~yr~rpr~p~~~d~~ls~~~~~~~deldEEfD~~ps~~~~~~lr~Rydrlr~va~rvQ~vlgd~At   80 (156)
T PF08372_consen    1 LPTVFLYLFLIGLWNYRFRPRHPPHMDTKLSHADSAHPDELDEEFDTFPSSRPPDSLRMRYDRLRSVAGRVQNVLGDVAT   80 (156)
T ss_pred             CchHHHHHHHHHHhccccCCCCCCCCCccccccccCCcchhhhhhcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            48899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhccCCChhhHHHHHHHHHHHHHHHhhhhhhHHHhhhhhhhccCCccCCCCCCchhhhhhcCCCCccCCC
Q 004100          698 QGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVALLTGFYVLRHPRFRHKLPSVPLNFFRRLPARTDCML  773 (773)
Q Consensus       698 ~~e~~~nl~~w~~p~~t~~~~~~l~~~~~~~~~vP~r~i~l~~g~~~~~~P~~r~~~~~~~~~~~~r~ps~~~~~~  773 (773)
                      ++||++|+++|+||.+|.+++++|+++++++|++|+|+++++||+|++|||++|.++|+.+.|||+||||++|+||
T Consensus        81 ~gERl~allsWrdP~aT~lf~~~clv~avvly~vP~r~l~l~~gly~~r~P~~R~~~P~~~~nff~RlPs~~d~~l  156 (156)
T PF08372_consen   81 QGERLQALLSWRDPRATALFVVFCLVAAVVLYFVPFRVLVLIWGLYKLRHPRFRNPLPSPPLNFFRRLPSRSDSML  156 (156)
T ss_pred             HHHHHHHhhccCCccHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHhcCccccCCCCcHHHHHHHHCCCchhhcC
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999986



It contains putative transmembrane regions. It often appears together with calcium-ion dependent C2 domains (IPR000008 from INTERPRO).

>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>PF04842 DUF639: Plant protein of unknown function (DUF639); InterPro: IPR006927 The sequences in this family are plant proteins of unknown function Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF11696 DUF3292: Protein of unknown function (DUF3292); InterPro: IPR021709 This eukaryotic family of proteins has no known function Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>PF06398 Pex24p: Integral peroxisomal membrane peroxin; InterPro: IPR010482 Peroxisomes play diverse roles in the cell, compartmentalising many activities related to lipid metabolism and functioning in the decomposition of toxic hydrogen peroxide Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>PF08372 PRT_C: Plant phosphoribosyltransferase C-terminal; InterPro: IPR013583 This domain is found at the C terminus of phosphoribosyltransferases and phosphoribosyltransferase-like proteins Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>PF02453 Reticulon: Reticulon; InterPro: IPR003388 Eukaryotic proteins of the reticulon (RTN) family all share an association with the endoplasmic reticulum (ER) Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1329 consensus Phospholipase D1 [Lipid transport and metabolism] Back     alignment and domain information
>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins Back     alignment and domain information
>PF08151 FerI: FerI (NUC094) domain; InterPro: IPR012968 The ferlin gene family are characterised by multiple tandem C2 domains and a C-terminal transmembrane domain Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>PF15625 CC2D2AN-C2: CC2D2A N-terminal C2 domain Back     alignment and domain information
>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>PF11618 DUF3250: Protein of unknown function (DUF3250); InterPro: IPR021656 This family of proteins represents a protein with unknown function Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>PF11618 DUF3250: Protein of unknown function (DUF3250); InterPro: IPR021656 This family of proteins represents a protein with unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query773
3hn8_A296 Crystal Structure Of Synaptotagmin Length = 296 1e-10
1dqv_A296 Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt 1e-10
2ep6_A133 Solution Structure Of The Second C2 Domain From Hum 8e-08
2ep6_A133 Solution Structure Of The Second C2 Domain From Hum 3e-05
1rh8_A142 Three-Dimensional Structure Of The Calcium-Free Pic 1e-06
2r83_A284 Crystal Structure Analysis Of Human Synaptotagmin 1 2e-06
3kwt_A148 Munc13-1 C2b-Domain, Calcium-Free Length = 148 4e-06
3kwt_A148 Munc13-1 C2b-Domain, Calcium-Free Length = 148 3e-04
3jzy_A510 Crystal Structure Of Human Intersectin 2 C2 Domain 9e-06
2d8k_A141 Solution Structure Of The First C2 Domain Of Synapt 5e-05
1rlw_A126 Calcium-Phospholipid Binding Domain From Cytosolic 8e-05
1cjy_A749 Human Cytosolic Phospholipase A2 Length = 749 1e-04
1bci_A138 C2 Domain Of Cytosolic Phospholipase A2, Nmr, Minim 2e-04
1v27_A141 Solution Structure Of The First C2 Domain Of Rim2 L 7e-04
>pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 Back     alignment and structure

Iteration: 1

Score = 65.5 bits (158), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 76/275 (27%), Positives = 117/275 (42%), Gaps = 58/275 (21%) Query: 37 MQYLY------VRVVKAKDLPPKDVTGSCDPYVEVKM---GNYKGTTRHFEKKTNPEWNQ 87 ++YLY VR+++A DLP KD G DPYV++ + K T+ K NP +N+ Sbjct: 14 LRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPIFNE 73 Query: 88 VFAFS---KDRIQSSVLEVTXXXXXXXXXXXMGRVLFD-LNEIPKRVPPDSPLAPQWYRL 143 F FS + Q + +G+V+ D L E+ ++ PPD PL W + Sbjct: 74 TFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQ-PPDRPL---WRDI 129 Query: 144 EDRKGDKVR-GELMLAVWMGTQADEAFPEAWHSDAATVTGIEGLANIRSKVYLSPKLWYL 202 + +K GEL ++ YL P L Sbjct: 130 LEGGSEKADLGELNFSL---------------------------------CYL-PTAGLL 155 Query: 203 RVNVIEAQDLQPTDKGRFPEVYVKAQLGNQALRTRVSAS----RTINPMWNEDLMF-VAA 257 V +I+A +L+ D F + YVKA L ++ R + + T+NP +NE L+F VA Sbjct: 156 TVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAP 215 Query: 258 EPFEE-HLILTVEDRVAPNKDEVLGKCMIPLQYVD 291 E E L + V D +EV+G C + + D Sbjct: 216 ESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAAD 250
>pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 Back     alignment and structure
>pdb|2EP6|A Chain A, Solution Structure Of The Second C2 Domain From Human Mctp2 Protein Length = 133 Back     alignment and structure
>pdb|2EP6|A Chain A, Solution Structure Of The Second C2 Domain From Human Mctp2 Protein Length = 133 Back     alignment and structure
>pdb|1RH8|A Chain A, Three-Dimensional Structure Of The Calcium-Free Piccolo C2a- Domain Length = 142 Back     alignment and structure
>pdb|2R83|A Chain A, Crystal Structure Analysis Of Human Synaptotagmin 1 C2a-c2b Length = 284 Back     alignment and structure
>pdb|3KWT|A Chain A, Munc13-1 C2b-Domain, Calcium-Free Length = 148 Back     alignment and structure
>pdb|3KWT|A Chain A, Munc13-1 C2b-Domain, Calcium-Free Length = 148 Back     alignment and structure
>pdb|3JZY|A Chain A, Crystal Structure Of Human Intersectin 2 C2 Domain Length = 510 Back     alignment and structure
>pdb|2D8K|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Vii Length = 141 Back     alignment and structure
>pdb|1RLW|A Chain A, Calcium-Phospholipid Binding Domain From Cytosolic Phospholipase A2 Length = 126 Back     alignment and structure
>pdb|1CJY|A Chain A, Human Cytosolic Phospholipase A2 Length = 749 Back     alignment and structure
>pdb|1BCI|A Chain A, C2 Domain Of Cytosolic Phospholipase A2, Nmr, Minimized Average Structure Length = 138 Back     alignment and structure
>pdb|1V27|A Chain A, Solution Structure Of The First C2 Domain Of Rim2 Length = 141 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query773
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 1e-50
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 1e-19
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 3e-19
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 5e-43
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 6e-17
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 6e-14
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 4e-40
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 8e-18
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 1e-17
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 5e-40
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 2e-15
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 2e-13
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 1e-39
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 3e-21
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 7e-20
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 1e-38
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 1e-12
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 3e-37
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 3e-19
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 3e-18
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 4e-36
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 5e-18
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 3e-35
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 7e-12
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 7e-34
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 5e-16
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 3e-15
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 1e-30
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 3e-20
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 2e-17
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 7e-30
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 4e-18
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 1e-12
1cjy_A749 CPLA2, protein (cytosolic phospholipase A2); lipid 3e-29
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 2e-11
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 1e-06
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 1e-25
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 4e-13
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 8e-06
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 3e-25
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 6e-20
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 2e-15
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 5e-25
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 5e-15
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 2e-08
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 4e-24
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 1e-14
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 6e-09
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 5e-24
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 2e-15
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 7e-07
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 7e-24
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 4e-15
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 6e-06
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 8e-24
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 1e-13
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 4e-06
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 9e-24
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 5e-14
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 3e-06
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 1e-23
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 1e-22
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 3e-15
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 7e-23
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 6e-16
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 2e-05
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 2e-22
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 1e-10
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 3e-04
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 2e-22
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 2e-13
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 7e-07
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 2e-22
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 5e-13
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 1e-10
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 4e-22
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 8e-13
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 1e-04
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 1e-21
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 6e-14
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 1e-21
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 1e-14
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 2e-21
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 4e-14
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 4e-21
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 2e-10
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 7e-21
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 1e-13
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 3e-20
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 3e-10
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 1e-05
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 3e-20
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 9e-12
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 8e-05
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 3e-20
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 3e-11
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 2e-04
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 4e-20
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 4e-10
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 6e-20
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 2e-10
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 2e-04
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 3e-17
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 2e-10
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 3e-06
3nsj_A540 Perforin-1; pore forming protein, immune system; H 8e-15
3nsj_A540 Perforin-1; pore forming protein, immune system; H 1e-09
3nsj_A540 Perforin-1; pore forming protein, immune system; H 8e-05
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 8e-10
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 7e-05
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 1e-08
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 9e-06
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 9e-08
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 6e-05
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 2e-04
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 9e-04
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 4e-04
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
 Score =  172 bits (438), Expect = 1e-50
 Identities = 44/134 (32%), Positives = 67/134 (50%), Gaps = 10/134 (7%)

Query: 28  TSTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDPYVEVKMGNYKGTTRHFEKKTNPEWNQ 87
           + +   V+ +  L V+V+KA DL   D +G  DP+  +++GN +  T    K  NPEWN+
Sbjct: 3   SGSSGDVKDVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNK 62

Query: 88  VFAFSKDRIQSSVLEVTVKDKD-FVKDDFMGRVLFDLNEIPKRVPPDSPLAPQWYRLEDR 146
           VF F    I   VLEVTV D+D     DF+G+V   L  I           P  Y L+++
Sbjct: 63  VFTFPIKDIH-DVLEVTVFDEDGDKPPDFLGKVAIPLLSIRDG-------QPNCYVLKNK 114

Query: 147 KGD-KVRGELMLAV 159
             +   +G + L +
Sbjct: 115 DLEQAFKGVIYLEM 128


>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Length = 126 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query773
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 100.0
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 100.0
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 100.0
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.97
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.82
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.82
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.82
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.81
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.81
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.81
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.8
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.8
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.79
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.79
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.78
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.78
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.77
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.77
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.77
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.77
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.76
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.76
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.75
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.75
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.75
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.74
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.74
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.74
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.74
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.74
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.73
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.73
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.73
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.73
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.73
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.73
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.72
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.72
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.72
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.72
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.72
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.71
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.71
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.71
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.71
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.71
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.71
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.71
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.7
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.7
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.7
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.7
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.7
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.7
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.7
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.69
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.69
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.69
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.69
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.69
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.69
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.69
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.68
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.68
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.68
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.68
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.67
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.67
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.67
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.66
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.66
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.62
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.62
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.6
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.6
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.58
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.55
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.54
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.54
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.52
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.5
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 99.44
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.43
1cjy_A749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.42
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.37
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 99.27
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.17
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.17
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.16
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.12
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.11
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.03
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.03
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.94
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 98.74
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 98.72
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 98.68
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 98.66
2yrb_A156 Protein fantom; beta sandwich, NPPSFA, national pr 93.31
3l4c_A220 Dedicator of cytokinesis protein 1; DOCK180, DOCK1 88.55
2wxf_A940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 88.41
3hhm_A1091 Phosphatidylinositol-4,5-bisphosphate 3-kinase cat 85.35
2yrb_A156 Protein fantom; beta sandwich, NPPSFA, national pr 84.73
2wxf_A 940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 81.61
3hhm_A 1091 Phosphatidylinositol-4,5-bisphosphate 3-kinase cat 81.59
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
Probab=100.00  E-value=7e-33  Score=290.74  Aligned_cols=245  Identities=24%  Similarity=0.391  Sum_probs=203.2

Q ss_pred             cCcceeeeecccCceeEEEEEEEEeecCCCCCCCCCCCcEEEEEECC---eeeeeeccCCCCCCeeecEEEEEec--CCC
Q 004100           23 TGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDPYVEVKMGN---YKGTTRHFEKKTNPEWNQVFAFSKD--RIQ   97 (773)
Q Consensus        23 ~~~~~~~~~~~~~~~~~L~V~v~~a~~L~~~d~~~~~dpyv~v~~~~---~~~~T~~~~~~~nP~WnE~f~f~v~--~~~   97 (773)
                      |...+++.|+  ...+.|.|+|++|+||+..|..+.+||||++++++   ++++|++++++.||.|||+|.|.+.  +..
T Consensus         6 G~l~~~l~y~--~~~~~L~v~v~~a~~L~~~d~~~~~dpyv~v~~~~~~~~~~~T~~~~~~~nP~wne~f~f~v~~~~~~   83 (284)
T 2r83_A            6 GKLQYSLDYD--FQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELA   83 (284)
T ss_dssp             CEEEEEEEEE--TTTTEEEEEEEEEECCCCCSSSSSCCEEEEEEEETCTTSCEECCCCCSCSSCEEEEEEEECCCGGGCT
T ss_pred             eEEEEEEEEE--CCCCEEEEEEEEeeCCCCCCCCCCCCeEEEEEEEcCCCceEeCCcccCCCCCeeCceEEEEechHHhC
Confidence            4456777776  45689999999999999999889999999999964   4788999999999999999999985  345


Q ss_pred             CceEEEEEEeCCCC-CCeeeEEEEEEcCccCCCCCCCCCCcCeEEEeeeCCC--CceeeEEEEEEEEeccCCCCCCcccc
Q 004100           98 SSVLEVTVKDKDFV-KDDFMGRVLFDLNEIPKRVPPDSPLAPQWYRLEDRKG--DKVRGELMLAVWMGTQADEAFPEAWH  174 (773)
Q Consensus        98 ~~~l~i~V~d~~~~-~d~~lG~~~i~l~~l~~~~~~~~~~~~~w~~L~~~~~--~~~~G~i~l~~~~~~~~d~~~~~~~~  174 (773)
                      ...|.|+|||.+.. +|++||++.++|.++..+.     ....|++|....+  ....|+|.+++.+.+           
T Consensus        84 ~~~l~~~V~d~d~~~~~~~lG~~~i~l~~l~~~~-----~~~~w~~L~~~~~~~~~~~G~i~l~l~~~p-----------  147 (284)
T 2r83_A           84 GKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGH-----VTEEWRDLQSAEKEEQEKLGDICFSLRYVP-----------  147 (284)
T ss_dssp             TCEEEEEEEECCSSSCCCEEEEEEEEGGGCCCSS-----CEEEEEECBCCSSCCCCCCCEEEEEEEEET-----------
T ss_pred             cCEEEEEEEECCCCCCCceeEEEEEcchhcccCC-----cceeEEEeeccccccccccccEEEEEEecC-----------
Confidence            68999999999988 8999999999999997642     3578999988653  235699998887653           


Q ss_pred             cccccccccccccccccceeccCceEEEEEEEEEeecCCCCCCCCCCCcEEEEEEC--C---EEEEeecccCCCCCcccc
Q 004100          175 SDAATVTGIEGLANIRSKVYLSPKLWYLRVNVIEAQDLQPTDKGRFPEVYVKAQLG--N---QALRTRVSASRTINPMWN  249 (773)
Q Consensus       175 ~~~~~~~~~~~~~~~~~~~~~~p~~~~L~V~v~~a~~L~~~~~~~~~dpyv~v~l~--~---~~~kT~~~~~~t~nP~wn  249 (773)
                                             ..+.|.|+|++|++|+.++.++.+||||++.+.  +   ++++|+++++ +.||.||
T Consensus       148 -----------------------~~~~l~v~v~~a~~L~~~d~~~~~dpyv~v~~~~~~~~~~~~kT~v~~~-t~nP~wn  203 (284)
T 2r83_A          148 -----------------------TAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKN-TLNPYYN  203 (284)
T ss_dssp             -----------------------TTTEEEEEEEEEESCCCCSTTSCCCEEEEEEEEETTEEEEEEECCCCCS-CSSCEEE
T ss_pred             -----------------------cCCceEEEEEEeECCCCcCCCCCcCeEEEEEEEeCCcEeeeeccceecC-CCCCEEc
Confidence                                   224699999999999999999999999999994  2   4678999876 9999999


Q ss_pred             ceEEEEeeCCC--CCeEEEEEEEccCCCCCceeEEEEEeccccccc--------cCCCCCCceEEEcccC
Q 004100          250 EDLMFVAAEPF--EEHLILTVEDRVAPNKDEVLGKCMIPLQYVDKR--------LDHKPVNTRWYNLEKH  309 (773)
Q Consensus       250 e~f~f~~~~~~--~~~l~i~V~d~~~~~~d~~iG~~~i~L~~l~~~--------~~~~~~~~~w~~L~~~  309 (773)
                      |.|.|.+....  ...|.|+|||++..+++++||++.+++..+...        ...+....+|+.|.+.
T Consensus       204 e~f~f~v~~~~l~~~~l~i~V~d~d~~~~~~~iG~~~i~l~~~~~~~~~w~~~~~~~~~~~~~W~~L~~~  273 (284)
T 2r83_A          204 ESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVE  273 (284)
T ss_dssp             EEEEEECCTTTGGGEEEEEEEEECCSSSCCCEEEEEEEETTCCHHHHHHHHHHHHSTTSCEEEEEECBCH
T ss_pred             eeEEEeCCHHHhCceEEEEEEEeCCCCCCCcEEEEEEECCCCCCcHHHHHHHHHHCCCCchheeeecCCc
Confidence            99999986543  447999999999999999999999999864321        1233456789999875



>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2yrb_A Protein fantom; beta sandwich, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} Back     alignment and structure
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure
>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A Back     alignment and structure
>2yrb_A Protein fantom; beta sandwich, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure
>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 773
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 3e-25
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 2e-14
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 2e-09
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 2e-23
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 1e-12
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 3e-10
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 3e-23
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 1e-08
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 9e-22
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 2e-15
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 2e-11
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 2e-21
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 3e-14
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 3e-12
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 2e-21
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 1e-15
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 1e-15
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 1e-20
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 3e-10
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 5e-07
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 1e-19
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 8e-14
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 8e-06
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 6e-19
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 4e-12
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 1e-10
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 7e-19
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 4e-12
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 1e-18
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 6e-12
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 8e-04
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 6e-16
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 7e-09
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 7e-16
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 6e-12
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 7e-04
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 8e-16
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 2e-08
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 4e-06
d1dqva1130 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus 6e-15
d1dqva1130 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus 1e-07
d1dqva1130 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus 7e-04
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 9e-14
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 5e-12
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 1e-04
d1bdya_123 b.7.1.1 (A:) Domain from protein kinase C delta {R 1e-13
d1bdya_123 b.7.1.1 (A:) Domain from protein kinase C delta {R 3e-05
d1gmia_136 b.7.1.1 (A:) Domain from protein kinase C epsilon 5e-13
d1gmia_136 b.7.1.1 (A:) Domain from protein kinase C epsilon 5e-11
d1gmia_136 b.7.1.1 (A:) Domain from protein kinase C epsilon 9e-10
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 1e-11
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 3e-07
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 4e-05
d2zkmx2122 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human 6e-08
d2zkmx2122 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human 4e-05
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Unc-13 homolog A
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 99.4 bits (247), Expect = 3e-25
 Identities = 31/120 (25%), Positives = 51/120 (42%), Gaps = 11/120 (9%)

Query: 37  MQYLYVRVVKAKDLPPKDVTGSCDPYVEVKMGNYKGTTRHFEKKTNPEWNQVFAFSKDRI 96
           M  L V V KAK    ++     + YV +K+ N K TT    + + P W Q F F  +R+
Sbjct: 1   MSLLCVGVKKAKFDGAQE---KFNTYVTLKVQNVKSTTIAV-RGSQPSWEQDFMFEINRL 56

Query: 97  QSSVLEVTVKDKDFVKDDFMGRVLFDLNEIPKRVPPDSPLAPQWYRLEDR---KGDKVRG 153
              +  V V +K  + D  +G V   L  I +    +     +W  L+ +      ++ G
Sbjct: 57  DLGLT-VEVWNKGLIWDTMVGTVWIPLRTIRQ---SNEEGPGEWLTLDSQAIMADSEICG 112


>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query773
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.86
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.84
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.81
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.81
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.78
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.78
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.77
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.77
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.76
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.76
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.75
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.75
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.74
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.74
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.74
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.73
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.73
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.73
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.71
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.71
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.7
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.7
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.7
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.67
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.67
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.67
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.66
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.66
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.65
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.64
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.64
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.64
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.63
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.63
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.59
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.55
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.55
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.52
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.41
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.24
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 94.46
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 92.11
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86  E-value=5.8e-22  Score=177.97  Aligned_cols=123  Identities=25%  Similarity=0.458  Sum_probs=108.3

Q ss_pred             CccceEEEEEEEccCCCCCccCCCCCCCCcEEEEEECCeeeeeeeccCCCCCccccEEEEEEeCCCceEEEEEEeCCCCC
Q 004100          359 SSIGVLELGILNAQGLMPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSPTPKWNEQYTWEVFDPCTVITIGVFDNCHLH  438 (773)
Q Consensus       359 ~~~g~l~v~v~~a~~L~~~~~~~~~~~~dpyv~v~~~~~~~~T~~~~~t~~P~wne~~~f~v~~~~~~l~v~v~d~~~~~  438 (773)
                      +++|.|+|+|++|+||+.+   +..|.+||||+++++++.++|++++++.||.|||.|.|.+.++...|.|+|||++.++
T Consensus         3 ~~~G~L~V~v~~A~~L~~~---d~~g~~Dpyv~v~~~~~~~~T~~~~~t~nP~wne~f~f~v~~~~~~L~i~V~d~~~~~   79 (126)
T d2ep6a1           3 KDVGILQVKVLKAADLLAA---DFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKDIHDVLEVTVFDEDGDK   79 (126)
T ss_dssp             CCSEEEEEEEEEEESCCCS---SSSSCCCEEEEEEETTEEEECCCCSSCSSCCCCEEEEEEESCTTCEEEEEEEEEETTE
T ss_pred             CccEEEEEEEEEeECCCCC---CCCCCcCeEEEEEcCCeEEEEEeeCCceeEEEEEEEEEEEeccCceeEEEEEEccCCc
Confidence            4679999999999999987   5568899999999999999999999999999999999999998899999999998876


Q ss_pred             CCCCCCCCCCCccEEEEEecCccccCCeEEeeEEeEeecCCCcccccEEEEEEEEee
Q 004100          439 GGDKAGGARDSRIGKVRIRLSTLETDRVYTHSYPLLVLYPNGVKKMGEIHLAVRFTC  495 (773)
Q Consensus       439 ~~~~~~~~~d~~lG~~~i~l~~l~~~~~~~~~~~L~~~~~~g~~~~G~v~l~~~~~~  495 (773)
                              +|++||++.|+|+++..+.  .+|++|......+. ..|+|+|++++.+
T Consensus        80 --------~d~~lG~~~i~l~~l~~~~--~~~~~l~~~~~~~~-~~G~i~l~~~~i~  125 (126)
T d2ep6a1          80 --------PPDFLGKVAIPLLSIRDGQ--PNCYVLKNKDLEQA-FKGVIYLEMDLIY  125 (126)
T ss_dssp             --------EEEECCBCEEEGGGCCSSC--CEECCCBCSCTTSC-CSSEEEEEEEEEE
T ss_pred             --------CcceEEEEEEEHHHCCCCC--ceEEEccccCCCCc-eeEEEEEEEEEEE
Confidence                    7899999999999998776  57999876554443 3599999998853



>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure