Citrus Sinensis ID: 004131
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 772 | ||||||
| 255552337 | 794 | chloride channel clc, putative [Ricinus | 0.985 | 0.958 | 0.889 | 0.0 | |
| 297737022 | 800 | unnamed protein product [Vitis vinifera] | 0.997 | 0.962 | 0.887 | 0.0 | |
| 225432606 | 771 | PREDICTED: chloride channel protein CLC- | 0.993 | 0.994 | 0.889 | 0.0 | |
| 356497470 | 801 | PREDICTED: chloride channel protein CLC- | 0.993 | 0.957 | 0.863 | 0.0 | |
| 356541567 | 774 | PREDICTED: chloride channel protein CLC- | 0.998 | 0.996 | 0.855 | 0.0 | |
| 224111216 | 752 | Cl-channel clc-7 [Populus trichocarpa] g | 0.974 | 1.0 | 0.889 | 0.0 | |
| 357480817 | 777 | Chloride channel protein CLC-d [Medicago | 0.998 | 0.992 | 0.842 | 0.0 | |
| 357480813 | 799 | Chloride channel protein CLC-d [Medicago | 0.993 | 0.959 | 0.843 | 0.0 | |
| 357480815 | 847 | Chloride channel protein CLC-d [Medicago | 0.993 | 0.905 | 0.792 | 0.0 | |
| 15240276 | 792 | chloride channel protein CLC-d [Arabidop | 0.993 | 0.968 | 0.851 | 0.0 |
| >gi|255552337|ref|XP_002517213.1| chloride channel clc, putative [Ricinus communis] gi|223543848|gb|EEF45376.1| chloride channel clc, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1356 bits (3509), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 683/768 (88%), Positives = 719/768 (93%), Gaps = 7/768 (0%)
Query: 1 MLSNHLQNGFETAKLVWSQIPNSEEAEHEGVGLLSTSGGSSSVESLDYEVIENYAYREEQ 60
MLSNHL NG ETAKLVWS+IP+SEE GVGLL TS G+SS ESLDYE IENYAYREEQ
Sbjct: 1 MLSNHLNNGIETAKLVWSRIPHSEE----GVGLL-TSSGASSAESLDYEAIENYAYREEQ 55
Query: 61 AQRGKLYVGYSVVVKWFFALLIGIGTGLAAVFINISVENFAGWKFSLTFSIIQKSYFAGF 120
AQRGKLY+GY V VKW FALLIGIGTGLAAVFIN+SVENFAGWKFSLTFSIIQKSYFAGF
Sbjct: 56 AQRGKLYIGYYVAVKWLFALLIGIGTGLAAVFINLSVENFAGWKFSLTFSIIQKSYFAGF 115
Query: 121 LVYILINLILVFSSVYIITKFAPAAAGSGIPEIKGYLNGVDIHGILLFRTLIGKIFGSIG 180
++Y+L NL LV+SSVYIIT+FAPAAAGSGIPEIKGYLNG+DI GILLFRTL+GKIFGSIG
Sbjct: 116 VLYVLFNLALVYSSVYIITQFAPAAAGSGIPEIKGYLNGIDIPGILLFRTLVGKIFGSIG 175
Query: 181 SVGGGLALGKEGPLVHTGACIASLLGQGGSTKYHLRYRWLQVFRSDRDRRDLVTCGCAAG 240
SVGGGLALGKEGPLVHTGACIASLLGQGGSTKYHL RWLQVF+SDRDRRDLVTCGCAAG
Sbjct: 176 SVGGGLALGKEGPLVHTGACIASLLGQGGSTKYHLSSRWLQVFKSDRDRRDLVTCGCAAG 235
Query: 241 VAAAFRAPVGGVLFALEEVTSWWRSQLMWRVFFTSAIVAVVVRSAMGWCKSGKCGHFGSG 300
VAAAFRAPVGGVLFALEEVTSWWRSQLMWRVFFTSAIVAVVVR+AMGWCKSG CGHFGSG
Sbjct: 236 VAAAFRAPVGGVLFALEEVTSWWRSQLMWRVFFTSAIVAVVVRTAMGWCKSGNCGHFGSG 295
Query: 301 GFIIWDISDGQEDYSFEELLPMAVIGVIGGLLGALFNQLTLYMTSWRRNYLHKKGNRVKI 360
GF+IWDISDGQEDYSF ELLPMAVIGVIGGLLGALFNQLTLY+T WRRNYLHKKGNRVKI
Sbjct: 296 GFVIWDISDGQEDYSFAELLPMAVIGVIGGLLGALFNQLTLYITQWRRNYLHKKGNRVKI 355
Query: 361 IEACVISVITSVISFGLPLLRKCSPCPESDLDSGIECPRPPGMYGNYVNFYCSKDKEYND 420
IEAC+ISVITS ISFGLPLLRKCSPCPE D D IECPRPPGMYGNYVNFYC +KEYND
Sbjct: 356 IEACLISVITSAISFGLPLLRKCSPCPEKDAD--IECPRPPGMYGNYVNFYCGTNKEYND 413
Query: 421 LATIFFNTQDDAIRNLFSAKTIHEYSAQSLLTFLVMFYTLAVVTFGIAVPAGQFVPGIMI 480
LATIFFNTQDDAIRNLFSAKTIHEYSAQSLLTFLVMFYTLAVVTFG A+PAGQFVPGIMI
Sbjct: 414 LATIFFNTQDDAIRNLFSAKTIHEYSAQSLLTFLVMFYTLAVVTFGAAIPAGQFVPGIMI 473
Query: 481 GSTYGRLVGMFVVNFYKKLNIEEGTYALLGAASFLGGSMRMTVSLCVIMVEITNNLKFLP 540
GSTYGRLVGMFVV FY K NIEEGTYALLGAASFLGGSMRMTVSLCVIMVEITNNLK LP
Sbjct: 474 GSTYGRLVGMFVVKFYNKPNIEEGTYALLGAASFLGGSMRMTVSLCVIMVEITNNLKLLP 533
Query: 541 LIMLVLLISKAVGDAFSEGLYEEQAHLRGVPLLESRPKYKMRQMTAKEACGAQKVVSLPR 600
LIMLVLLISKAVGDAF+EGLYE QA LRG+PLLES+PKY+MR MTA+EACG QKVVS PR
Sbjct: 534 LIMLVLLISKAVGDAFNEGLYEVQARLRGIPLLESKPKYQMRTMTAREACGNQKVVSFPR 593
Query: 601 IIKVADVVSILRTNKHNGFPVIDHSRNGERLVIGLVLRSHLLVLLQSKVDFQHSPLPCDT 660
+ KVADVVSILR+NKHNGFPVIDH+RNGE LVIGL+LRSHLLVLLQSKVDFQHSPLPCD
Sbjct: 594 VAKVADVVSILRSNKHNGFPVIDHTRNGETLVIGLMLRSHLLVLLQSKVDFQHSPLPCDP 653
Query: 661 RGGSKPISHSFSEFVKPASSKGLSIDDIHLSSDDMEMYIDLGPFLNPSPYVVPEDMSLSK 720
RGGS+ I H+FSEFVKP SSKG+ I+DIHLSSDD+EMYIDL PFLNPSPYVVPEDMSL+K
Sbjct: 654 RGGSRSIRHNFSEFVKPVSSKGICIEDIHLSSDDLEMYIDLAPFLNPSPYVVPEDMSLTK 713
Query: 721 VYNLFRQLGLRHIFVVPRASRVIGLITRKDLLIEDGEDSTTVELQSTS 768
VYN+FRQLGLRHIFVVPRASRVIGLITRKDLLIED EDS +ELQSTS
Sbjct: 714 VYNIFRQLGLRHIFVVPRASRVIGLITRKDLLIEDHEDSANMELQSTS 761
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297737022|emb|CBI26223.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225432606|ref|XP_002281606.1| PREDICTED: chloride channel protein CLC-d [Vitis vinifera] gi|301318138|gb|ADK66984.1| chloride channel ClC6 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356497470|ref|XP_003517583.1| PREDICTED: chloride channel protein CLC-d-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356541567|ref|XP_003539246.1| PREDICTED: chloride channel protein CLC-d-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224111216|ref|XP_002315783.1| Cl-channel clc-7 [Populus trichocarpa] gi|222864823|gb|EEF01954.1| Cl-channel clc-7 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357480817|ref|XP_003610694.1| Chloride channel protein CLC-d [Medicago truncatula] gi|355512029|gb|AES93652.1| Chloride channel protein CLC-d [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357480813|ref|XP_003610692.1| Chloride channel protein CLC-d [Medicago truncatula] gi|355512027|gb|AES93650.1| Chloride channel protein CLC-d [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357480815|ref|XP_003610693.1| Chloride channel protein CLC-d [Medicago truncatula] gi|355512028|gb|AES93651.1| Chloride channel protein CLC-d [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|15240276|ref|NP_197996.1| chloride channel protein CLC-d [Arabidopsis thaliana] gi|41688458|sp|P92943.2|CLCD_ARATH RecName: Full=Chloride channel protein CLC-d; Short=AtCLC-d; AltName: Full=CBS domain-containing protein CBSCLC2 gi|332006157|gb|AED93540.1| chloride channel protein CLC-d [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 772 | ||||||
| TAIR|locus:2179724 | 792 | CLC-D "chloride channel D" [Ar | 0.993 | 0.968 | 0.774 | 0.0 | |
| TAIR|locus:2158809 | 779 | CLC-C "chloride channel C" [Ar | 0.896 | 0.888 | 0.427 | 9.3e-146 | |
| TAIR|locus:2095123 | 780 | CLC-B "chloride channel B" [Ar | 0.738 | 0.730 | 0.444 | 7e-143 | |
| TAIR|locus:2164466 | 775 | CLC-A "chloride channel A" [Ar | 0.735 | 0.732 | 0.447 | 8.9e-143 | |
| ZFIN|ZDB-GENE-061103-196 | 795 | clcn7 "chloride channel 7" [Da | 0.725 | 0.704 | 0.342 | 7.5e-101 | |
| UNIPROTKB|F1NS73 | 802 | CLCN7 "Uncharacterized protein | 0.727 | 0.700 | 0.350 | 1.6e-98 | |
| DICTYBASE|DDB_G0276865 | 815 | clcB "CLC 6/7 family protein" | 0.726 | 0.688 | 0.334 | 2.3e-97 | |
| UNIPROTKB|E2R0Q0 | 747 | CLCN7 "Uncharacterized protein | 0.722 | 0.746 | 0.340 | 7.8e-95 | |
| MGI|MGI:1347048 | 803 | Clcn7 "chloride channel 7" [Mu | 0.722 | 0.694 | 0.337 | 1.3e-94 | |
| RGD|61836 | 803 | Clcn7 "chloride channel, volta | 0.722 | 0.694 | 0.337 | 1.3e-94 |
| TAIR|locus:2179724 CLC-D "chloride channel D" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3068 (1085.0 bits), Expect = 0., P = 0.
Identities = 596/770 (77%), Positives = 641/770 (83%)
Query: 1 MLSNHLQNGFETAKLVWSQIPNSEEAE-HXXXXXXXXXXXXXXXXXXDYEVIENYAYREE 59
MLSNHLQNG E+ L+WS++P S++ DYEVIENYAYREE
Sbjct: 1 MLSNHLQNGIESDNLLWSRVPESDDTSTDDITLLNSHRDGDGGVNSLDYEVIENYAYREE 60
Query: 60 QAQRGKLYVGYSVVVKWFFALLIGIGTGLAAVFINISVENFAGWKFSLTFSIIQKSYFAG 119
QA RGKLYVGY V VKWFF+LLIGIGTGLAAVFIN+SVENFAGWKF+LTF+IIQKSYFAG
Sbjct: 61 QAHRGKLYVGYYVAVKWFFSLLIGIGTGLAAVFINLSVENFAGWKFALTFAIIQKSYFAG 120
Query: 120 FLVYILINLILVFSSVYIITKFAPAAAGSGIPEIKGYLNGVDIHGILLFRTLIGKIFGSI 179
F+VY+LINL+LVFSS YIIT+FAPAAAGSGIPEIKGYLNG+DI G LLFRTLIGKIFGSI
Sbjct: 121 FIVYLLINLVLVFSSAYIITQFAPAAAGSGIPEIKGYLNGIDIPGTLLFRTLIGKIFGSI 180
Query: 180 GSVGGGLALGKEGPLVHTGACIASLLGQGGSTKYHLRYRWLQVFRSDRDRRDLXXXXXXX 239
GSVGGGLALGKEGPLVHTGACIASLLGQGGSTKYHL RW Q+F+SDRDRRDL
Sbjct: 181 GSVGGGLALGKEGPLVHTGACIASLLGQGGSTKYHLNSRWPQLFKSDRDRRDLVTCGCAA 240
Query: 240 XXXXXXXXXXXXXLFALEEVTSWWRSQLMWRVFFTSAIVAVVVRSAMGWCKSGKCGHFGS 299
LFALEEVTSWWRSQLMWRVFFTSAIVAVVVR+AMGWCKSG CGHFG
Sbjct: 241 GVAAAFRAPVGGVLFALEEVTSWWRSQLMWRVFFTSAIVAVVVRTAMGWCKSGICGHFGG 300
Query: 300 GGFIIWDISDGQEDYSFEELLPMXXXXXXXXXXXXXFNQLTLYMTSWRRNYLHKKGNRVK 359
GGFIIWD+SDGQ+DY F+ELLPM FNQLTLYMTSWRRN LHKKGNRVK
Sbjct: 301 GGFIIWDVSDGQDDYYFKELLPMAVIGVIGGLLGALFNQLTLYMTSWRRNSLHKKGNRVK 360
Query: 360 IIEACVISVITSVISFGLPLLRKCSPCPESDLDSGIECPRPPGMYGNYVNFYCSKDKEYN 419
IIEAC+IS ITS ISFGLPLLRKCSPCPES DSGIECPRPPGMYGNYVNF+C D EYN
Sbjct: 361 IIEACIISCITSAISFGLPLLRKCSPCPESVPDSGIECPRPPGMYGNYVNFFCKTDNEYN 420
Query: 420 DLATIFFNTQDDAIRNLFSAKTIHEYSAQSLLTFLVMFYTLAVVTFGIAVPAGQFVPGIM 479
DLATIFFNTQDDAIRNLFSAKT+ E+SAQSLLTFL MFYTLAVVTFG AVPAGQFVPGIM
Sbjct: 421 DLATIFFNTQDDAIRNLFSAKTMREFSAQSLLTFLAMFYTLAVVTFGTAVPAGQFVPGIM 480
Query: 480 IGSTYGRLVGMFVVNFYKKLNIEEGTYALLGAASFLGGSMRMTVSLCVIMVEITNNLKFL 539
IGSTYGRLVGMFVV FYKKLNIEEGTYALLGAASFLGGSMRMTVSLCVIMVEITNNLK L
Sbjct: 481 IGSTYGRLVGMFVVRFYKKLNIEEGTYALLGAASFLGGSMRMTVSLCVIMVEITNNLKLL 540
Query: 540 PLIMLVLLISKAVGDAFSEGLYEEQAHLRGVPLLESRPKYKMRQMTAKEACGAQKVVSLP 599
PLIMLVLLISKAVGDAF+EGLYE QA L+G+PLLESRPKY MRQM AKEAC +QKV+SLP
Sbjct: 541 PLIMLVLLISKAVGDAFNEGLYEVQARLKGIPLLESRPKYHMRQMIAKEACQSQKVISLP 600
Query: 600 RIIKVADVVSILRTNKHNGFPVIDHSRNGERLVIGXXXXXXXXXXXQSKVDFQHSPLPCD 659
R+I+VADV SIL +NKHNGFPVIDH+R+GE LVIG QSKVDFQHSPLPCD
Sbjct: 601 RVIRVADVASILGSNKHNGFPVIDHTRSGETLVIGLVLRSHLLVLLQSKVDFQHSPLPCD 660
Query: 660 TRGGSKPISHSFSEFVKPASSKGXXXXXXXXXXXXMEMYIDLGPFLNPSPYVVPEDMSLS 719
++ I HSFSEF KP SSKG +EMYIDL PFLNPSPYVVPEDMSL+
Sbjct: 661 P--SARNIRHSFSEFAKPVSSKGLCIEDIHLTSDDLEMYIDLAPFLNPSPYVVPEDMSLT 718
Query: 720 KVYNLFRQLGLRHIFVVPRASRVIGLITRKDLLIEDGEDSTTVELQSTSS 769
KVYNLFRQLGLRH+FVVPR SRVIGLITRKDLLIE+ +S+ VELQ ++S
Sbjct: 719 KVYNLFRQLGLRHLFVVPRPSRVIGLITRKDLLIEENGESSAVELQQSTS 768
|
|
| TAIR|locus:2158809 CLC-C "chloride channel C" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2095123 CLC-B "chloride channel B" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2164466 CLC-A "chloride channel A" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-061103-196 clcn7 "chloride channel 7" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NS73 CLCN7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0276865 clcB "CLC 6/7 family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R0Q0 CLCN7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1347048 Clcn7 "chloride channel 7" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|61836 Clcn7 "chloride channel, voltage-sensitive 7" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 772 | |||
| cd03685 | 466 | cd03685, ClC_6_like, ClC-6-like chloride channel p | 1e-172 | |
| cd01036 | 416 | cd01036, ClC_euk, Chloride channel, ClC | 1e-115 | |
| cd03684 | 445 | cd03684, ClC_3_like, ClC-3-like chloride channel p | 1e-101 | |
| pfam00654 | 345 | pfam00654, Voltage_CLC, Voltage gated chloride cha | 6e-77 | |
| cd00400 | 383 | cd00400, Voltage_gated_ClC, CLC voltage-gated chlo | 8e-61 | |
| cd03685 | 466 | cd03685, ClC_6_like, ClC-6-like chloride channel p | 3e-58 | |
| COG0038 | 443 | COG0038, EriC, Chloride channel protein EriC [Inor | 2e-56 | |
| cd01031 | 402 | cd01031, EriC, ClC chloride channel EriC | 2e-51 | |
| cd03683 | 426 | cd03683, ClC_1_like, ClC-1-like chloride channel p | 3e-47 | |
| cd01036 | 416 | cd01036, ClC_euk, Chloride channel, ClC | 9e-42 | |
| PRK05277 | 438 | PRK05277, PRK05277, chloride channel protein; Prov | 2e-34 | |
| cd01034 | 390 | cd01034, EriC_like, ClC chloride channel family | 6e-26 | |
| cd04591 | 105 | cd04591, CBS_pair_EriC_assoc_euk_bac, This cd cont | 1e-23 | |
| cd03683 | 426 | cd03683, ClC_1_like, ClC-1-like chloride channel p | 3e-16 | |
| cd01033 | 388 | cd01033, ClC_like, Putative ClC chloride channel | 3e-10 | |
| cd03682 | 378 | cd03682, ClC_sycA_like, ClC sycA-like chloride cha | 4e-10 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 5e-10 | |
| PRK01862 | 574 | PRK01862, PRK01862, putative voltage-gated ClC-typ | 1e-08 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 2e-08 | |
| cd04611 | 111 | cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd co | 1e-06 | |
| pfam00654 | 345 | pfam00654, Voltage_CLC, Voltage gated chloride cha | 3e-06 | |
| PRK05277 | 438 | PRK05277, PRK05277, chloride channel protein; Prov | 8e-06 | |
| smart00116 | 49 | smart00116, CBS, Domain in cystathionine beta-synt | 9e-06 | |
| cd04586 | 135 | cd04586, CBS_pair_BON_assoc, This cd contains two | 2e-05 | |
| cd04600 | 124 | cd04600, CBS_pair_HPP_assoc, This cd contains two | 4e-05 | |
| cd01033 | 388 | cd01033, ClC_like, Putative ClC chloride channel | 5e-05 | |
| COG0038 | 443 | COG0038, EriC, Chloride channel protein EriC [Inor | 1e-04 | |
| cd04607 | 113 | cd04607, CBS_pair_NTP_transferase_assoc, This cd c | 2e-04 | |
| PRK01610 | 418 | PRK01610, PRK01610, putative voltage-gated ClC-typ | 2e-04 | |
| cd04640 | 126 | cd04640, CBS_pair_27, The CBS domain, named after | 4e-04 | |
| cd00400 | 383 | cd00400, Voltage_gated_ClC, CLC voltage-gated chlo | 0.001 | |
| cd04590 | 111 | cd04590, CBS_pair_CorC_HlyC_assoc, This cd contain | 0.001 | |
| cd04598 | 119 | cd04598, CBS_pair_GGDEF_assoc, This cd contains tw | 0.001 | |
| cd01034 | 390 | cd01034, EriC_like, ClC chloride channel family | 0.002 | |
| cd04612 | 111 | cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont | 0.002 | |
| cd04638 | 106 | cd04638, CBS_pair_25, The CBS domain, named after | 0.002 | |
| smart00116 | 49 | smart00116, CBS, Domain in cystathionine beta-synt | 0.003 | |
| COG0517 | 117 | COG0517, COG0517, FOG: CBS domain [General functio | 0.004 | |
| cd04803 | 122 | cd04803, CBS_pair_15, The CBS domain, named after | 0.004 | |
| cd04593 | 115 | cd04593, CBS_pair_EriC_assoc_bac_arch, This cd con | 0.004 |
| >gnl|CDD|239657 cd03685, ClC_6_like, ClC-6-like chloride channel proteins | Back alignment and domain information |
|---|
Score = 503 bits (1298), Expect = e-172
Identities = 187/338 (55%), Positives = 236/338 (69%), Gaps = 2/338 (0%)
Query: 44 ESLDYEVIENYAYREEQAQRGKLYVGYSVVVKWFFALLIGIGTGLAAVFINISVENFAGW 103
ESLDYEVIEN +REE +R K V +KW LLIGI TGL A FI+++VEN AG
Sbjct: 1 ESLDYEVIENDLFREEWRKRKKKQVLQYEFLKWIICLLIGIFTGLVAYFIDLAVENLAGL 60
Query: 104 KFSLTFSIIQKS-YFAGFLVYILINLILVFSSVYIITKFAPAAAGSGIPEIKGYLNGVDI 162
KF + + I+K F FLVY+ +NL+LV + ++ AP AAGSGIPE+KGYLNGV I
Sbjct: 61 KFLVVKNYIEKGRLFTAFLVYLGLNLVLVLVAALLVAYIAPTAAGSGIPEVKGYLNGVKI 120
Query: 163 HGILLFRTLIGKIFGSIGSVGGGLALGKEGPLVHTGACIASLLGQGGSTKYHLRYRWLQV 222
IL +TL+ KI G I SV GGLALGKEGP++H GACIA+ L QGGST L +RW +
Sbjct: 121 PHILRLKTLLVKIVGVILSVSGGLALGKEGPMIHIGACIAAGLSQGGSTSLRLDFRWFRY 180
Query: 223 FRSDRDRRDLVTCGCAAGVAAAFRAPVGGVLFALEEVTSWWRSQLMWRVFFTSAIVAVVV 282
FR+DRD+RD VTCG AAGVAAAF APVGGVLF+LEEV S+W L WR FF+S IV +
Sbjct: 181 FRNDRDKRDFVTCGAAAGVAAAFGAPVGGVLFSLEEVASFWNQALTWRTFFSSMIVTFTL 240
Query: 283 RSAMGWCKSGKCGHFGSGGFIIWDISDGQEDYSFEELLPMAVIGVIGGLLGALFNQLTLY 342
+ C SGKCG FG GG I++D S + Y++ EL+P +IGVIGGLLGALFN L
Sbjct: 241 NFFLSGCNSGKCGLFGPGGLIMFDGSSTKYLYTYFELIPFMLIGVIGGLLGALFNHLNHK 300
Query: 343 MTSWRRNYLHKKGNRVKIIEACVISVITSVISFGLPLL 380
+T +R+ H KG +K++EA ++S++TSV++F LL
Sbjct: 301 VTRFRKRINH-KGKLLKVLEALLVSLVTSVVAFPQTLL 337
|
This CD includes ClC-6, ClC-7 and ClC-B, C, D in plants. Proteins in this family are ubiquitous in eukarotes and their functions are unclear. They are expressed in intracellular organelles membranes. This family belongs to the ClC superfamily of chloride ion channels, which share the unique double-barreled architecture and voltage-dependent gating mechanism. The gating is conferred by the permeating anion itself, acting as the gating charge. ClC chloride ion channel superfamily perform a variety of functions including cellular excitability regulation, cell volume regulation, membrane potential stabilization, acidification of intracellular organelles, signal transduction, and transepithelial transport in animals. Length = 466 |
| >gnl|CDD|238507 cd01036, ClC_euk, Chloride channel, ClC | Back alignment and domain information |
|---|
| >gnl|CDD|239656 cd03684, ClC_3_like, ClC-3-like chloride channel proteins | Back alignment and domain information |
|---|
| >gnl|CDD|216046 pfam00654, Voltage_CLC, Voltage gated chloride channel | Back alignment and domain information |
|---|
| >gnl|CDD|238233 cd00400, Voltage_gated_ClC, CLC voltage-gated chloride channel | Back alignment and domain information |
|---|
| >gnl|CDD|239657 cd03685, ClC_6_like, ClC-6-like chloride channel proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223116 COG0038, EriC, Chloride channel protein EriC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238504 cd01031, EriC, ClC chloride channel EriC | Back alignment and domain information |
|---|
| >gnl|CDD|239655 cd03683, ClC_1_like, ClC-1-like chloride channel proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238507 cd01036, ClC_euk, Chloride channel, ClC | Back alignment and domain information |
|---|
| >gnl|CDD|235385 PRK05277, PRK05277, chloride channel protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238506 cd01034, EriC_like, ClC chloride channel family | Back alignment and domain information |
|---|
| >gnl|CDD|239964 cd04591, CBS_pair_EriC_assoc_euk_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|239655 cd03683, ClC_1_like, ClC-1-like chloride channel proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238505 cd01033, ClC_like, Putative ClC chloride channel | Back alignment and domain information |
|---|
| >gnl|CDD|239654 cd03682, ClC_sycA_like, ClC sycA-like chloride channel proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|234987 PRK01862, PRK01862, putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|239984 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|216046 pfam00654, Voltage_CLC, Voltage gated chloride channel | Back alignment and domain information |
|---|
| >gnl|CDD|235385 PRK05277, PRK05277, chloride channel protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239959 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239973 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >gnl|CDD|238505 cd01033, ClC_like, Putative ClC chloride channel | Back alignment and domain information |
|---|
| >gnl|CDD|223116 COG0038, EriC, Chloride channel protein EriC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|239980 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|234963 PRK01610, PRK01610, putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240011 cd04640, CBS_pair_27, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238233 cd00400, Voltage_gated_ClC, CLC voltage-gated chloride channel | Back alignment and domain information |
|---|
| >gnl|CDD|239963 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >gnl|CDD|239971 cd04598, CBS_pair_GGDEF_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >gnl|CDD|238506 cd01034, EriC_like, ClC chloride channel family | Back alignment and domain information |
|---|
| >gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|240009 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239966 cd04593, CBS_pair_EriC_assoc_bac_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 772 | |||
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 100.0 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 100.0 | |
| KOG0476 | 931 | consensus Cl- channel CLC-2 and related proteins ( | 100.0 | |
| cd03685 | 466 | ClC_6_like ClC-6-like chloride channel proteins. T | 100.0 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 100.0 | |
| cd03684 | 445 | ClC_3_like ClC-3-like chloride channel proteins. T | 100.0 | |
| cd03683 | 426 | ClC_1_like ClC-1-like chloride channel proteins. T | 100.0 | |
| cd01036 | 416 | ClC_euk Chloride channel, ClC. These domains are f | 100.0 | |
| cd01031 | 402 | EriC ClC chloride channel EriC. This domain is fou | 100.0 | |
| PRK01610 | 418 | putative voltage-gated ClC-type chloride channel C | 100.0 | |
| PRK05277 | 438 | chloride channel protein; Provisional | 100.0 | |
| COG0038 | 443 | EriC Chloride channel protein EriC [Inorganic ion | 100.0 | |
| PF00654 | 355 | Voltage_CLC: Voltage gated chloride channel Mutati | 100.0 | |
| cd01033 | 388 | ClC_like Putative ClC chloride channel. Clc protei | 100.0 | |
| cd01034 | 390 | EriC_like ClC chloride channel family. These prote | 100.0 | |
| cd00400 | 383 | Voltage_gated_ClC CLC voltage-gated chloride chann | 100.0 | |
| cd03682 | 378 | ClC_sycA_like ClC sycA-like chloride channel prote | 100.0 | |
| PRK03655 | 414 | putative ion channel protein; Provisional | 100.0 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 99.72 | |
| cd01034 | 390 | EriC_like ClC chloride channel family. These prote | 99.67 | |
| cd01033 | 388 | ClC_like Putative ClC chloride channel. Clc protei | 99.66 | |
| PRK05277 | 438 | chloride channel protein; Provisional | 99.61 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.6 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 99.55 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 99.55 | |
| cd00400 | 383 | Voltage_gated_ClC CLC voltage-gated chloride chann | 99.53 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 99.52 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 99.52 | |
| PRK01610 | 418 | putative voltage-gated ClC-type chloride channel C | 99.51 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 99.47 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 99.45 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 99.42 | |
| cd03682 | 378 | ClC_sycA_like ClC sycA-like chloride channel prote | 99.42 | |
| cd01031 | 402 | EriC ClC chloride channel EriC. This domain is fou | 99.42 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 99.42 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 99.42 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 99.41 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 99.39 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 99.38 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 99.36 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 99.35 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 99.34 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 99.34 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 99.33 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 99.33 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 99.33 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 99.32 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 99.32 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 99.32 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 99.32 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 99.31 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 99.31 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 99.31 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 99.31 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 99.3 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 99.3 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 99.3 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 99.3 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 99.29 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 99.29 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 99.29 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 99.28 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 99.28 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 99.28 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 99.27 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 99.27 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 99.26 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 99.26 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 99.26 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 99.26 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 99.26 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 99.26 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 99.26 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 99.25 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 99.25 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 99.24 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 99.24 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 99.24 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 99.24 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 99.24 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 99.24 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 99.23 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 99.23 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 99.23 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 99.23 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 99.22 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 99.22 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 99.22 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 99.21 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 99.2 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 99.2 | |
| PF00654 | 355 | Voltage_CLC: Voltage gated chloride channel Mutati | 99.19 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 99.19 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 99.19 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 99.19 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 99.18 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 99.18 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 99.18 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 99.18 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 99.18 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 99.17 | |
| cd03684 | 445 | ClC_3_like ClC-3-like chloride channel proteins. T | 99.16 | |
| COG0038 | 443 | EriC Chloride channel protein EriC [Inorganic ion | 99.16 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 99.16 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 99.16 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 99.15 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 99.15 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 99.15 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 99.15 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 99.15 | |
| PRK03655 | 414 | putative ion channel protein; Provisional | 99.13 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 99.12 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 99.1 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 99.09 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 99.09 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 99.03 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 98.99 | |
| cd03685 | 466 | ClC_6_like ClC-6-like chloride channel proteins. T | 98.99 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 98.96 | |
| cd01036 | 416 | ClC_euk Chloride channel, ClC. These domains are f | 98.91 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.86 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 98.79 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 98.78 | |
| cd03683 | 426 | ClC_1_like ClC-1-like chloride channel proteins. T | 98.74 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.55 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 98.48 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 98.45 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 98.43 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 98.43 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 98.3 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 97.97 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 97.89 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 97.85 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 97.78 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 97.77 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 97.64 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 97.63 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.61 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 97.61 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 97.57 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 97.54 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 97.51 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 97.48 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 97.45 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 97.4 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 97.34 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 97.31 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 97.3 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 97.27 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 97.23 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 97.23 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 97.22 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 97.19 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 97.19 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 97.19 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 97.18 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 97.15 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 97.15 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 97.14 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 97.11 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 97.08 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 97.08 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 97.08 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 97.07 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 97.07 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 97.07 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 97.07 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 97.06 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 97.06 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 97.06 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 97.04 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 97.04 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 97.04 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 97.03 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 97.03 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 97.02 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 97.01 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 96.99 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 96.99 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 96.98 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 96.98 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 96.98 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 96.98 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 96.97 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 96.96 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 96.94 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 96.93 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 96.93 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 96.92 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 96.92 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 96.91 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 96.9 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 96.89 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 96.88 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 96.88 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 96.87 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 96.86 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 96.85 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 96.84 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 96.84 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 96.83 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 96.83 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 96.82 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 96.82 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 96.82 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 96.79 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 96.79 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 96.79 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 96.74 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 96.72 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 96.72 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 96.7 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 96.7 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 96.67 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 96.59 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 96.56 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 96.47 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 96.36 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 96.32 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 96.2 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 96.14 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 95.99 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 95.6 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 94.92 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 93.1 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 92.8 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 92.63 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 91.96 | |
| KOG2118 | 498 | consensus Predicted membrane protein, contains two | 90.89 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 88.25 | |
| KOG0476 | 931 | consensus Cl- channel CLC-2 and related proteins ( | 87.61 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 84.69 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 83.37 |
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-155 Score=1252.22 Aligned_cols=692 Identities=54% Similarity=0.910 Sum_probs=640.9
Q ss_pred CCCCCCCCcccchhchHHHHHHHhcCcccchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHhhh---
Q 004131 39 GSSSVESLDYEVIENYAYREEQAQRGKLYVGYSVVVKWFFALLIGIGTGLAAVFINISVENFAGWKFSLTFSIIQKS--- 115 (772)
Q Consensus 39 ~~~~~esldy~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~liGv~~Gl~a~~~~~~i~~~~~~~~~~~~~~~~~~--- 115 (772)
++++|||||||+.||+.|+|+||+|++.+.++|...||+++++||+++|++|.++|..+|.+.++|+..+.+.+.+.
T Consensus 51 k~~~yESLDYei~ENdlf~e~~r~~~k~~~~~y~~~kW~~~~lIGi~TgLva~fidl~Ven~ag~Kf~~v~~~v~~~~s~ 130 (762)
T KOG0474|consen 51 KVCDYESLDYEICENDLFLEDWRTRDKKKGRRYEAVKWMVCFLIGICTGLVALFIDLFVENFAGLKFGVVQNSVEECRSQ 130 (762)
T ss_pred CCCCccccchhhhcchHHHHHHHhhcccceeeeehHHHHHHHHHHHHHHHHHHHHHHHHHHhhchhHHHHHHHHHHhhhc
Confidence 78899999999999999999999999999999999999999999999999999999999999999999987776554
Q ss_pred ---hhhHHHHHHHHHHHHHHHHHHHhhhccccccCCCHHHHHHHHccccccCchhHHHHHHHHhhhhhhccccccccCcc
Q 004131 116 ---YFAGFLVYILINLILVFSSVYIITKFAPAAAGSGIPEIKGYLNGVDIHGILLFRTLIGKIFGSIGSVGGGLALGKEG 192 (772)
Q Consensus 116 ---~~~~~~~~~~~~~~~~~~~~~l~~~~~p~a~GsGipev~~~l~g~~~~~~l~~~~l~~K~~~~~~sv~sG~svG~EG 192 (772)
++..++.|.++++.++++++.++.+++|.|+||||||||+||||+++|+.+++||+++|++|+++++++|+.+||||
T Consensus 131 ~g~~~~~~l~~~g~Nl~lv~~as~lv~~iaP~AAGSGIPevK~YLNGV~iP~ivrl~TL~~Ki~Gvi~sV~gGL~~GKEG 210 (762)
T KOG0474|consen 131 KGCLALSLLVLLGFNLVLVFLASVLVAYIAPVAAGSGIPEVKCYLNGVKIPGIVRLRTLIVKILGVIFSVAGGLAVGKEG 210 (762)
T ss_pred cccHHHHHHHHHHHhHHHHHHHHHHHHeechhccCCCCchhhhhhcCccCcceeehhhhHHhHhhhhhhhhhhhhccCcC
Confidence 78899999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hHHHHHHHHHHHhhccCccccchhhhhhcccCChhhhhhHHHhhhhhhhhhhhcCCccceeeeeeecchhhhhhhHHHHH
Q 004131 193 PLVHTGACIASLLGQGGSTKYHLRYRWLQVFRSDRDRRDLVTCGCAAGVAAAFRAPVGGVLFALEEVTSWWRSQLMWRVF 272 (772)
Q Consensus 193 P~v~iGa~ig~~l~~~~~~~~~l~~~~~~~f~~~~~~r~li~~GaaAgvaaaF~APigGvlFalE~~~~~~~~~~~~~~~ 272 (772)
||||.||+||+.++|++|.+++++|||+|+||||+|||++++||+|||+||+|+||+||+||++||.++||++.++||+|
T Consensus 211 PMIHsGa~Vaagl~QG~S~~~r~~~r~fr~FrnDrdrRD~VscGaAAGVaAAF~APvGGvLFaLEE~aS~Wnq~L~WR~f 290 (762)
T KOG0474|consen 211 PMIHSGSVVAAGLGQGGSTSLRKDWRWFRYFRNDRDRRDLVSCGAAAGVAAAFRAPVGGVLFALEEGASWWNQALLWRTF 290 (762)
T ss_pred CeeehhHHHHhcccCCCccchhhhhhhhhhhcccchhhhhhhcchHHhHHHHhCCCccceEEEechhhHHHHhhHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHhhhhccCCcccccCCCceEEEecCCCCCCCChhhHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHhhhc
Q 004131 273 FTSAIVAVVVRSAMGWCKSGKCGHFGSGGFIIWDISDGQEDYSFEELLPMAVIGVIGGLLGALFNQLTLYMTSWRRNYLH 352 (772)
Q Consensus 273 ~~~~va~~v~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~l~~~~~lGv~~Gl~g~~f~~~~~~~~~~~~~~~~ 352 (772)
|++++++++++.++.+|.+|+|+.|+.+++++|++.+....|+.+|+++|+++|++||++|++||++|....++++. +
T Consensus 291 Fss~i~~f~l~~~i~~~~~G~~g~f~~~GLi~f~vf~~~~~y~~~el~~f~~iGViGGlLGalfN~Ln~~~~~~r~~--~ 368 (762)
T KOG0474|consen 291 FSSAIVAFVLRAFILSCLSGKCGLFGKGGLINFDVFDGPVDYHIHELPPFLLIGVIGGLLGALFNYLNLKKVLRRYN--Y 368 (762)
T ss_pred HHhHHHHHhHHHHHHHHhcCchhccCCcceEEecccCCccccccccccceeEeehhhhhHHHHHHHHHHHHHHHHHh--c
Confidence 99999999999999999999999999999999999977779999999999999999999999999666555554443 5
Q ss_pred ccCCccchhhhHHHHHHHHHHHhcccccccCCCCCCCCCCCCCCCCCCCCCCCccccccccCCCccchhhhhhccCcHHH
Q 004131 353 KKGNRVKIIEACVISVITSVISFGLPLLRKCSPCPESDLDSGIECPRPPGMYGNYVNFYCSKDKEYNDLATIFFNTQDDA 432 (772)
Q Consensus 353 ~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~c~~~~~~~~~~~~~~~~~~g~~g~~~~~~c~~g~~y~~la~l~~~~~~~~ 432 (772)
.|.+..|++++++++++|+++.|.+|++.+|+|||.+..+ .+|| +|+||+|+ |||+|+++|+|+||+
T Consensus 369 ~k~k~~kvlea~~Vs~~ts~~af~l~~l~~C~P~~~~~~~--~~~p----------~f~Cp~~~-YNdlAtL~fnt~dda 435 (762)
T KOG0474|consen 369 EKGKIGKVLEALLVSLVTSVLAFGLPFLADCQPCPPSITE--GQCP----------TFFCPDGE-YNDLATLFFNTNDDA 435 (762)
T ss_pred cCchHHHHHHHHHHHHHHHHHHhhhHHHhcCCCCCCCccc--ccCc----------cccCCCCc-hhHHHHHHcCCcHHH
Confidence 6677889999999999999999999999999999974322 1455 48999998 999999999999999
Q ss_pred HHHhhcccCCCcchHHHHHHHHHHHHHHHHHHhcCccCcccchhHHHHHHHHHHHHHHHHHHhhhcCCCchHHHHHHHhh
Q 004131 433 IRNLFSAKTIHEYSAQSLLTFLVMFYTLAVVTFGIAVPAGQFVPGIMIGSTYGRLVGMFVVNFYKKLNIEEGTYALLGAA 512 (772)
Q Consensus 433 i~~l~~~~~~~~~~~~~l~~~~~~k~~~t~~t~g~g~~gG~f~P~l~iGa~~G~l~g~~~~~~~~~~~~~~~~~aliGaa 512 (772)
+|++||.++ ++|++.+|++|++++++++++|||+.+|+|+|+|++++||++||++|+++..++ ++|||.||++|||
T Consensus 436 VrnLFh~~~-~ef~~~tL~iFfv~yf~L~~~TfGi~vpsGlFiP~iL~GAa~GRlvg~~l~~~~---~id~G~yAllGAA 511 (762)
T KOG0474|consen 436 VRNLFHSPT-NEFGILTLAIFFVLYFFLACWTFGIAVPSGLFIPVILTGAAYGRLVGMLLGSYT---NIDPGLYALLGAA 511 (762)
T ss_pred HHHHhcCCC-CccchhHHHHHHHHHHHHHHHHhcccccccchhHHHHhhHHHHHHHHHHHHHhh---ccCchHHHHHhHH
Confidence 999999877 999999999999999999999999999999999999999999999999999887 8999999999999
Q ss_pred hhhhccccchhHHhHHHHHhcCCcchHHHHHHHHHHHHHHHhhcCcchHHHHHHhhCCCCCCCCchhhhhccchhhhccC
Q 004131 513 SFLGGSMRMTVSLCVIMVEITNNLKFLPLIMLVLLISKAVGDAFSEGLYEEQAHLRGVPLLESRPKYKMRQMTAKEACGA 592 (772)
Q Consensus 513 a~l~g~~r~pis~~vi~~E~Tg~~~~l~pimia~~va~~v~~~~~~~iy~~~l~~kg~p~L~~~~~~~l~~l~v~diM~~ 592 (772)
|++||++|||+|+|||++|+| +..+++|+|++.++|+||+|.||+++||.++++|++|+|++++++++++++++|+|++
T Consensus 512 a~LGG~mRMTvSL~VIl~E~T-n~~~~lPiMlvLliaK~VGD~FNegiYd~~i~LkgvP~Le~~pe~~mr~L~a~ev~~~ 590 (762)
T KOG0474|consen 512 AFLGGVMRMTVSLCVILLELT-NNLLLLPIMLVLLIAKTVGDSFNEGIYDIIIQLKGVPFLEWEPEPYMRNLTAGEVMSK 590 (762)
T ss_pred HHhCCeEEEEeeeehHHHHhh-hhhhhhHHHHHHHHHHHHHhhhhhhhHHHhhhccCCccccCCCchHhhhhhHhhhccC
Confidence 999999999999999999999 5788888999999999999999999999999999999999999999999999999999
Q ss_pred CceEEecCcccHHHHHHHHhhCCCCeeEEEeCCCCCC-cEEEEeeeHHHHHHHHhcccccCCCCCCCCCCCCCCCccccc
Q 004131 593 QKVVSLPRIIKVADVVSILRTNKHNGFPVIDHSRNGE-RLVIGLVLRSHLLVLLQSKVDFQHSPLPCDTRGGSKPISHSF 671 (772)
Q Consensus 593 ~~vv~v~~~~tv~~~~~~L~~~~~~~fPVVd~~~~~~-~~lvGiItr~dL~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~ 671 (772)
+ +++++..+++..++++|++++||+|||||+.+.++ +++.|+|.|+|++.+|+++. |.++......+. .....++
T Consensus 591 p-vi~l~~~ekV~~Iv~vLk~t~HngFPVvd~~~~~~~~~l~GlILRshl~vlL~~~~-f~~~~~~~~~~~--~~~~~~~ 666 (762)
T KOG0474|consen 591 P-VICLNRVEKVAVIVDVLKSTNHNGFPVVDEPPSNEAGRLHGLILRSHLLVLLKKRV-FVEESRSTFDLP--VRRKFTF 666 (762)
T ss_pred C-eEEEechhhHHHHHHHHHhcCcCCCccccCCCCccchhhhHHHHHHHHHHHHHhhh-hhccCccccCcc--hhhcCCH
Confidence 9 99999999999999999999999999999865333 68999999999999999988 554332222110 0011122
Q ss_pred cccccccCCCCCCcccccCCcccccccccccccccCCCceecCCCCHHHHHHHHHHcCCCEEEEecCCCeEEEEEeHhhh
Q 004131 672 SEFVKPASSKGLSIDDIHLSSDDMEMYIDLGPFLNPSPYVVPEDMSLSKVYNLFRQLGLRHIFVVPRASRVIGLITRKDL 751 (772)
Q Consensus 672 ~~~~~~~~~~~~~v~di~~~~~~~~~~idl~~~m~~~p~~V~~~~sL~~a~~lf~~~glr~lpVVd~~g~lvGIITr~DL 751 (772)
+++++ +.++++|+.++++|+++++|++|+||++|++|++++|+.+++.+||+.|+||+.||++.++++|++||+|+
T Consensus 667 ~d~a~----r~~~i~dv~lt~~e~~~yvDl~p~~n~sPytV~~~mSl~k~~~lFR~lGLRhLlVv~~~~~~~gilTR~D~ 742 (762)
T KOG0474|consen 667 RDFAK----REPSIEDVHLTSEEMEMYVDLHPFMNPSPYTVPETMSLAKAFILFRQLGLRHLLVVPKTNRVVGILTRKDL 742 (762)
T ss_pred HHhhh----cCCchhhhhcchHhHhhccccccccCCCCcccCcccchHHHHHHHHHhcceeEEEecCCCceeEEEehhhh
Confidence 22333 56789999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhHhcCC
Q 004131 752 LIEDGED 758 (772)
Q Consensus 752 l~~~~~~ 758 (772)
.++...+
T Consensus 743 ~~~~~l~ 749 (762)
T KOG0474|consen 743 ARYRILG 749 (762)
T ss_pred hhHHHhc
Confidence 9876433
|
|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03685 ClC_6_like ClC-6-like chloride channel proteins | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd03684 ClC_3_like ClC-3-like chloride channel proteins | Back alignment and domain information |
|---|
| >cd03683 ClC_1_like ClC-1-like chloride channel proteins | Back alignment and domain information |
|---|
| >cd01036 ClC_euk Chloride channel, ClC | Back alignment and domain information |
|---|
| >cd01031 EriC ClC chloride channel EriC | Back alignment and domain information |
|---|
| >PRK01610 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >PRK05277 chloride channel protein; Provisional | Back alignment and domain information |
|---|
| >COG0038 EriC Chloride channel protein EriC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00654 Voltage_CLC: Voltage gated chloride channel Mutation in several of these channels lead to human disease | Back alignment and domain information |
|---|
| >cd01033 ClC_like Putative ClC chloride channel | Back alignment and domain information |
|---|
| >cd01034 EriC_like ClC chloride channel family | Back alignment and domain information |
|---|
| >cd00400 Voltage_gated_ClC CLC voltage-gated chloride channel | Back alignment and domain information |
|---|
| >cd03682 ClC_sycA_like ClC sycA-like chloride channel proteins | Back alignment and domain information |
|---|
| >PRK03655 putative ion channel protein; Provisional | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01034 EriC_like ClC chloride channel family | Back alignment and domain information |
|---|
| >cd01033 ClC_like Putative ClC chloride channel | Back alignment and domain information |
|---|
| >PRK05277 chloride channel protein; Provisional | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd00400 Voltage_gated_ClC CLC voltage-gated chloride channel | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >PRK01610 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd03682 ClC_sycA_like ClC sycA-like chloride channel proteins | Back alignment and domain information |
|---|
| >cd01031 EriC ClC chloride channel EriC | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >PF00654 Voltage_CLC: Voltage gated chloride channel Mutation in several of these channels lead to human disease | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd03684 ClC_3_like ClC-3-like chloride channel proteins | Back alignment and domain information |
|---|
| >COG0038 EriC Chloride channel protein EriC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >PRK03655 putative ion channel protein; Provisional | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03685 ClC_6_like ClC-6-like chloride channel proteins | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01036 ClC_euk Chloride channel, ClC | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03683 ClC_1_like ClC-1-like chloride channel proteins | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown] | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 772 | ||||
| 3org_A | 632 | Crystal Structure Of A Eukaryotic Clc Transporter L | 5e-15 | ||
| 1kpl_A | 473 | Crystal Structure Of The Clc Chloride Channel From | 6e-11 | ||
| 1kpl_A | 473 | Crystal Structure Of The Clc Chloride Channel From | 5e-06 | ||
| 3nd0_A | 466 | X-Ray Crystal Structure Of A Slow Cyanobacterial Cl | 6e-08 | ||
| 3nmo_A | 465 | Crystal Structure Of An Engineered Monomeric Clc-Ec | 1e-07 | ||
| 2ht4_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 2e-07 | ||
| 2ht2_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 2e-07 | ||
| 2ez0_A | 473 | Crystal Structure Of The S107aE148QY445A MUTANT OF | 2e-07 | ||
| 2htk_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 2e-07 | ||
| 3det_A | 473 | Structure Of The E418a, Y445a Doubly Ungated Mutant | 2e-07 | ||
| 3ejy_A | 473 | Structure Of E203h Mutant Of E.Coli Cl-H+ ANTIPORTE | 2e-07 | ||
| 3ejz_A | 473 | Structure Of E203v Mutant E.Coli Cl-H+ EXCHANGER, C | 2e-07 | ||
| 1kpk_A | 473 | Crystal Structure Of The Clc Chloride Channel From | 2e-07 | ||
| 2ht3_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 2e-07 | ||
| 2exy_A | 473 | Crystal Structure Of The E148q Mutant Of Ecclc, Fab | 2e-07 | ||
| 2htl_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 2e-07 | ||
| 2fec_A | 465 | Structure Of The E203q Mutant Of The Cl-H+ EXCHANGE | 2e-07 | ||
| 1otu_A | 465 | Structure Of The Escherichia Coli Clc Chloride Chan | 2e-07 | ||
| 1ots_A | 465 | Structure Of The Escherichia Coli Clc Chloride Chan | 2e-07 | ||
| 4ftp_A | 465 | Structure Of The E202y Mutant Of The Cl-H+ ANTIPORT | 2e-07 | ||
| 1ott_A | 465 | Structure Of The Escherichia Coli Clc Chloride Chan | 2e-07 | ||
| 2hlf_A | 444 | Structure Of The Escherichis Coli Clc Chloride Chan | 2e-07 | ||
| 2r9h_A | 444 | Crystal Structure Of Q207c Mutant Of Clc-Ec1 In Com | 2e-07 | ||
| 4ene_A | 446 | Structure Of The N- And C-Terminal Trimmed Clc-Ec1 | 2e-07 |
| >pdb|3ORG|A Chain A, Crystal Structure Of A Eukaryotic Clc Transporter Length = 632 | Back alignment and structure |
|
| >pdb|1KPL|A Chain A, Crystal Structure Of The Clc Chloride Channel From S. Typhimurium Length = 473 | Back alignment and structure |
| >pdb|1KPL|A Chain A, Crystal Structure Of The Clc Chloride Channel From S. Typhimurium Length = 473 | Back alignment and structure |
| >pdb|3ND0|A Chain A, X-Ray Crystal Structure Of A Slow Cyanobacterial Cl-H+ ANTIPORTER Length = 466 | Back alignment and structure |
| >pdb|3NMO|A Chain A, Crystal Structure Of An Engineered Monomeric Clc-Ec1 Cl-H+ Transporter Length = 465 | Back alignment and structure |
| >pdb|2HT4|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445w Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|2HT2|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445h Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|2EZ0|A Chain A, Crystal Structure Of The S107aE148QY445A MUTANT OF ECCLC, In Complex With A Fab Fragment Length = 473 | Back alignment and structure |
| >pdb|2HTK|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445a Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|3DET|A Chain A, Structure Of The E418a, Y445a Doubly Ungated Mutant Of E.Coli Clc_ec1, Cl-H+ ANTIPORTER Length = 473 | Back alignment and structure |
| >pdb|3EJY|A Chain A, Structure Of E203h Mutant Of E.Coli Cl-H+ ANTIPORTER, CLC- Ec1 Length = 473 | Back alignment and structure |
| >pdb|3EJZ|A Chain A, Structure Of E203v Mutant E.Coli Cl-H+ EXCHANGER, CLC-Ec1 Length = 473 | Back alignment and structure |
| >pdb|1KPK|A Chain A, Crystal Structure Of The Clc Chloride Channel From E. Coli Length = 473 | Back alignment and structure |
| >pdb|2HT3|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445l Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|2EXY|A Chain A, Crystal Structure Of The E148q Mutant Of Ecclc, Fab Complexed In Absence Of Bound Ions Length = 473 | Back alignment and structure |
| >pdb|2HTL|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445f Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|2FEC|A Chain A, Structure Of The E203q Mutant Of The Cl-H+ EXCHANGER CLC- Ec1 From E.Coli Length = 465 | Back alignment and structure |
| >pdb|1OTU|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel E148q Mutant And Fab Complex Length = 465 | Back alignment and structure |
| >pdb|1OTS|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel And Fab Complex Length = 465 | Back alignment and structure |
| >pdb|4FTP|A Chain A, Structure Of The E202y Mutant Of The Cl-H+ ANTIPORTER CLC-Ec1 From E.Coli Length = 465 | Back alignment and structure |
| >pdb|1OTT|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel E148a Mutant And Fab Complex Length = 465 | Back alignment and structure |
| >pdb|2HLF|A Chain A, Structure Of The Escherichis Coli Clc Chloride Channel Y445e Mutant And Fab Complex Length = 444 | Back alignment and structure |
| >pdb|2R9H|A Chain A, Crystal Structure Of Q207c Mutant Of Clc-Ec1 In Complex With Fab Length = 444 | Back alignment and structure |
| >pdb|4ENE|A Chain A, Structure Of The N- And C-Terminal Trimmed Clc-Ec1 Cl-H+ ANTIPORTER And Fab Complex Length = 446 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 772 | |||
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 1e-176 | |
| 1ots_A | 465 | Voltage-gated CLC-type chloride channel ERIC; CLC | 3e-65 | |
| 3nd0_A | 466 | SLL0855 protein; CLC family CL-/H+ antiporter, CLC | 6e-63 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 7e-33 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 5e-20 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 4e-05 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 5e-14 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 2e-13 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 6e-11 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 9e-09 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 5e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 1e-07 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 2e-07 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 8e-07 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 8e-05 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 2e-07 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 4e-07 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 4e-07 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 6e-04 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 2e-06 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 5e-05 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 2e-06 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 2e-06 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 4e-06 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 4e-05 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 4e-06 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 6e-06 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 8e-06 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 1e-05 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 1e-04 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 1e-05 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 1e-04 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 4e-05 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 4e-05 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 6e-05 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 8e-05 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 8e-05 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 2e-04 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 3e-04 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 3e-04 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 5e-04 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 6e-04 |
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Length = 632 | Back alignment and structure |
|---|
Score = 518 bits (1336), Expect = e-176
Identities = 152/687 (22%), Positives = 281/687 (40%), Gaps = 79/687 (11%)
Query: 72 VVVKWFFALLIGIGTGLAAVFINISVENFAGWKFSLTFSIIQKSYFAGFLVYILINLILV 131
++ F L+G+ L ++++V + ++ FAG+++Y++ + L
Sbjct: 7 LLRLVCFLTLLGVTAALFIFAVDLAVHGLEELRMKISRLA---GRFAGYILYVVSGVALC 63
Query: 132 FSSVYIITKFAPAAAGSGIPEIKGYLNGV--DIHGILLFRTLIGKIFGSIGSVGGGLALG 189
S + + A GSG+P++K L+G + L R L K G I ++GGGL +G
Sbjct: 64 LLSTFWCAVLSTEAEGSGLPQMKSILSGFYDKMRSALELRVLFAKALGLICAIGGGLPVG 123
Query: 190 KEGPLVHTGACIASLLGQGGSTKYHLRYRWLQVFRSDRDRRDLVTCGCAAGVAAAFRAPV 249
EGP VH IA + G + ++ R + CA G+A++F AP+
Sbjct: 124 WEGPNVHIACIIAHQFYRLG--------VFKELCTDRALRLQTLAAACAVGLASSFGAPL 175
Query: 250 GGVLFALEEVTSWWRSQLMWRVFFTSAIVAVVVRSAMGWCKSGKCGHFGSGGFIIWDISD 309
GGVL+++E + S++ Q W+ ++ A+V F F
Sbjct: 176 GGVLYSIETIASFYLVQAFWKGVLSALSGAIVYELLYTT---PLVEAFEGTNFDAS---- 228
Query: 310 GQEDYSFEELLPMAVIGVIGGLLGALFNQLTLYMTSWRRNYLHKKGNRVKIIEACVISVI 369
D S + L A++G + G+LGALF + + R + + V+++
Sbjct: 229 ---DVSRTQTLLYAILGALMGVLGALFIRCVRSIYELRMRHYPGTN---RYFLVGVVALF 282
Query: 370 TSVISFGLPLLRKCSPCPESDLDSGIECPRPPGMYGNYVNFYCSKDKEYNDLATIFFNTQ 429
S + + L NDL Q
Sbjct: 283 ASALQYPFRLFALDPR------------------------------ATINDLFKAVPLYQ 312
Query: 430 DDAIRNLFSAKTIHEYSAQSLLTFLVMFYTLAVVTFGIAVPAGQFVPGIMIGSTYGRLVG 489
D + L+ ++ + L ++ G+ +PAG FVP +IG+ +GRL G
Sbjct: 313 TD------------HFGWTELILMPIIKFILVALSIGLPLPAGVFVPSFLIGAGFGRLYG 360
Query: 490 MFVVNFYKKLNIEEGTYALLGAASFLGGSMRMTVSLCVIMVEITNNLKFLPLIMLVLLIS 549
+ + I G+YA++GAA+F G R +S VI+ E+T ++ L +++ +L++
Sbjct: 361 ELMRVVFGN-AIVPGSYAVVGAAAFTAGVTR-ALSCAVIIFEVTGQIRHLVPVLISVLLA 418
Query: 550 KAVGDAFSEGLYEEQAHLRGVPLLESRPKYKMRQMTAKEACGAQK-VVSLPRIIKVADVV 608
VG+AF+ LYE ++ +P + + + +MTA+E + L + +
Sbjct: 419 VIVGNAFNRSLYETLVLMKHLPYMPILRRDRSPEMTAREIMHPIEGEPHLFPDSEPQHIK 478
Query: 609 SILRTNK-HNGFPVIDHSRNGERLVIGLVLRSHLLVLLQSKVDFQHSPLPCDTRGG--SK 665
IL FPVID + ++G + R ++ LQ ++ P+
Sbjct: 479 GILEKFPNRLVFPVIDANGY----LLGAISRKEIVDRLQHVLEDVPEPIAGHRTLVLLDA 534
Query: 666 PISHSFSEFVKPASSKGLSIDDIHLSSDDMEMYIDLGPFLNPSPYVVPEDMSLSKVYNLF 725
E + + G ++ +E L + SP VV + +++ LF
Sbjct: 535 ADLSENIEGLVDETPSGEHSSKGKRTATVLEPTSSLVVPCDVSPIVVTSYSLVRQLHFLF 594
Query: 726 RQLGLRHIFVVPRASRVIGLITRKDLL 752
L I+V R +++G++ R+D+
Sbjct: 595 VMLMPSMIYVTER-GKLVGIVEREDVA 620
|
| >1ots_A Voltage-gated CLC-type chloride channel ERIC; CLC chloride channel, FAB complex, membrane protein; 2.51A {Escherichia coli} SCOP: f.20.1.1 PDB: 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2htl_A 3ejy_A 2ht2_A 2fed_A 2fec_A 1otu_A 3ejz_A 2ht4_A 2htk_A 2ht3_A 1ott_A 2h2s_A 3det_A 2ez0_A 3nmo_A ... Length = 465 | Back alignment and structure |
|---|
| >3nd0_A SLL0855 protein; CLC family CL-/H+ antiporter, CLC_EC1 homolog, transport protein; 3.20A {Synechocystis} PDB: 3q17_A Length = 466 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Length = 250 | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Length = 250 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 772 | |||
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 100.0 | |
| 3nd0_A | 466 | SLL0855 protein; CLC family CL-/H+ antiporter, CLC | 100.0 | |
| 1ots_A | 465 | Voltage-gated CLC-type chloride channel ERIC; CLC | 100.0 | |
| 4ene_A | 446 | CLC-EC1, H(+)/CL(-) exchange transporter CLCA; mem | 100.0 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 99.85 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.75 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 99.72 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 99.72 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 99.71 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 99.71 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.71 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 99.7 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 99.7 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.7 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 99.7 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.69 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 99.69 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 99.69 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 99.68 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 99.68 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 99.67 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 99.67 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 99.67 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 99.66 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 99.66 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 99.66 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 99.66 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 99.65 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.65 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 99.64 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 99.64 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 99.64 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.64 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 99.64 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 99.64 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 99.62 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 99.61 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 99.61 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 99.61 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 99.6 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 99.6 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 99.6 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 99.6 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 99.59 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 99.56 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 99.55 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.54 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.54 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 99.53 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.52 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.5 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.49 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.47 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 99.44 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.43 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.43 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.42 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.39 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.35 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.34 | |
| 4ene_A | 446 | CLC-EC1, H(+)/CL(-) exchange transporter CLCA; mem | 99.33 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 99.32 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 99.31 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.3 | |
| 1ots_A | 465 | Voltage-gated CLC-type chloride channel ERIC; CLC | 99.3 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 99.29 | |
| 3nd0_A | 466 | SLL0855 protein; CLC family CL-/H+ antiporter, CLC | 99.27 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 99.27 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 99.26 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 99.25 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.21 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 99.2 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.17 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.13 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 99.12 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 98.51 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.5 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.43 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 98.3 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 98.29 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.27 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 98.21 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 98.21 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 98.18 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.17 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 98.16 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 98.16 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 98.15 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 98.15 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 98.14 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 98.12 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 98.1 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 98.09 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 98.09 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 98.08 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 98.08 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 98.07 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 98.05 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 98.02 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 98.02 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 98.01 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 98.0 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 98.0 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 97.99 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 97.98 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 97.98 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 97.98 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 97.98 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 97.97 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 97.97 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 97.96 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 97.92 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 97.91 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 97.89 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 97.86 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 97.86 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 97.83 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 97.8 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 97.7 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 97.68 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 97.63 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 97.61 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 97.4 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 97.26 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 97.25 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 97.09 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 96.99 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 96.98 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 96.63 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 96.61 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 96.28 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 96.28 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 96.09 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 96.0 |
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
Probab=100.00 E-value=3e-87 Score=785.78 Aligned_cols=603 Identities=24% Similarity=0.411 Sum_probs=450.0
Q ss_pred HHHH-HHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHhhhccccccCCCHHH
Q 004131 74 VKWF-FALLIGIGTGLAAVFINISVENFAGWKFSLTFSIIQKSYFAGFLVYILINLILVFSSVYIITKFAPAAAGSGIPE 152 (772)
Q Consensus 74 ~~w~-~~~liGv~~Gl~a~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~p~a~GsGipe 152 (772)
.||+ +++++|+++|+++++++..++++++++.... +...+ ...|+.|+.+++++++++++++++++|.++||||||
T Consensus 8 ~r~~~~~~lvGi~~gl~~~~~~~~i~~~~~~~~~~~-~~~~~--~~~~~~~~~~~~~~~~~~~~l~~~~~p~a~GsGIp~ 84 (632)
T 3org_A 8 LRLVCFLTLLGVTAALFIFAVDLAVHGLEELRMKIS-RLAGR--FAGYILYVVSGVALCLLSTFWCAVLSTEAEGSGLPQ 84 (632)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHSCH--HHHHHHHHHHHHHHHHHHHHHHHHSCGGGCBCSHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHhhh--hHHHHHHHHHHHHHHHHHHHHHHhcCCccCCCCHHH
Confidence 3555 7899999999999999999999998764332 22222 445667777888888899999999999999999999
Q ss_pred HHHHHcccc--ccCchhHHHHHHHHhhhhhhccccccccCcchHHHHHHHHHHHhhccCccccchhhhhhc-ccCChhhh
Q 004131 153 IKGYLNGVD--IHGILLFRTLIGKIFGSIGSVGGGLALGKEGPLVHTGACIASLLGQGGSTKYHLRYRWLQ-VFRSDRDR 229 (772)
Q Consensus 153 v~~~l~g~~--~~~~l~~~~l~~K~~~~~~sv~sG~svG~EGP~v~iGa~ig~~l~~~~~~~~~l~~~~~~-~f~~~~~~ 229 (772)
||++++|.. +++.+++|+++.|++++++++++|+|+|||||++|+||++|+.+++. ++++ .++++++|
T Consensus 85 v~~~l~g~~~~~~~~~~~~~~~~K~~~~~l~igsG~s~GrEGP~vqiGa~ig~~~~~~---------~~f~~~~~~~~~~ 155 (632)
T 3org_A 85 MKSILSGFYDKMRSALELRVLFAKALGLICAIGGGLPVGWEGPNVHIACIIAHQFYRL---------GVFKELCTDRALR 155 (632)
T ss_dssp HHHHTTTTHHHHGGGGSHHHHHHHHHHHHHHHHTTCSCBSHHHHHHHHHHHHHHHTTS---------HHHHHHHHSHHHH
T ss_pred HHHHHhCccccccccccHHHHHHHHHHHHHHHhcCCCccccchHHHHHHHHHHHHhhh---------hhhccccCCHHHH
Confidence 999999976 67889999999999999999999999999999999999999988751 0222 22378899
Q ss_pred hhHHHhhhhhhhhhhhcCCccceeeeeeecchhhhhhhHHHHHHHHHHHHHHHHHhhhhccCCcccccCCCceEEEecCC
Q 004131 230 RDLVTCGCAAGVAAAFRAPVGGVLFALEEVTSWWRSQLMWRVFFTSAIVAVVVRSAMGWCKSGKCGHFGSGGFIIWDISD 309 (772)
Q Consensus 230 r~li~~GaaAgvaaaF~APigGvlFalE~~~~~~~~~~~~~~~~~~~va~~v~~~~~~~~~~~~~~~~~~~~~~~f~~~~ 309 (772)
|++++||+|||+||+|||||+|++|++||+.++|+.+.+|+++++|++++++++.+... ......|+. .|++
T Consensus 156 r~ll~aGaaAG~aaaF~aPlaGvlFalE~~~~~~~~~~~~~~~~as~~a~~v~~~~~~~--~~~~~~~~~----~~~~-- 227 (632)
T 3org_A 156 LQTLAAACAVGLASSFGAPLGGVLYSIETIASFYLVQAFWKGVLSALSGAIVYELLYTT--PLVEAFEGT----NFDA-- 227 (632)
T ss_dssp HHHHHHHHHHHHHHHHTCHHHHHHHHHHHTCSEEETTHHHHHHHHHHHHHHHTTC-------------------------
T ss_pred HHHHHHHHHHHHHHHhCCccHhHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHhccC--ccccccccc----cccc--
Confidence 99999999999999999999999999999999999999999999999999887643210 000011111 1222
Q ss_pred CCCCCChhhHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHhhhcccCCccchhhhHHHHHHHHHHHhcccccccCCCCCCC
Q 004131 310 GQEDYSFEELLPMAVIGVIGGLLGALFNQLTLYMTSWRRNYLHKKGNRVKIIEACVISVITSVISFGLPLLRKCSPCPES 389 (772)
Q Consensus 310 ~~~~~~~~~l~~~~~lGv~~Gl~g~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~c~~~~~~ 389 (772)
..++++.++ +++++|++||++|++|+++++...++ +.++..+.+|++++++++++++++. .|..
T Consensus 228 -~~~~~~~~l-~~~~lGi~~Gl~g~~f~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~l~--~p~~--------- 291 (632)
T 3org_A 228 -SDVSRTQTL-LYAILGALMGVLGALFIRCVRSIYEL---RMRHYPGTNRYFLVGVVALFASALQ--YPFR--------- 291 (632)
T ss_dssp --CCCCSCTH-HHHHHHHHHHHHHHHHHHHHHHHHHH---HHHSSTTCCTHHHHHHHHHHHHHHT--TTC----------
T ss_pred -cCCCcHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHH---HHHhhcchhHHHHHHHHHHHHHHHH--HHHH---------
Confidence 235778889 99999999999999999555544333 2222223457778887777766532 2221
Q ss_pred CCCCCCCCCCCCCCCCccccccccCCCccchhhhhhccCcHHHHHHhhcccCC---CcchHHHHHHHHHHHHHHHHHHhc
Q 004131 390 DLDSGIECPRPPGMYGNYVNFYCSKDKEYNDLATIFFNTQDDAIRNLFSAKTI---HEYSAQSLLTFLVMFYTLAVVTFG 466 (772)
Q Consensus 390 ~~~~~~~~~~~~g~~g~~~~~~c~~g~~y~~la~l~~~~~~~~i~~l~~~~~~---~~~~~~~l~~~~~~k~~~t~~t~g 466 (772)
.| . + +.++.++.+|++.+. +.+.+..+++++++|+++|++|+|
T Consensus 292 -----------~g-------------~-~---------~~~~~i~~l~~~~~~~~~~~~~~~~l~~~~~~k~~~t~~s~g 337 (632)
T 3org_A 292 -----------LF-------------A-L---------DPRATINDLFKAVPLYQTDHFGWTELILMPIIKFILVALSIG 337 (632)
T ss_dssp ---------------------------------------CHHHHHHHHSCC----------CCSSHHHHHHHHHHHHHTT
T ss_pred -----------hc-------------C-C---------cHHHHHHHHHcCCccccccchhHHHHHHHHHHHHHHHHHHHh
Confidence 01 0 0 112445555543221 133445677889999999999999
Q ss_pred CccCcccchhHHHHHHHHHHHHHHHHHHhhhcCCCchHHHHHHHhhhhhhccccchhHHhHHHHHhcCCcchHHHHHHHH
Q 004131 467 IAVPAGQFVPGIMIGSTYGRLVGMFVVNFYKKLNIEEGTYALLGAASFLGGSMRMTVSLCVIMVEITNNLKFLPLIMLVL 546 (772)
Q Consensus 467 ~g~~gG~f~P~l~iGa~~G~l~g~~~~~~~~~~~~~~~~~aliGaaa~l~g~~r~pis~~vi~~E~Tg~~~~l~pimia~ 546 (772)
+|+|||+|+|++++||++|+++|.+++.++|. .++|+.||++||||+++|++|+|+++ ||++|+||++++++|+|+++
T Consensus 338 ~g~pGGif~P~l~iGA~~G~~~g~~~~~~~p~-~~~p~~~a~vGmaa~~~~v~~ap~t~-vi~~E~tg~~~~~lpl~ia~ 415 (632)
T 3org_A 338 LPLPAGVFVPSFLIGAGFGRLYGELMRVVFGN-AIVPGSYAVVGAAAFTAGVTRALSCA-VIIFEVTGQIRHLVPVLISV 415 (632)
T ss_dssp SSSBCBCHHHHHHHHHHHHHHHHHHHHHHHCT-TSCHHHHHHHHHHHHHHHHSCCTTHH-HHHHHHTCCCSCSHHHHHHH
T ss_pred CCCcchhhHHHHHHHHHHHHHHHHHHHHhCCc-ccchHHHHHHHHHHHHHHHHHHHHHH-HHHHHHhCChhHHHHHHHHH
Confidence 99999999999999999999999999887753 37899999999999999999998876 58999999999999999999
Q ss_pred HHHHHHHhhcCcchHHHHHHhhCCCCCCCCchhhhhccchhhhcc--CCceEEecCcccHHHHHHHHh-hCCCCeeEEEe
Q 004131 547 LISKAVGDAFSEGLYEEQAHLRGVPLLESRPKYKMRQMTAKEACG--AQKVVSLPRIIKVADVVSILR-TNKHNGFPVID 623 (772)
Q Consensus 547 ~va~~v~~~~~~~iy~~~l~~kg~p~L~~~~~~~l~~l~v~diM~--~~~vv~v~~~~tv~~~~~~L~-~~~~~~fPVVd 623 (772)
++|+++++.+++++||.+++.|++|++++..++..++++|+|+|+ ++ +++++++++++|+.+.|+ +++++++||+|
T Consensus 416 ~~a~~v~~~~~~~iY~~~~~~k~lp~l~~~~~~~~~~~~V~diM~p~~~-v~~v~~~~t~~e~~~~~~~~~~~~~~PVvd 494 (632)
T 3org_A 416 LLAVIVGNAFNRSLYETLVLMKHLPYMPILRRDRSPEMTAREIMHPIEG-EPHLFPDSEPQHIKGILEKFPNRLVFPVID 494 (632)
T ss_dssp HHHHHHHHHHCCCHHHHHHHHTTCCEEEEECTTCCTTSBHHHHCBCTTT-SCCBCSSSCHHHHHHHHHHSTTCCEECBBC
T ss_pred HHHHHHHHHhCCCHHHHHHHhcCCCccccccccccccCcHHHHhhcCCC-ceEecCCCcHHHHHHHHHhcCCcceEEEEe
Confidence 999999999989999999999999998866666668999999999 78 999999999999999999 89999999999
Q ss_pred CCCCCCcEEEEeeeHHHHHHHHhcccccCCCCCCCCCCCCCCCcccccc--ccccccCCCCCCcc-cccCCccc-----c
Q 004131 624 HSRNGERLVIGLVLRSHLLVLLQSKVDFQHSPLPCDTRGGSKPISHSFS--EFVKPASSKGLSID-DIHLSSDD-----M 695 (772)
Q Consensus 624 ~~~~~~~~lvGiItr~dL~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~v~-di~~~~~~-----~ 695 (772)
++ ++++|+|+++|+++.+.++....+++ .+.+ +....+. .+.+.......... .......+ .
T Consensus 495 ~~----~~lvGiVt~~DL~~~l~~~~~~~~~~--~~~~----~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~e~~~~~~ 564 (632)
T 3org_A 495 AN----GYLLGAISRKEIVDRLQHVLEDVPEP--IAGH----RTLVLLDAADLSENIEGLVDETPSGEHSSKGKRTATVL 564 (632)
T ss_dssp TT----CBBCCEESHHHHTTTTTTC-------------------------------------------------------
T ss_pred cC----CeEEEEEEHHHHHHHHHHHhhhcccc--cccc----cceeccCHHHHHhhcccCCCCCcccchhhhcccceEee
Confidence 86 89999999999988765432011110 0000 0000000 00000000000000 00000000 0
Q ss_pred cccccccccccCCCceecCCCCHHHHHHHHHHcCCCEEEEecCCCeEEEEEeHhhhhhHhcCCCc
Q 004131 696 EMYIDLGPFLNPSPYVVPEDMSLSKVYNLFRQLGLRHIFVVPRASRVIGLITRKDLLIEDGEDST 760 (772)
Q Consensus 696 ~~~idl~~~m~~~p~~V~~~~sL~~a~~lf~~~glr~lpVVd~~g~lvGIITr~DLl~~~~~~~~ 760 (772)
+..-+++++|+++|.+|++++++.++.++|++++.+++||+ ++|+++||||++|+++.+.++.+
T Consensus 565 ~~~~~v~~iMt~~pitV~~~~~l~ea~~~M~~~~i~~lpVv-e~G~lvGIVT~~Dll~~~~~~~~ 628 (632)
T 3org_A 565 EPTSSLVVPCDVSPIVVTSYSLVRQLHFLFVMLMPSMIYVT-ERGKLVGIVEREDVAYGYSNSLE 628 (632)
T ss_dssp ------CCSCCCCCCEEETTCBHHHHHHHHHHTCCSEEEEE-ETTEEEEEEEGGGTEECCCC---
T ss_pred ccccccchhhcCCCceecCCCcHHHHHHHHHhcCCCEEEEE-ECCEEEEEEehhhHHHHHhhhHH
Confidence 11113788999999999999999999999999999999999 55999999999999998876543
|
| >3nd0_A SLL0855 protein; CLC family CL-/H+ antiporter, CLC_EC1 homolog, transport protein; 3.20A {Synechocystis} PDB: 3q17_A | Back alignment and structure |
|---|
| >1ots_A Voltage-gated CLC-type chloride channel ERIC; CLC chloride channel, FAB complex, membrane protein; 2.51A {Escherichia coli} SCOP: f.20.1.1 PDB: 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2htl_A 3ejy_A 2ht2_A 2fed_A 2fec_A 1otu_A 3ejz_A 2ht4_A 2htk_A 2ht3_A 1ott_A 2h2s_A 3det_A 2ez0_A 3nmo_A ... | Back alignment and structure |
|---|
| >4ene_A CLC-EC1, H(+)/CL(-) exchange transporter CLCA; membrane protein, coupled ION transporter, cell membrane, TR protein; HET: DMU MAL; 2.40A {Escherichia coli k-12} PDB: 1ots_A 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2fed_A 2fec_A 1otu_A 2htl_A 2ht2_A 3ejy_A 1ott_A 2h2s_A 4fg6_A 2ht4_A 4ftp_A 3ejz_A 2ht3_A 2htk_A ... | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >4ene_A CLC-EC1, H(+)/CL(-) exchange transporter CLCA; membrane protein, coupled ION transporter, cell membrane, TR protein; HET: DMU MAL; 2.40A {Escherichia coli k-12} PDB: 1ots_A 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2fed_A 2fec_A 1otu_A 2htl_A 2ht2_A 3ejy_A 1ott_A 2h2s_A 4fg6_A 2ht4_A 4ftp_A 3ejz_A 2ht3_A 2htk_A ... | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >1ots_A Voltage-gated CLC-type chloride channel ERIC; CLC chloride channel, FAB complex, membrane protein; 2.51A {Escherichia coli} SCOP: f.20.1.1 PDB: 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2htl_A 3ejy_A 2ht2_A 2fed_A 2fec_A 1otu_A 3ejz_A 2ht4_A 2htk_A 2ht3_A 1ott_A 2h2s_A 3det_A 2ez0_A 3nmo_A ... | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >3nd0_A SLL0855 protein; CLC family CL-/H+ antiporter, CLC_EC1 homolog, transport protein; 3.20A {Synechocystis} PDB: 3q17_A | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 772 | ||||
| d1otsa_ | 444 | f.20.1.1 (A:) Clc chloride channel {Escherichia co | 5e-64 | |
| d2j9la1 | 169 | d.37.1.1 (A:578-746) Chloride channel protein 5, C | 2e-12 | |
| d2yzqa1 | 156 | d.37.1.1 (A:123-278) Uncharacterized protein PH178 | 7e-08 | |
| d2d4za3 | 160 | d.37.1.1 (A:527-606,A:691-770) Chloride channel pr | 1e-07 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 1e-06 | |
| d1jr1a4 | 120 | d.37.1.1 (A:113-232) Type II inosine monophosphate | 2e-06 | |
| d2v8qe1 | 145 | d.37.1.1 (E:182-326) 5'-AMP-activated protein kina | 3e-06 | |
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 6e-05 | |
| d2ouxa2 | 127 | d.37.1.1 (A:136-262) Magnesium transporter MgtE {E | 8e-05 | |
| d2ooxe2 | 153 | d.37.1.1 (E:182-334) Uncharacterized protein C1556 | 1e-04 | |
| d1o50a3 | 145 | d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th | 1e-04 | |
| d1vr9a3 | 121 | d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB | 3e-04 | |
| d2ooxe1 | 179 | d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 | 3e-04 | |
| d2yzqa2 | 122 | d.37.1.1 (A:1-122) Uncharacterized protein PH1780 | 0.001 | |
| d1zfja4 | 126 | d.37.1.1 (A:95-220) Type II inosine monophosphate | 0.002 | |
| d2rc3a1 | 127 | d.37.1.1 (A:23-149) Uncharacterized protein NE2398 | 0.003 | |
| d2ef7a1 | 127 | d.37.1.1 (A:1-127) Uncharacterized protein ST2348 | 0.003 | |
| d2yvxa2 | 144 | d.37.1.1 (A:132-275) Magnesium transporter MgtE {T | 0.004 |
| >d1otsa_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]} Length = 444 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Clc chloride channel superfamily: Clc chloride channel family: Clc chloride channel domain: Clc chloride channel species: Escherichia coli [TaxId: 562]
Score = 218 bits (556), Expect = 5e-64
Identities = 113/511 (22%), Positives = 196/511 (38%), Gaps = 78/511 (15%)
Query: 57 REEQAQRGKLYVGYSVVVKWFFALLIGIGTGLAAVFINISVENFAGWKFSLTFSIIQKSY 116
R Q R L + + F A ++G GLAAV + V + +Y
Sbjct: 1 RRRQLIRQLLERDKTPLAILFMAAVVGTLVGLAAVAFDKGVAWLQNQRMGALVHTAD-NY 59
Query: 117 FAGFLVYILINLILVFSSVYIITKFAPAAAGSGIPEIKGYLNGVDIHGILLFRTLIGKIF 176
V L + +L +++ K+AP A GSGIPEI+G L + +R L K F
Sbjct: 60 PLLLTVAFLCSAVLAMFGYFLVRKYAPEAGGSGIPEIEGALEDQ--RPVRWWRVLPVKFF 117
Query: 177 GSIGSVGGGLALGKEGPLVHTGACIASLLGQGGSTKYHLRYRWLQVFRSDRDRRDLVTCG 236
G +G++GGG+ LG+EGP V G I ++ + + D R L+ G
Sbjct: 118 GGLGTLGGGMVLGREGPTVQIGGNIGRMVLD------------IFRLKGDEARHTLLATG 165
Query: 237 CAAGVAAAFRAPVGGVLFALEEVTSWWRSQLMWRVFFTSAIVAVVVRSAMGWCKSGKCGH 296
AAG+AAAF AP+ G+LF +EE+ +R L+ + + V++ + M + +
Sbjct: 166 AAAGLAAAFNAPLAGILFIIEEMRPQFRYTLIS---IKAVFIGVIMSTIMYRIFNHEVAL 222
Query: 297 FGSGGFIIWDISDGQEDYSFEELLPMAVIGVIGGLLGALFNQLTLYMTSWRRNYLHKKGN 356
G L ++G+I G+ G +FN+ L M +H
Sbjct: 223 IDVGKLSDA---------PLNTLWLYLILGIIFGIFGPIFNKWVLGMQDLLHR-VHGGNI 272
Query: 357 RVKIIEACVISVITSVISFGLPLLRKCSPCPESDLDSGIECPRPPGMYGNYVNFYCSKDK 416
++ I + ++ F P G N
Sbjct: 273 TKWVLMGGAIGGLCGLLGF-----------------------VAPATSGGGFNLIPI--- 306
Query: 417 EYNDLATIFFNTQDDAIRNLFSAKTIHEYSAQSLLTFLVMFYTLAVVTFGIAVPAGQFVP 476
T +S L+ V ++ F P G F P
Sbjct: 307 -----------------------ATAGNFSMGMLVFIFVARVITTLLCFSSGAPGGIFAP 343
Query: 477 GIMIGSTYGRLVGMFVVNFYKKLNIEEGTYALLGAASFLGGSMRMTVSLCVIMVEITNNL 536
+ +G+ G GM V + + ++E GT+A+ G + L S+R ++ ++++E+T+N
Sbjct: 344 MLALGTVLGTAFGMVAVELFPQYHLEAGTFAIAGMGALLAASIRAPLTGIILVLEMTDNY 403
Query: 537 KFLPLIMLVLLISKAVGDAFS-EGLYEEQAH 566
+ + +++ L + + + LY
Sbjct: 404 QLILPMIITGLGATLLAQFTGGKPLYSAILA 434
|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Length = 127 | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 122 | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Length = 126 | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Length = 144 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 772 | |||
| d1otsa_ | 444 | Clc chloride channel {Escherichia coli [TaxId: 562 | 100.0 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.76 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.76 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 99.75 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.75 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.75 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.74 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.74 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.73 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.73 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.73 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.73 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.72 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.72 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 99.7 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.68 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 99.68 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 99.68 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 99.68 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.68 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 99.66 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.64 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.62 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.62 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 99.61 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.59 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 99.57 | |
| d1otsa_ | 444 | Clc chloride channel {Escherichia coli [TaxId: 562 | 99.24 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 98.56 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.52 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 98.43 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 98.37 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 98.3 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 98.29 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 98.29 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 98.29 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 98.26 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.24 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 98.22 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 98.19 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 98.18 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 98.16 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.14 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 98.12 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 98.04 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.02 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 97.97 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 97.93 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 97.82 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 97.81 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 97.64 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 97.44 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 97.36 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 97.22 |
| >d1otsa_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Clc chloride channel superfamily: Clc chloride channel family: Clc chloride channel domain: Clc chloride channel species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=4.1e-61 Score=539.65 Aligned_cols=414 Identities=26% Similarity=0.471 Sum_probs=336.2
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHhhhccccccCCCHHH
Q 004131 73 VVKWFFALLIGIGTGLAAVFINISVENFAGWKFSLTFSIIQKSYFAGFLVYILINLILVFSSVYIITKFAPAAAGSGIPE 152 (772)
Q Consensus 73 ~~~w~~~~liGv~~Gl~a~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~p~a~GsGipe 152 (772)
+..+++++++|+++|+++.+++..++++++++++...+..+ +++..++++......++++++++++++.|.++|||+||
T Consensus 17 l~~~~la~liGi~~gl~~~~~~~~i~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~l~~~~~p~~~GsGipe 95 (444)
T d1otsa_ 17 LAILFMAAVVGTLVGLAAVAFDKGVAWLQNQRMGALVHTAD-NYPLLLTVAFLCSAVLAMFGYFLVRKYAPEAGGSGIPE 95 (444)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSS-SHHHHHHHHHHHHHHHHHHHHHHHHHHCGGGSSCSHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhc-cccHHHHHHHHHHHHHHHHHHHHHHhhCCccCCCCHHH
Confidence 44567899999999999999999999999999877544332 23334445556667788888999999999999999999
Q ss_pred HHHHHccccccCchhHHHHHHHHhhhhhhccccccccCcchHHHHHHHHHHHhhccCccccchhhhhhcccCChhhhhhH
Q 004131 153 IKGYLNGVDIHGILLFRTLIGKIFGSIGSVGGGLALGKEGPLVHTGACIASLLGQGGSTKYHLRYRWLQVFRSDRDRRDL 232 (772)
Q Consensus 153 v~~~l~g~~~~~~l~~~~l~~K~~~~~~sv~sG~svG~EGP~v~iGa~ig~~l~~~~~~~~~l~~~~~~~f~~~~~~r~l 232 (772)
++.++||. ++.+++|+++.|++++++++++|+|+|||||++|+|+++|++++| ++|. ++++++|.+
T Consensus 96 v~~~l~~~--~~~~~~r~~~~k~~~~~~sl~~G~s~G~EGP~v~iga~i~~~l~~-----------~~~~-~~~~~~r~l 161 (444)
T d1otsa_ 96 IEGALEDQ--RPVRWWRVLPVKFFGGLGTLGGGMVLGREGPTVQIGGNIGRMVLD-----------IFRL-KGDEARHTL 161 (444)
T ss_dssp HHHHHTTC--SCCCHHHHHHHHHHHHHHHHHTTCSCBSHHHHHHHHHHHHHHHHH-----------HTTC-CSHHHHHHH
T ss_pred HHHHHhCC--CCCccHHHHHHHHHHHHHHHhcCCCccccccHHHHHHHHHHHHHH-----------HHhh-hhHHhhHHH
Confidence 99999985 466789999999999999999999999999999999999999997 3332 356778999
Q ss_pred HHhhhhhhhhhhhcCCccceeeeeeecchhhhh--hhHHHHHHHHHHHHHHHHHhhhhccCCcccccCCCceEEEecCCC
Q 004131 233 VTCGCAAGVAAAFRAPVGGVLFALEEVTSWWRS--QLMWRVFFTSAIVAVVVRSAMGWCKSGKCGHFGSGGFIIWDISDG 310 (772)
Q Consensus 233 i~~GaaAgvaaaF~APigGvlFalE~~~~~~~~--~~~~~~~~~~~va~~v~~~~~~~~~~~~~~~~~~~~~~~f~~~~~ 310 (772)
++||+|||+|++||||++|++|++|++.++|+. +.+++.++++++++++.+... ++. ..|+++.
T Consensus 162 ~~~GaaAglaa~F~aPlaG~lFa~E~l~~~~~~~~~~~~~~~~a~~~~~~~~~~~~-----------~~~--~~~~~~~- 227 (444)
T d1otsa_ 162 LATGAAAGLAAAFNAPLAGILFIIEEMRPQFRYTLISIKAVFIGVIMSTIMYRIFN-----------HEV--ALIDVGK- 227 (444)
T ss_dssp HHHHHHHHHHHHHTCHHHHHHHHTTTTSCSSSCCCCCHHHHHHHHHHHHHHHHHHS-----------CSC--CSSCCCC-
T ss_pred HHHHHHHHHhhccCCchhhhhhhhHHHhhcchHHHHHHHHHHhhhHHHhhheeecc-----------Ccc--ccccccc-
Confidence 999999999999999999999999999887654 336666666666655544321 222 2345542
Q ss_pred CCCCChhhHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHhhhccc-CC-ccchhhhHHHHHHHHHHHhcccccccCCCCCC
Q 004131 311 QEDYSFEELLPMAVIGVIGGLLGALFNQLTLYMTSWRRNYLHKK-GN-RVKIIEACVISVITSVISFGLPLLRKCSPCPE 388 (772)
Q Consensus 311 ~~~~~~~~l~~~~~lGv~~Gl~g~~f~~~~~~~~~~~~~~~~~~-~~-~~~~~~~~~~~~~~~~~~~~~p~~~~c~~~~~ 388 (772)
..++++.++++++++|++||++|.+|+ +.+.+..+++.+.+ .+ .++.+.+.+++.+++++.++.|..
T Consensus 228 ~~~~~~~~~~~~~~lgi~~g~~g~~f~---~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~ll~~~~p~~-------- 296 (444)
T d1otsa_ 228 LSDAPLNTLWLYLILGIIFGIFGPIFN---KWVLGMQDLLHRVHGGNITKWVLMGGAIGGLCGLLGFVAPAT-------- 296 (444)
T ss_dssp CCCCCGGGHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHCGGG--------
T ss_pred ccCCCHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHhhcccchhHHHHHHHHHHHHHHHhccCccc--------
Confidence 456788999999999999999999999 55555544432211 22 233455666677778888777765
Q ss_pred CCCCCCCCCCCCCCCCCccccccccCCCccchhhhhhccCcHHHHHHhhcccCCCcchHHHHHHHHHHHHHHHHHHhcCc
Q 004131 389 SDLDSGIECPRPPGMYGNYVNFYCSKDKEYNDLATIFFNTQDDAIRNLFSAKTIHEYSAQSLLTFLVMFYTLAVVTFGIA 468 (772)
Q Consensus 389 ~~~~~~~~~~~~~g~~g~~~~~~c~~g~~y~~la~l~~~~~~~~i~~l~~~~~~~~~~~~~l~~~~~~k~~~t~~t~g~g 468 (772)
.| +| |+. ++.+++ ++.++..++.++++|++++++|+|+|
T Consensus 297 ------------~g-----------~G--~~~------------~~~~~~----~~~~~~~l~~~~~~K~~~t~~t~~~G 335 (444)
T d1otsa_ 297 ------------SG-----------GG--FNL------------IPIATA----GNFSMGMLVFIFVARVITTLLCFSSG 335 (444)
T ss_dssp ------------SS-----------CS--TTH------------HHHHHH----TCSCHHHHHHHHHHHHHHHHHHHHTT
T ss_pred ------------CC-----------Cc--hHH------------HHHHhc----CCcchHHHHHHHHHHHHHHHHHhhcC
Confidence 11 12 332 333433 34567788888999999999999999
Q ss_pred cCcccchhHHHHHHHHHHHHHHHHHHhhhcCCCchHHHHHHHhhhhhhccccchhHHhHHHHHhcCCcchHHHHHHHHHH
Q 004131 469 VPAGQFVPGIMIGSTYGRLVGMFVVNFYKKLNIEEGTYALLGAASFLGGSMRMTVSLCVIMVEITNNLKFLPLIMLVLLI 548 (772)
Q Consensus 469 ~~gG~f~P~l~iGa~~G~l~g~~~~~~~~~~~~~~~~~aliGaaa~l~g~~r~pis~~vi~~E~Tg~~~~l~pimia~~v 548 (772)
+|||+|+|++++||++|+++|.++..+.|..+++|+.|+++||+|+++|++|+|+|+++|++|+||++++++|+|+++++
T Consensus 336 ~~GG~f~P~l~iGa~~G~~~~~~~~~~~~~~~~~~~~~alvGmaa~~a~~~~~Plta~vl~~Eltg~~~~~~p~~ia~~~ 415 (444)
T d1otsa_ 336 APGGIFAPMLALGTVLGTAFGMVAVELFPQYHLEAGTFAIAGMGALLAASIRAPLTGIILVLEMTDNYQLILPMIITGLG 415 (444)
T ss_dssp CSSBSHHHHHHHHHHHHHHHHHHHHHHCGGGTCCHHHHHHHHHTHHHHHTSCCHHHHHHHHHHHHCCGGGHHHHHHHHHH
T ss_pred CCCCeehHHHHHHHHHHHHHHHHHHHhCCcccCCHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHCCHHHHHHHHHHHHH
Confidence 99999999999999999999999998888888999999999999999999999999999999999999999999999999
Q ss_pred HHHHHhhc-CcchHHHHHHh
Q 004131 549 SKAVGDAF-SEGLYEEQAHL 567 (772)
Q Consensus 549 a~~v~~~~-~~~iy~~~l~~ 567 (772)
|+++++.+ ++|+||.++++
T Consensus 416 a~~v~~~~~~~siY~~~l~~ 435 (444)
T d1otsa_ 416 ATLLAQFTGGKPLYSAILAR 435 (444)
T ss_dssp HHHHHHTTTCCCHHHHHHHH
T ss_pred HHHHHHHhCCCChHHHHHHH
Confidence 99999999 68999999875
|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1otsa_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|