Citrus Sinensis ID: 004136

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-
MNRFFFLVLIIASELVFVSPGVESASTNVNIEEVTKIGAIVDANSQMGKQAITAMKIAVQNFNSDSRNHKLSLQIRDHNRDPFQAATAAQELINKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPISSISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVANALDSLNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRLNYNISSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSSKHNVGDISSNIAAEGFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLRYDGFSIELFRLVVDHLNYDLPYEFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRTEYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTSSYTASLSSLLTVRRLEPNVTDIQSLKSGNLKVGCVDDSFVKKYLEEVLGFRSGNIVPFGNTEANYIQKFENNTIDSLFLERPYEKVFLDKYCKKYTAINTYRFGGLGFVSNIIYSHL
ccHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHccccccEEEEEEEcccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHccccccEEEEcccccccccccccccEEEEEEccHHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHcccccccEEEEEEcccccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccccccEEEccccccccccEEEEEEEccEEEEEEEEccccccccccccccccccccccccccccccEEccccccccccccccccccccccEEEcccccccccEEEEEccccccccccccccEEEEEHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHccccEEEccEEEEcccccccccccccccccEEEEEEccccccccEEcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccHHHHHHcccEEEEEcccHHHHHHHHHHcccccccccccccHHHHHHHHcccccEEEEEEccHHHHHHHHccccEEccccccccEEEEEEccccccc
ccHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHcccccccEEEEEEEcccccHHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHccccccEEEEcccccccccccccccEEEEEcccHHHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHHHHHccEEEEEEccccccccccHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHHccccccEEEEEEcccHHHHcccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccEccccEEEEEcccccEccccEEEEEEcccccEEEEEEcccccEEEEccccccccccccccccccccEEEEcccccEEcccccEEcccccEEEEEEEEEEccccEEEEEccccccccccccccEEEHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHcccccEEEEEEEEEEEcEEEEEcccccHHccEEEEEEccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccHEEEEEHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccEEEccccHHHHHHHHHccccHHHHHHccccHHHHHHHcccccEEEEEEcHHHHHHHHHHcccEEEEcccccccccEEEEEEEEccc
MNRFFFLVLIIASELvfvspgvesastnvnieeVTKIGAIVDANSQMGKQAITAMKIAVQNFnsdsrnhklslqirdhnrdpfQAATAAQELINKEKVKVIAGMETWEETAVVAEIASRvqvpilsfaapavtplsmsrrwpYLIRMASNDSEQMKCIADLARKYNWRRVAAIyednvyggdsgKLALLAEALQNVssseiqsrlvlppissisdpkeAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEAnrmglvgkdSVWIVTNTVANALDSLNTTVIssmegtlgiksyysddsspykeFSALFRrnftseypeedhfhpsihalraHDSIKIITEAIGrlnynissPEMLLRQMLSsdfsglsgkirfkdgellnadTLRIVNVVGKKykeldfwlpnfgfsktsskhnvgdissniaaegftgpviwpgnlinrnpkgwampsnqepmrigvptrtFFEKFVVikddplngnsndknlrydgFSIELFRLVVDHlnydlpyefvphdgvyddlingvydktydaavgdltilgnrteyveftqpyaesgfsmivpakqeestwmftkpftWEMWMVTAASFIYTMFIVWLLEhqsnpefrgtLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTSSYTASLSSLLTvrrlepnvtdiqslksgnlkvgcvdDSFVKKYLEEVLgfrsgnivpfgnteANYIQKFEnntidslflerpyekvFLDKYCKKYtaintyrfgglgFVSNIIYSHL
MNRFFFLVLIIASELVFVSPGvesastnvnieeVTKIGAIVDANSQMGKQAITAMKIAVQNFNSDSRNHKLSLQIRDHNRDPFQAATAAQELINKEKVKVIAGMETWEETAVVAEIASRVQVPILsfaapavtplsmsrRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSseiqsrlvlppissisdpkEAVRGElkkvqdkqsrVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVANALDSLNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRLNYNISSPEMLLRQMLSSDFSGLSGKIrfkdgellnadtLRIVNVVGKKYKELDFWLPNFGFSKTSSKHNVGDISSNIAAEGFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVikddplngnsndkNLRYDGFSIELFRLVVDHLNYDLPYEFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRTEYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTSSYTASLSSLLTVRRLEPnvtdiqslksgnlkvgcvDDSFVKKYLEEVLGfrsgnivpfgnTEANYIQKFENNTIDSLFLERPYEKVFLDKYCKKYTAIntyrfgglgFVSNIIYSHL
MNRFFFLVLIIASELVFVSPGVESASTNVNIEEVTKIGAIVDANSQMGKQAITAMKIAVQNFNSDSRNHKLSLQIRDHNRDPFQAATAAQELINKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPISSISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVANALDSLNTTVISSMEGTLGIKsyysddssPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRLNYNISSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSSKHNVGDISSNIAAEGFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLRYDGFSIELFRLVVDHLNYDLPYEFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRTEYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRvvvvlwlfvvfIltssytaslsslltVRRLEPNVTDIQSLKSGNLKVGCVDDSFVKKYLEEVLGFRSGNIVPFGNTEANYIQKFENNTIDSLFLERPYEKVFLDKYCKKYTAINTYRFGGLGFVSNIIYSHL
**RFFFLVLIIASELVFVSPGVESASTNVNIEEVTKIGAIVDANSQMGKQAITAMKIAVQNF************************TAAQELINKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQ*************************************SRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVANALDSLNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRLNYNISSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSSKHNVGDISSNIAAEGFTGPVIWPGNLINRNPKGWAM******MRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLRYDGFSIELFRLVVDHLNYDLPYEFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRTEYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTSSYTASLSSLLTVRRLEPNVTDIQSLKSGNLKVGCVDDSFVKKYLEEVLGFRSGNIVPFGNTEANYIQKFENNTIDSLFLERPYEKVFLDKYCKKYTAINTYRFGGLGFVSNIIY***
*NRFFFLVLIIASELVFVSPGVES*****NIEEVTKIGAIVDANSQMGKQAITAMKIAVQNFNSDSRNHKLSLQIRDHNRDPFQAATAAQELINKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPA********RWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPISSISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVANALDSLNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRLNYNISSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSS************AEGFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLRYDGFSIELFRLVVDHLNYDLPYEFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRTEYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTSSYTASLSSLLTVRRLEPNVTDIQSLKSGNLKVGCVDDSFVKKYLEEVLGFR**NI**************ENNTIDSLFLERPYEKVFLDKYCKKYTAINTYRFGGLGFVSNIIYSH*
MNRFFFLVLIIASELVFVSPGVESASTNVNIEEVTKIGAIVDANSQMGKQAITAMKIAVQNFNSDSRNHKLSLQIRDHNRDPFQAATAAQELINKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPISSISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVANALDSLNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRLNYNISSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSSKHNVGDISSNIAAEGFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLRYDGFSIELFRLVVDHLNYDLPYEFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRTEYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTSSYTASLSSLLTVRRLEPNVTDIQSLKSGNLKVGCVDDSFVKKYLEEVLGFRSGNIVPFGNTEANYIQKFENNTIDSLFLERPYEKVFLDKYCKKYTAINTYRFGGLGFVSNIIYSHL
*NRFFFLVLIIASELVFVSPGVESASTNVNIEEVTKIGAIVDANSQMGKQAITAMKIAVQNFNSDSRNHKLSLQIRDHNRDPFQAATAAQELINKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPISSISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVANALDSLNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRLNYNISSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSSK*************GFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLRYDGFSIELFRLVVDHLNYDLPYEFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRTEYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTSSYTASLSSLLTVRRLEPNVTDIQSLKSGNLKVGCVDDSFVKKYLEEVLGFRSGNIVPFGNTEANYIQKFENNTIDSLFLERPYEKVFLDKYCKKYTAINTYRFGGLGFVSNIIYSHL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNRFFFLVLIIASELVFVSPGVESASTNVNIEEVTKIGAIVDANSQMGKQAITAMKIAVQNFNSDSRNHKLSLQIRDHNRDPFQAATAAQELINKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPISSISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVANALDSLNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRLNYNISSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSSKHNVGDISSNIAAEGFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLRYDGFSIELFRLVVDHLNYDLPYEFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRTEYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTSSYTASLSSLLTVRRLEPNVTDIQSLKSGNLKVGCVDDSFVKKYLEEVLGFRSGNIVPFGNTEANYIQKFENNTIDSLFLERPYEKVFLDKYCKKYTAINTYRFGGLGFVSNIIYSHL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query771 2.2.26 [Sep-21-2011]
Q8LGN0 952 Glutamate receptor 2.7 OS yes no 0.901 0.730 0.339 1e-116
O81078 940 Glutamate receptor 2.9 OS no no 0.893 0.732 0.344 1e-109
Q9LFN8 967 Glutamate receptor 2.6 OS no no 0.914 0.729 0.326 1e-109
Q9LFN5 918 Glutamate receptor 2.5 OS no no 0.909 0.763 0.325 1e-108
O04660 901 Glutamate receptor 2.1 OS no no 0.911 0.780 0.332 1e-106
O81776 896 Glutamate receptor 2.4 OS no no 0.922 0.793 0.339 1e-104
Q9C5V5 947 Glutamate receptor 2.8 OS no no 0.901 0.733 0.340 1e-104
Q9SHV1 920 Glutamate receptor 2.2 OS no no 0.918 0.769 0.331 1e-103
Q9SHV2 895 Glutamate receptor 2.3 OS no no 0.889 0.766 0.326 1e-101
Q93YT1 912 Glutamate receptor 3.2 OS no no 0.948 0.801 0.312 1e-100
>sp|Q8LGN0|GLR27_ARATH Glutamate receptor 2.7 OS=Arabidopsis thaliana GN=GLR2.7 PE=2 SV=3 Back     alignment and function desciption
 Score =  418 bits (1075), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 258/761 (33%), Positives = 415/761 (54%), Gaps = 66/761 (8%)

Query: 36  KIGAIVDANSQMGKQAITAMKIAVQNFNSDSRNH--KLSLQIRDHNRDPFQAATAAQELI 93
           K+G ++D ++   K  +T++ I++ +F     ++  +L++ IRD   D  QA++AA +LI
Sbjct: 40  KVGVVLDLHTSFSKLCLTSINISLSDFYKYHSDYTTRLAIHIRDSMEDVVQASSAALDLI 99

Query: 94  NKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDSE 153
             E+V  I G  T  +   +  +A + QVP ++F+A    PL  S   PY +R   +DS 
Sbjct: 100 KNEQVSAIIGPRTSMQAEFMIRLADKSQVPTITFSA--TCPLLTSINSPYFVRATLDDSS 157

Query: 154 QMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPISSI 213
           Q+K IA + + + WR V AIY DN +G   G L LL +ALQ+V +  +   L+       
Sbjct: 158 QVKAIAAIVKSFGWRNVVAIYVDNEFG--EGILPLLTDALQDVQAFVVNRCLI------- 208

Query: 214 SDPKEA----VRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNT 269
             P+EA    +  EL K+   Q+RVF+V      +    F +A  +G++ +  VW++T+ 
Sbjct: 209 --PQEANDDQILKELYKLMTMQTRVFVV-HMPPTLGFRFFQKAREIGMMEEGYVWLLTDG 265

Query: 270 VANALDS-LNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIH 328
           V N L S    + + +M+G LG++S+    S   K F   + + F  +  +E+    +I 
Sbjct: 266 VMNLLKSNERGSSLENMQGVLGVRSHIPK-SKKLKNFRLRWEKMFPKKGNDEEM---NIF 321

Query: 329 ALRAHDSIKIITEAIGRLN-------YNISSPE---------------MLLRQMLSSDFS 366
           ALRA+DSI  +  A+ + N       + I+S                  LL+ + +  F+
Sbjct: 322 ALRAYDSITALAMAVEKTNIKSLRYDHPIASGNNKTNLGTLGVSRYGPSLLKALSNVRFN 381

Query: 367 GLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSSKHNVGDISSNIAAE 426
           GL+G+    +G+L  +    ++N++G + + +  W P+ G     SK+    +   +   
Sbjct: 382 GLAGEFELINGQL-ESSVFDVINIIGSEERIIGLWRPSNGIVNAKSKNTTSVLGERL--- 437

Query: 427 GFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLR 486
              GPVIWPG   +  PKGW +P+N + +R+G+P +  F +FV  K DP++       + 
Sbjct: 438 ---GPVIWPGKSKDV-PKGWQIPTNGKMLRVGIPVKKGFLEFVDAKIDPISNA-----MT 488

Query: 487 YDGFSIELFRLVVDHLNYD-LP--YEFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRT 543
             G+ IE+F  V+  L Y  +P    F+  D  YD+++  VY   YDA VGD+TI+ NR+
Sbjct: 489 PTGYCIEIFEAVLKKLPYSVIPKYIAFLSPDENYDEMVYQVYTGAYDAVVGDVTIVANRS 548

Query: 544 EYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSN 603
            YV+FT PY ESG SM+VP K  ++TW+F +P++ ++W+ TA  F++  FIVW+LEH+ N
Sbjct: 549 LYVDFTLPYTESGVSMMVPLKDNKNTWVFLRPWSLDLWVTTACFFVFIGFIVWILEHRVN 608

Query: 604 PEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTSSYTASLSSL 663
            +FRG    QI    WFAFST+ F+HR  + SNL R VV++W FVV +L  SYTA+L+S 
Sbjct: 609 TDFRGPPHHQIGTSFWFAFSTMNFAHREKVVSNLARFVVLVWCFVVLVLIQSYTANLTSF 668

Query: 664 LTVRRLEPNVTDIQSLKSGNLKVGCVDDSFVKKYLEEVLGFRSGNIVPFGNTEANYIQKF 723
            TV+ L+P VT+ + L   N  +G    +FV++ L+   GF    + PFG +     + F
Sbjct: 669 FTVKLLQPTVTNWKDLIKFNKNIGYQRGTFVRELLKS-QGFDESQLKPFG-SAVECDELF 726

Query: 724 ENNTIDSLFLERPYEKVFLDKYCKKYTAIN-TYRFGGLGFV 763
            N TI + F E  Y KV L +   KYT +  +++  G GFV
Sbjct: 727 SNGTITASFDEVAYIKVILSQNSSKYTMVEPSFKTAGFGFV 767
Glutamate-gated receptor that probably acts as non-selective cation channel. May be involved in light-signal transduction and calcium homeostasis via the regulation of calcium influx into cells.
Arabidopsis thaliana (taxid: 3702)
>sp|O81078|GLR29_ARATH Glutamate receptor 2.9 OS=Arabidopsis thaliana GN=GLR2.9 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFN8|GLR26_ARATH Glutamate receptor 2.6 OS=Arabidopsis thaliana GN=GLR2.6 PE=2 SV=2 Back     alignment and function description
>sp|Q9LFN5|GLR25_ARATH Glutamate receptor 2.5 OS=Arabidopsis thaliana GN=GLR2.5 PE=1 SV=2 Back     alignment and function description
>sp|O04660|GLR21_ARATH Glutamate receptor 2.1 OS=Arabidopsis thaliana GN=GLR2.1 PE=2 SV=2 Back     alignment and function description
>sp|O81776|GLR24_ARATH Glutamate receptor 2.4 OS=Arabidopsis thaliana GN=GLR2.4 PE=2 SV=2 Back     alignment and function description
>sp|Q9C5V5|GLR28_ARATH Glutamate receptor 2.8 OS=Arabidopsis thaliana GN=GLR2.8 PE=2 SV=2 Back     alignment and function description
>sp|Q9SHV1|GLR22_ARATH Glutamate receptor 2.2 OS=Arabidopsis thaliana GN=GLR2.2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHV2|GLR23_ARATH Glutamate receptor 2.3 OS=Arabidopsis thaliana GN=GLR2.3 PE=2 SV=1 Back     alignment and function description
>sp|Q93YT1|GLR32_ARATH Glutamate receptor 3.2 OS=Arabidopsis thaliana GN=GLR3.2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query771
224077012 942 glutamate-gated kainate-type ion channel 0.942 0.771 0.575 0.0
255563044843 glutamate receptor 2 plant, putative [Ri 0.901 0.824 0.592 0.0
224077014 931 glutamate-gated kainate-type ion channel 0.932 0.772 0.568 0.0
224114740867 glutamate-gated kainate-type ion channel 0.904 0.803 0.579 0.0
225443524 916 PREDICTED: glutamate receptor 2.7-like [ 0.929 0.782 0.546 0.0
356546605 910 PREDICTED: glutamate receptor 2.7-like [ 0.919 0.779 0.524 0.0
147838919 916 hypothetical protein VITISV_034689 [Viti 0.929 0.782 0.543 0.0
357446857 1083 Glutamate receptor 2.7 [Medicago truncat 0.957 0.681 0.491 0.0
224114736836 glutamate-gated kainate-type ion channel 0.880 0.812 0.558 0.0
356519637 1033 PREDICTED: glutamate receptor 2.7-like [ 0.926 0.691 0.506 0.0
>gi|224077012|ref|XP_002305092.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222848056|gb|EEE85603.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/757 (57%), Positives = 556/757 (73%), Gaps = 30/757 (3%)

Query: 6   FLVLIIASELVFVSPGVESASTNVNIEEVTKIGAIVDANSQMGKQAITAMKIAVQNFNSD 65
           FL+ ++ S L+  S GVE A    N + VT IGAI+D NS++GK+  TA+++AVQ+FN  
Sbjct: 29  FLLPVLISILLIFSNGVE-AEIRTN-KLVTNIGAIIDVNSRIGKEEKTALELAVQDFNDI 86

Query: 66  SRNHKLSLQIRDHNRDPFQAATAAQELINKEKVKVIAGMETWEETAVVAEIASRVQVPIL 125
           S NH+LSL  R    DP Q A AA+ELI ++KVKVI GM+ WEE A+VA I ++ Q+PIL
Sbjct: 87  STNHELSLHFRHPGEDPLQVAYAAEELIKEKKVKVIIGMDNWEEAALVANIGNQYQIPIL 146

Query: 126 SFAAPAVTPLSMSRRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGK 185
           SFA PA+TP   + RWP+LIRMAS+ SEQM+CIA L R +NWR+V  IYEDNVYGG+SG 
Sbjct: 147 SFATPAITPPLTTLRWPFLIRMASDGSEQMRCIAALVRCHNWRKVVVIYEDNVYGGESGN 206

Query: 186 LALLAEALQNVSSSEIQSRLVLPPISSISDPKEAVRGELKKVQ-DKQSRVFIVLQASLDM 244
           LALL+EALQ V  SEI+ RLVLPP S  +DP++ V+ EL K+Q D +SRVFIVLQ+SL M
Sbjct: 207 LALLSEALQEV-GSEIEYRLVLPPFSLSTDPEDVVQHELIKLQKDTESRVFIVLQSSLPM 265

Query: 245 TIHLFTEANRMGLVGKDSVWIVTNTVANALDSLNTTVISSMEGTLGIKSYYSDDSSPYKE 304
              LF EA  MGLVG+D+ WIV+N+V + LDS+N +VISSM GTLGI++YYS  SS Y+ 
Sbjct: 266 LTCLFREAKNMGLVGRDTAWIVSNSVTSFLDSMNNSVISSMGGTLGIQTYYSSSSS-YQR 324

Query: 305 FSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRLNYNISSPEMLLRQMLSSD 364
           F A FR+ F +EY +ED+F P I ALRA+DSI ++T+AI +L  + SSP+MLL  +L SD
Sbjct: 325 FEAQFRKIFRAEYLDEDNFLPGIQALRAYDSIGMVTQAIEKLGSDSSSPKMLLNSVLGSD 384

Query: 365 FSGLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKT---------SSKHN 415
           F+GL+G+I FKD  L  A  LRIVNVVGKKYKELDFWLPNFGFSKT          S  N
Sbjct: 385 FTGLTGEIHFKDAMLSQAPILRIVNVVGKKYKELDFWLPNFGFSKTLHPQEGKERCSNSN 444

Query: 416 VGDISSNIAAEGFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDP 475
           V + +  +A     GPVIWPG+L  RNPKGWAMP+N +P+RI VP RT F+KFV  +   
Sbjct: 445 VCNNTGCLA-----GPVIWPGDLNGRNPKGWAMPTNAKPLRIVVPKRTSFDKFVTFQTG- 498

Query: 476 LNGNSNDKNLRYDGFSIELFRLVVDHLNYDLPYEFVPHDGVYDDLINGVYDKTYDAAVGD 535
                       +GF I++F  VV+ LNY LP+EF  HDG+YDD+I GVY+KTYDAA+GD
Sbjct: 499 --------EALPEGFCIDVFNEVVERLNYPLPHEFFEHDGLYDDMIAGVYNKTYDAAIGD 550

Query: 536 LTILGNRTEYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIV 595
           +TIL  RT+YVEFTQPYAESG SMIVP + E++TW+FTKPF  EMW+V+ A FIYTM IV
Sbjct: 551 ITILAERTKYVEFTQPYAESGLSMIVPLENEDATWIFTKPFNLEMWIVSGAIFIYTMLIV 610

Query: 596 WLLEHQ-SNPEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTS 654
           W LEHQ SNPEFRG  K QI N LWF  S++FF H   + SN TR+VVV WL VVF+LT+
Sbjct: 611 WFLEHQSSNPEFRGPWKVQIENALWFLSSSLFFIHAEKLYSNFTRIVVVAWLCVVFVLTA 670

Query: 655 SYTASLSSLLTVRRLEPNVTDIQSLKSGNLKVGCVDDSFVKKYLEEVLGFRSGNIVPFGN 714
           SYTA+L+S+LTV+RLEP  ++ ++ +  +L VGC +DSFV+ YLE+VLGF++  I    +
Sbjct: 671 SYTANLTSMLTVQRLEPKFSEYKNYQINHLTVGCDNDSFVQNYLEKVLGFQTEKI-KIID 729

Query: 715 TEANYIQKFENNTIDSLFLERPYEKVFLDKYCKKYTA 751
            E +Y  +FE+N I + FLE PYEKVFL+KYC++YT+
Sbjct: 730 HENDYPTEFESNNIAAAFLELPYEKVFLNKYCERYTS 766

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255563044|ref|XP_002522526.1| glutamate receptor 2 plant, putative [Ricinus communis] gi|223538217|gb|EEF39826.1| glutamate receptor 2 plant, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224077014|ref|XP_002305093.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222848057|gb|EEE85604.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114740|ref|XP_002316843.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222859908|gb|EEE97455.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225443524|ref|XP_002272216.1| PREDICTED: glutamate receptor 2.7-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356546605|ref|XP_003541715.1| PREDICTED: glutamate receptor 2.7-like [Glycine max] Back     alignment and taxonomy information
>gi|147838919|emb|CAN63664.1| hypothetical protein VITISV_034689 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357446857|ref|XP_003593704.1| Glutamate receptor 2.7 [Medicago truncatula] gi|355482752|gb|AES63955.1| Glutamate receptor 2.7 [Medicago truncatula] Back     alignment and taxonomy information
>gi|224114736|ref|XP_002316842.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222859907|gb|EEE97454.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356519637|ref|XP_003528477.1| PREDICTED: glutamate receptor 2.7-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query771
TAIR|locus:2066107 952 GLR2.7 "glutamate receptor 2.7 0.905 0.733 0.324 2.4e-99
TAIR|locus:2066148 940 GLR2.9 "glutamate receptor 2.9 0.894 0.734 0.327 4.5e-98
TAIR|locus:2066086 947 GLR2.8 "glutamate receptor 2.8 0.906 0.738 0.321 3.3e-95
TAIR|locus:2181196 901 GLR2.1 "glutamate receptor 2.1 0.949 0.812 0.311 3.6e-89
TAIR|locus:2122128 912 GLUR2 "glutamate receptor 2" [ 0.512 0.433 0.320 4.3e-87
TAIR|locus:2047256 920 GLR2.2 "glutamate receptor 2.2 0.945 0.792 0.310 1.3e-86
TAIR|locus:2047251 895 GLR2.3 "glutamate receptor 2.3 0.952 0.820 0.299 4.9e-85
TAIR|locus:2081805 903 GLR3.6 "glutamate receptor 3.6 0.931 0.795 0.293 2.6e-79
TAIR|locus:2207165 959 GLR3.4 "AT1G05200" [Arabidopsi 0.902 0.725 0.292 7.9e-78
TAIR|locus:2062586 921 GLR5 "glutamate receptor 5" [A 0.891 0.745 0.277 1.9e-74
TAIR|locus:2066107 GLR2.7 "glutamate receptor 2.7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 986 (352.1 bits), Expect = 2.4e-99, P = 2.4e-99
 Identities = 246/758 (32%), Positives = 401/758 (52%)

Query:    36 KIGAIVDANSQMGKQAITAMKIAVQNF---NSDSRNHKLSLQIRDHNRDPFQAATAAQEL 92
             K+G ++D ++   K  +T++ I++ +F   +SD    +L++ IRD   D  QA++AA +L
Sbjct:    40 KVGVVLDLHTSFSKLCLTSINISLSDFYKYHSDYTT-RLAIHIRDSMEDVVQASSAALDL 98

Query:    93 INKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDS 152
             I  E+V  I G  T  +   +  +A + QVP ++F+A    PL  S   PY +R   +DS
Sbjct:    99 IKNEQVSAIIGPRTSMQAEFMIRLADKSQVPTITFSATC--PLLTSINSPYFVRATLDDS 156

Query:   153 EQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPISS 212
              Q+K IA + + + WR V AIY DN +G   G L LL +ALQ+V +  + +R ++P    
Sbjct:   157 SQVKAIAAIVKSFGWRNVVAIYVDNEFG--EGILPLLTDALQDVQAFVV-NRCLIP--QE 211

Query:   213 ISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVAN 272
              +D  + +  EL K+   Q+RVF+V      +    F +A  +G++ +  VW++T+ V N
Sbjct:   212 AND--DQILKELYKLMTMQTRVFVVHMPPT-LGFRFFQKAREIGMMEEGYVWLLTDGVMN 268

Query:   273 ALDSLNT-TVISSMEGTLGIKXXXXXXXXPYKEFSALFRRNFTSEYPEEDHFHPSIHALR 331
              L S    + + +M+G LG++          K F   + + F  +  +E+    +I ALR
Sbjct:   269 LLKSNERGSSLENMQGVLGVRSHIPKSKK-LKNFRLRWEKMFPKKGNDEEM---NIFALR 324

Query:   332 AHDSIKIITEAIGRLN-----YN--ISSPE---------------MLLRQMLSSDFSGLS 369
             A+DSI  +  A+ + N     Y+  I+S                  LL+ + +  F+GL+
Sbjct:   325 AYDSITALAMAVEKTNIKSLRYDHPIASGNNKTNLGTLGVSRYGPSLLKALSNVRFNGLA 384

Query:   370 GKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSSKHNVGDISSNIAAEGFT 429
             G+    +G+L  +    ++N++G + + +  W P+ G     SK+    +   +      
Sbjct:   385 GEFELINGQL-ESSVFDVINIIGSEERIIGLWRPSNGIVNAKSKNTTSVLGERL------ 437

Query:   430 GPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLRYDG 489
             GPVIWPG   +  PKGW +P+N + +R+G+P +  F +FV  K DP++ N+    +   G
Sbjct:   438 GPVIWPGKSKDV-PKGWQIPTNGKMLRVGIPVKKGFLEFVDAKIDPIS-NA----MTPTG 491

Query:   490 FSIELFRLVVDHLNYD-LP-Y-EFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRTEYV 546
             + IE+F  V+  L Y  +P Y  F+  D  YD+++  VY   YDA VGD+TI+ NR+ YV
Sbjct:   492 YCIEIFEAVLKKLPYSVIPKYIAFLSPDENYDEMVYQVYTGAYDAVVGDVTIVANRSLYV 551

Query:   547 EFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEF 606
             +FT PY ESG SM+VP K  ++TW+F +P++ ++W+ TA  F++  FIVW+LEH+ N +F
Sbjct:   552 DFTLPYTESGVSMMVPLKDNKNTWVFLRPWSLDLWVTTACFFVFIGFIVWILEHRVNTDF 611

Query:   607 RGTLKDQISNILWFAFSTIFFSHRANIQSNLTRXXXXXXXXXXXIXXXXXXXXXXXXXXV 666
             RG    QI    WFAFST+ F+HR  + SNL R           +              V
Sbjct:   612 RGPPHHQIGTSFWFAFSTMNFAHREKVVSNLARFVVLVWCFVVLVLIQSYTANLTSFFTV 671

Query:   667 RRLEPNVTDIQSLKSGNLKVGCVDDSFVKKYLEEVLGFRSGNIVPFGNTEANYIQKFENN 726
             + L+P VT+ + L   N  +G    +FV++ L+   GF    + PFG+      + F N 
Sbjct:   672 KLLQPTVTNWKDLIKFNKNIGYQRGTFVRELLKSQ-GFDESQLKPFGSA-VECDELFSNG 729

Query:   727 TIDSLFLERPYEKVFLDKYCKKYTAIN-TYRFGGLGFV 763
             TI + F E  Y KV L +   KYT +  +++  G GFV
Sbjct:   730 TITASFDEVAYIKVILSQNSSKYTMVEPSFKTAGFGFV 767
GO:0004970 "ionotropic glutamate receptor activity" evidence=IEA
GO:0005215 "transporter activity" evidence=IEA
GO:0005217 "intracellular ligand-gated ion channel activity" evidence=ISS
GO:0005234 "extracellular-glutamate-gated ion channel activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006810 "transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0006874 "cellular calcium ion homeostasis" evidence=NAS
GO:0009416 "response to light stimulus" evidence=NAS
GO:0005773 "vacuole" evidence=IDA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
TAIR|locus:2066148 GLR2.9 "glutamate receptor 2.9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066086 GLR2.8 "glutamate receptor 2.8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181196 GLR2.1 "glutamate receptor 2.1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122128 GLUR2 "glutamate receptor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047256 GLR2.2 "glutamate receptor 2.2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047251 GLR2.3 "glutamate receptor 2.3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081805 GLR3.6 "glutamate receptor 3.6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207165 GLR3.4 "AT1G05200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062586 GLR5 "glutamate receptor 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query771
cd06366350 cd06366, PBP1_GABAb_receptor, Ligand-binding domai 3e-93
cd06350348 cd06350, PBP1_GPCR_family_C_like, Ligand-binding d 6e-41
pfam01094343 pfam01094, ANF_receptor, Receptor family ligand bi 6e-41
cd06269298 cd06269, PBP1_glutamate_receptors_like, Family C G 1e-35
cd04509299 cd04509, PBP1_ABC_transporter_GCPR_C_like, Family 5e-34
pfam00060268 pfam00060, Lig_chan, Ligand-gated ion channel 1e-31
cd06268298 cd06268, PBP1_ABC_transporter_LIVBP_like, Periplas 4e-24
pfam13458343 pfam13458, Peripla_BP_6, Periplasmic binding prote 3e-22
COG0683366 COG0683, LivK, ABC-type branched-chain amino acid 2e-19
cd01391269 cd01391, Periplasmic_Binding_Protein_Type_1, Type 1e-18
cd06351328 cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leuci 7e-18
cd06333312 cd06333, PBP1_ABC-type_HAAT_like, Type I periplasm 1e-16
cd06367362 cd06367, PBP1_iGluR_NMDA, N-terminal leucine/isole 2e-12
cd06345344 cd06345, PBP1_ABC_ligand_binding_like_10, Type I p 2e-12
cd06352389 cd06352, PBP1_NPR_GC_like, Ligand-binding domain o 2e-12
pfam00497220 pfam00497, SBP_bac_3, Bacterial extracellular solu 3e-10
cd06363410 cd06363, PBP1_Taste_receptor, Ligand-binding domai 4e-10
cd06330346 cd06330, PBP1_Arsenic_SBP_like, Periplasmic solute 3e-09
cd06340347 cd06340, PBP1_ABC_ligand_binding_like_6, Type I pe 9e-09
cd06346312 cd06346, PBP1_ABC_ligand_binding_like_11, Type I p 1e-08
cd06342334 cd06342, PBP1_ABC_LIVBP_like, Type I periplasmic l 2e-08
COG0834275 COG0834, HisJ, ABC-type amino acid transport/signa 5e-08
cd06347334 cd06347, PBP1_ABC_ligand_binding_like_12, Type I p 7e-08
cd06327334 cd06327, PBP1_SBP_like_1, Periplasmic solute-bindi 1e-07
cd06368324 cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leuc 2e-07
cd06338345 cd06338, PBP1_ABC_ligand_binding_like_5, Type I pe 3e-07
cd06348344 cd06348, PBP1_ABC_ligand_binding_like_13, Type I p 3e-07
cd06335347 cd06335, PBP1_ABC_ligand_binding_like_2, Type I pe 6e-07
cd00134218 cd00134, PBPb, Bacterial periplasmic transport sys 7e-07
cd06332333 cd06332, PBP1_aromatic_compounds_like, Type I peri 9e-07
cd06374472 cd06374, PBP1_mGluR_groupI, Ligand binding domain 4e-06
smart00062219 smart00062, PBPb, Bacterial periplasmic substrate- 5e-06
cd06361403 cd06361, PBP1_GPC6A_like, Ligand-binding domain of 9e-06
cd06326336 cd06326, PBP1_STKc_like, Type I periplasmic bindin 1e-05
cd06339336 cd06339, PBP1_YraM_LppC_lipoprotein_like, Periplas 3e-05
cd06376463 cd06376, PBP1_mGluR_groupIII, Ligand-binding domai 4e-05
cd06337357 cd06337, PBP1_ABC_ligand_binding_like_4, Type I pe 6e-05
cd06375458 cd06375, PBP1_mGluR_groupII, Ligand binding domain 8e-05
PRK09495247 PRK09495, glnH, glutamine ABC transporter periplas 1e-04
cd06336347 cd06336, PBP1_ABC_ligand_binding_like_3, Type I pe 1e-04
cd06373396 cd06373, PBP1_NPR_like, Ligand binding domain of n 2e-04
cd06362452 cd06362, PBP1_mGluR, Ligand binding domain of the 2e-04
cd06328333 cd06328, PBP1_SBP_like_2, Periplasmic solute-bindi 0.001
smart0091862 smart00918, Lig_chan-Glu_bd, Ligated ion channel L 0.002
cd06379377 cd06379, PBP1_iGluR_NMDA_NR1, N-terminal leucine/i 0.002
cd06382327 cd06382, PBP1_iGluR_Kainate, N-terminal leucine/is 0.003
cd06378362 cd06378, PBP1_iGluR_NMDA_NR2, N-terminal leucine/i 0.004
TIGR01096250 TIGR01096, 3A0103s03R, lysine-arginine-ornithine-b 0.004
>gnl|CDD|107361 cd06366, PBP1_GABAb_receptor, Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information 
 Score =  294 bits (756), Expect = 3e-93
 Identities = 134/382 (35%), Positives = 214/382 (56%), Gaps = 42/382 (10%)

Query: 36  KIGAIVDAN-SQMGKQAITAMKIAVQNFNSDSRNH---KLSLQIRDHNRDPFQAATAAQE 91
           +IGAI D + S +GK A+ A+++A+++ N+D+      +L L +RD   DP QAA+AA +
Sbjct: 1   RIGAIFDLSGSWIGKAALPAIEMALEDVNADNSILPGYRLVLHVRDSKCDPVQAASAALD 60

Query: 92  LINKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASND 151
           L+  + V  I G +       VAE+A+   VP+LSFAA + + LS   ++PY  R   +D
Sbjct: 61  LLENKPVVAIIGPQCSSVAEFVAEVANEWNVPVLSFAATSPS-LSSRLQYPYFFRTTPSD 119

Query: 152 SEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPIS 211
           S Q   IA L +K+ WRRVA IYED+ YG  SG L  L +ALQ     EI  R   PP +
Sbjct: 120 SSQNPAIAALLKKFGWRRVATIYEDDDYG--SGGLPDLVDALQEA-GIEISYRAAFPPSA 176

Query: 212 SISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVA 271
           +  D  +     LKK+++K SRV +V   S D+   +F EA ++G++GK  VWI+T+ ++
Sbjct: 177 NDDDITD----ALKKLKEKDSRVIVVH-FSPDLARRVFCEAYKLGMMGKGYVWILTDWLS 231

Query: 272 NALDS----LNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSI 327
           +   S     +  ++ +M+G +G++SY  + S   +EF++ +R+ F +E PE     PSI
Sbjct: 232 SNWWSSSDCTDEEMLEAMQGVIGVRSYVPNSSMTLQEFTSRWRKRFGNENPELT--EPSI 289

Query: 328 HALRAHDSIKIITEAIGRLNYNISSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRI 387
           +AL A+D++                         S++F+GLSG ++F  G  L +    I
Sbjct: 290 YALYAYDAV-----------------------WASTNFNGLSGPVQFDGGRRLASPAFEI 326

Query: 388 VNVVGKKYKELDFWLPNFGFSK 409
           +N++GK Y+++ FW    G S 
Sbjct: 327 INIIGKGYRKIGFWSSESGLSV 348

Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA). GABA is the major inhibitory neurotransmitter in the mammalian CNS and, like glutamate and other transmitters, acts via both ligand gated ion channels (GABAa receptors) and G-protein coupled receptors (GABAb). GABAa receptors are members of the ionotropic receptor superfamily which includes alpha-adrenergic and glycine receptors. The GABAb receptor is a member of a receptor superfamily which includes the mGlu receptors. The GABAb receptor is coupled to G alpha_i proteins, and activation causes a decrease in calcium, an increase in potassium membrane conductance, and inhibition of cAMP formation. The response is thus inhibitory and leads to hyperpolarization and decreased neurotransmitter release, for example. Length = 350
>gnl|CDD|153138 cd06350, PBP1_GPCR_family_C_like, Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) Back     alignment and domain information
>gnl|CDD|216296 pfam01094, ANF_receptor, Receptor family ligand binding region Back     alignment and domain information
>gnl|CDD|153137 cd06269, PBP1_glutamate_receptors_like, Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>gnl|CDD|107261 cd04509, PBP1_ABC_transporter_GCPR_C_like, Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>gnl|CDD|215685 pfam00060, Lig_chan, Ligand-gated ion channel Back     alignment and domain information
>gnl|CDD|107263 cd06268, PBP1_ABC_transporter_LIVBP_like, Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily Back     alignment and domain information
>gnl|CDD|222144 pfam13458, Peripla_BP_6, Periplasmic binding protein Back     alignment and domain information
>gnl|CDD|223755 COG0683, LivK, ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|107248 cd01391, Periplasmic_Binding_Protein_Type_1, Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>gnl|CDD|107346 cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) Back     alignment and domain information
>gnl|CDD|107328 cd06333, PBP1_ABC-type_HAAT_like, Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids Back     alignment and domain information
>gnl|CDD|107362 cd06367, PBP1_iGluR_NMDA, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors Back     alignment and domain information
>gnl|CDD|107340 cd06345, PBP1_ABC_ligand_binding_like_10, Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|107347 cd06352, PBP1_NPR_GC_like, Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>gnl|CDD|215950 pfam00497, SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3 Back     alignment and domain information
>gnl|CDD|107358 cd06363, PBP1_Taste_receptor, Ligand-binding domain of the T1R taste receptor Back     alignment and domain information
>gnl|CDD|107325 cd06330, PBP1_Arsenic_SBP_like, Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>gnl|CDD|107335 cd06340, PBP1_ABC_ligand_binding_like_6, Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|107341 cd06346, PBP1_ABC_ligand_binding_like_11, Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|107337 cd06342, PBP1_ABC_LIVBP_like, Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) Back     alignment and domain information
>gnl|CDD|223904 COG0834, HisJ, ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|107342 cd06347, PBP1_ABC_ligand_binding_like_12, Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|107322 cd06327, PBP1_SBP_like_1, Periplasmic solute-binding domain of active transport proteins that belong to the type I periplasmic binding fold protein family Back     alignment and domain information
>gnl|CDD|107363 cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>gnl|CDD|107333 cd06338, PBP1_ABC_ligand_binding_like_5, Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|107343 cd06348, PBP1_ABC_ligand_binding_like_13, Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|107330 cd06335, PBP1_ABC_ligand_binding_like_2, Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|238078 cd00134, PBPb, Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>gnl|CDD|107327 cd06332, PBP1_aromatic_compounds_like, Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes Back     alignment and domain information
>gnl|CDD|107369 cd06374, PBP1_mGluR_groupI, Ligand binding domain of the group I metabotropic glutamate receptor Back     alignment and domain information
>gnl|CDD|214497 smart00062, PBPb, Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>gnl|CDD|107356 cd06361, PBP1_GPC6A_like, Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor Back     alignment and domain information
>gnl|CDD|107321 cd06326, PBP1_STKc_like, Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins Back     alignment and domain information
>gnl|CDD|107334 cd06339, PBP1_YraM_LppC_lipoprotein_like, Periplasmic binding component of lipoprotein LppC, an immunodominant antigen Back     alignment and domain information
>gnl|CDD|107371 cd06376, PBP1_mGluR_groupIII, Ligand-binding domain of the group III metabotropic glutamate receptor Back     alignment and domain information
>gnl|CDD|107332 cd06337, PBP1_ABC_ligand_binding_like_4, Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|107370 cd06375, PBP1_mGluR_groupII, Ligand binding domain of the group II metabotropic glutamate receptor Back     alignment and domain information
>gnl|CDD|236540 PRK09495, glnH, glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>gnl|CDD|107331 cd06336, PBP1_ABC_ligand_binding_like_3, Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|107368 cd06373, PBP1_NPR_like, Ligand binding domain of natriuretic peptide receptor (NPR) family Back     alignment and domain information
>gnl|CDD|107357 cd06362, PBP1_mGluR, Ligand binding domain of the metabotropic glutamate receptors (mGluR) Back     alignment and domain information
>gnl|CDD|107323 cd06328, PBP1_SBP_like_2, Periplasmic solute-binding domain of active transport proteins found in gram-negative and gram-positive bacteria Back     alignment and domain information
>gnl|CDD|214911 smart00918, Lig_chan-Glu_bd, Ligated ion channel L-glutamate- and glycine-binding site Back     alignment and domain information
>gnl|CDD|107374 cd06379, PBP1_iGluR_NMDA_NR1, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor Back     alignment and domain information
>gnl|CDD|107377 cd06382, PBP1_iGluR_Kainate, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors Back     alignment and domain information
>gnl|CDD|107373 cd06378, PBP1_iGluR_NMDA_NR2, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family Back     alignment and domain information
>gnl|CDD|233269 TIGR01096, 3A0103s03R, lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 771
KOG1054 897 consensus Glutamate-gated AMPA-type ion channel re 100.0
KOG4440 993 consensus NMDA selective glutamate-gated ion chann 100.0
KOG1053 1258 consensus Glutamate-gated NMDA-type ion channel re 100.0
KOG1052 656 consensus Glutamate-gated kainate-type ion channel 100.0
cd06361403 PBP1_GPC6A_like Ligand-binding domain of the promi 100.0
cd06366350 PBP1_GABAb_receptor Ligand-binding domain of GABAb 100.0
cd06362452 PBP1_mGluR Ligand binding domain of the metabotrop 100.0
cd06364510 PBP1_CaSR Ligand-binding domain of the CaSR calciu 100.0
cd06374472 PBP1_mGluR_groupI Ligand binding domain of the gro 100.0
cd06365469 PBP1_Pheromone_receptor Ligand-binding domain of t 100.0
cd06386387 PBP1_NPR_C_like Ligand-binding domain of type C na 100.0
cd06393384 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol 100.0
cd06376463 PBP1_mGluR_groupIII Ligand-binding domain of the g 100.0
cd06375458 PBP1_mGluR_groupII Ligand binding domain of the gr 100.0
cd06379377 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/ 100.0
cd06373396 PBP1_NPR_like Ligand binding domain of natriuretic 100.0
cd06367362 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali 100.0
cd06372391 PBP1_GC_G_like Ligand-binding domain of membrane g 100.0
cd06380382 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali 100.0
cd06363410 PBP1_Taste_receptor Ligand-binding domain of the T 100.0
cd06385405 PBP1_NPR_A Ligand-binding domain of type A natriur 100.0
cd06370404 PBP1_Speract_GC_like Ligand-binding domain of memb 100.0
cd06390364 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucin 100.0
cd06352389 PBP1_NPR_GC_like Ligand-binding domain of membrane 100.0
cd06389370 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucin 100.0
cd06384399 PBP1_NPR_B Ligand-binding domain of type B natriur 100.0
cd06388371 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucin 100.0
cd06371382 PBP1_sensory_GC_DEF_like Ligand-binding domain of 100.0
cd06392400 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v 100.0
cd06387372 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucin 100.0
cd06382327 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/v 100.0
cd06391400 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v 100.0
PRK15404369 leucine ABC transporter subunit substrate-binding 100.0
cd06394333 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleu 100.0
cd06342334 PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind 100.0
KOG1056878 consensus Glutamate-gated metabotropic ion channel 100.0
cd06338345 PBP1_ABC_ligand_binding_like_5 Type I periplasmic 100.0
cd06345344 PBP1_ABC_ligand_binding_like_10 Type I periplasmic 100.0
cd06346312 PBP1_ABC_ligand_binding_like_11 Type I periplasmic 100.0
PF01094348 ANF_receptor: Receptor family ligand binding regio 100.0
cd06368324 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu 100.0
cd06355348 PBP1_FmdD_like Periplasmic component (FmdD) of an 100.0
cd06348344 PBP1_ABC_ligand_binding_like_13 Type I periplasmic 100.0
cd06340347 PBP1_ABC_ligand_binding_like_6 Type I periplasmic 100.0
cd06381363 PBP1_iGluR_delta_like N-terminal leucine/isoleucin 100.0
COG0683366 LivK ABC-type branched-chain amino acid transport 100.0
cd06343362 PBP1_ABC_ligand_binding_like_8 Type I periplasmic 100.0
TIGR03669374 urea_ABC_arch urea ABC transporter, substrate-bind 100.0
cd06350348 PBP1_GPCR_family_C_like Ligand-binding domain of m 100.0
TIGR03407359 urea_ABC_UrtA urea ABC transporter, urea binding p 100.0
cd06344332 PBP1_ABC_ligand_binding_like_9 Type I periplasmic 100.0
cd06349340 PBP1_ABC_ligand_binding_like_14 Type I periplasmic 100.0
cd06327334 PBP1_SBP_like_1 Periplasmic solute-binding domain 100.0
PF13458343 Peripla_BP_6: Periplasmic binding protein; PDB: 4E 100.0
cd06331333 PBP1_AmiC_like Type I periplasmic components of am 100.0
cd06347334 PBP1_ABC_ligand_binding_like_12 Type I periplasmic 100.0
cd06329342 PBP1_SBP_like_3 Periplasmic solute-binding domain 100.0
cd06359333 PBP1_Nba_like Type I periplasmic binding component 100.0
cd06357360 PBP1_AmiC Periplasmic binding domain of amidase (A 100.0
cd06336347 PBP1_ABC_ligand_binding_like_3 Type I periplasmic 100.0
cd06360336 PBP1_alkylbenzenes_like Type I periplasmic binding 100.0
cd06378362 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/ 100.0
cd06328333 PBP1_SBP_like_2 Periplasmic solute-binding domain 100.0
cd06330346 PBP1_Arsenic_SBP_like Periplasmic solute-binding d 100.0
cd06356334 PBP1_Amide_Urea_BP_like Periplasmic component (Fmd 100.0
cd06358333 PBP1_NHase Type I periplasmic-binding protein of t 100.0
cd06335347 PBP1_ABC_ligand_binding_like_2 Type I periplasmic 100.0
cd06334351 PBP1_ABC_ligand_binding_like_1 Type I periplasmic 100.0
cd06332333 PBP1_aromatic_compounds_like Type I periplasmic bi 100.0
cd06383368 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine 99.98
cd06337357 PBP1_ABC_ligand_binding_like_4 Type I periplasmic 99.98
cd06351328 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleuc 99.98
cd06377382 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/ 99.97
KOG1055865 consensus GABA-B ion channel receptor subunit GABA 99.97
PF13433363 Peripla_BP_5: Periplasmic binding protein domain; 99.97
cd06326336 PBP1_STKc_like Type I periplasmic binding domain o 99.97
cd06339336 PBP1_YraM_LppC_lipoprotein_like Periplasmic bindin 99.96
cd06341341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic 99.96
TIGR03863347 PQQ_ABC_bind ABC transporter, substrate binding pr 99.96
cd06269298 PBP1_glutamate_receptors_like Family C G-protein c 99.95
cd04509299 PBP1_ABC_transporter_GCPR_C_like Family C of G-pro 99.94
cd06333312 PBP1_ABC-type_HAAT_like Type I periplasmic binding 99.94
cd06369380 PBP1_GC_C_enterotoxin_receptor Ligand-binding doma 99.93
cd06268298 PBP1_ABC_transporter_LIVBP_like Periplasmic bindin 99.92
PRK10797302 glutamate and aspartate transporter subunit; Provi 99.8
PRK11917259 bifunctional adhesin/ABC transporter aspartate/glu 99.79
PRK11260266 cystine transporter subunit; Provisional 99.79
PRK09495247 glnH glutamine ABC transporter periplasmic protein 99.78
PRK15010260 ABC transporter lysine/arginine/ornithine binding 99.75
PF00497225 SBP_bac_3: Bacterial extracellular solute-binding 99.75
PRK15007243 putative ABC transporter arginine-biding protein; 99.74
TIGR01096250 3A0103s03R lysine-arginine-ornithine-binding perip 99.74
PRK15437259 histidine ABC transporter substrate-binding protei 99.72
TIGR02995275 ectoine_ehuB ectoine/hydroxyectoine ABC transporte 99.72
PRK10859 482 membrane-bound lytic transglycosylase F; Provision 99.69
TIGR03870246 ABC_MoxJ methanol oxidation system protein MoxJ. T 99.64
cd01391269 Periplasmic_Binding_Protein_Type_1 Type 1 periplas 99.63
PF00060148 Lig_chan: Ligand-gated ion channel; InterPro: IPR0 99.6
TIGR03871232 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associa 99.59
PRK09959 1197 hybrid sensory histidine kinase in two-component r 99.56
PRK09959 1197 hybrid sensory histidine kinase in two-component r 99.55
COG0834275 HisJ ABC-type amino acid transport/signal transduc 99.53
TIGR02285268 conserved hypothetical protein. Members of this fa 99.49
smart00062219 PBPb Bacterial periplasmic substrate-binding prote 99.46
cd00134218 PBPb Bacterial periplasmic transport systems use m 99.45
PF04348536 LppC: LppC putative lipoprotein; InterPro: IPR0074 99.42
COG4623 473 Predicted soluble lytic transglycosylase fused to 99.16
PF1061365 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- 99.13
TIGR01098254 3A0109s03R phosphate/phosphite/phosphonate ABC tra 98.89
cd01537264 PBP1_Repressors_Sugar_Binding_like Ligand-binding 98.88
cd01536267 PBP1_ABC_sugar_binding_like Periplasmic sugar-bind 98.84
smart00079134 PBPe Eukaryotic homologues of bacterial periplasmi 98.81
COG3107604 LppC Putative lipoprotein [General function predic 98.71
cd06267264 PBP1_LacI_sugar_binding_like Ligand binding domain 98.68
cd06300272 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-bi 98.67
cd06320275 PBP1_allose_binding Periplasmic allose-binding dom 98.66
cd06325281 PBP1_ABC_uncharacterized_transporter Type I peripl 98.59
COG2984322 ABC-type uncharacterized transport system, peripla 98.58
cd06282266 PBP1_GntR_like_2 Ligand-binding domain of putative 98.46
PRK10653295 D-ribose transporter subunit RbsB; Provisional 98.44
cd06323268 PBP1_ribose_binding Periplasmic sugar-binding doma 98.39
PRK00489287 hisG ATP phosphoribosyltransferase; Reviewed 98.33
PF13407257 Peripla_BP_4: Periplasmic binding protein domain; 98.31
cd06319277 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-b 98.28
cd06317275 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-bi 98.28
cd06310273 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-bi 98.25
cd06301272 PBP1_rhizopine_binding_like Periplasmic binding pr 98.24
cd06312271 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-bi 98.24
cd06309273 PBP1_YtfQ_like Periplasmic binding domain of ABC-t 98.12
cd06273268 PBP1_GntR_like_1 This group includes the ligand-bi 98.11
cd01545270 PBP1_SalR Ligand-binding domain of DNA transcripti 98.1
PRK10936343 TMAO reductase system periplasmic protein TorT; Pr 98.09
cd06311274 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-bi 98.05
PRK09701311 D-allose transporter subunit; Provisional 98.04
COG1879322 RbsB ABC-type sugar transport system, periplasmic 97.98
cd06305273 PBP1_methylthioribose_binding_like Methylthioribos 97.97
PRK15395330 methyl-galactoside ABC transporter galactose-bindi 97.96
cd06298268 PBP1_CcpA_like Ligand-binding domain of the catabo 97.95
cd06303280 PBP1_LuxPQ_Quorum_Sensing Periplasmic binding prot 97.94
TIGR03431288 PhnD phosphonate ABC transporter, periplasmic phos 97.9
cd01539303 PBP1_GGBP Periplasmic glucose/galactose-binding pr 97.89
cd06322267 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-b 97.89
cd06308270 PBP1_sensor_kinase_like Periplasmic binding domain 97.88
cd06289268 PBP1_MalI_like Ligand-binding domain of MalI, a tr 97.87
cd06321271 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-b 97.87
cd06271268 PBP1_AglR_RafR_like Ligand-binding domain of DNA t 97.86
cd06284267 PBP1_LacI_like_6 Ligand-binding domain of an uncha 97.85
PF00532279 Peripla_BP_1: Periplasmic binding proteins and sug 97.83
PRK15408336 autoinducer 2-binding protein lsrB; Provisional 97.79
cd01542259 PBP1_TreR_like Ligand-binding domain of DNA transc 97.78
PRK10355330 xylF D-xylose transporter subunit XylF; Provisiona 97.76
cd01540289 PBP1_arabinose_binding Periplasmic L-arabinose-bin 97.76
cd06306268 PBP1_TorT-like TorT-like proteins, a periplasmic b 97.76
cd06316294 PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-bi 97.73
cd01574264 PBP1_LacI Ligand-binding domain of DNA transcripti 97.73
cd06278266 PBP1_LacI_like_2 Ligand-binding domain of uncharac 97.7
cd06275269 PBP1_PurR Ligand-binding domain of purine represso 97.69
cd06288269 PBP1_sucrose_transcription_regulator Ligand-bindin 97.69
cd06281269 PBP1_LacI_like_5 Ligand-binding domain of uncharac 97.69
cd01575268 PBP1_GntR Ligand-binding domain of DNA transcripti 97.68
cd06295275 PBP1_CelR Ligand binding domain of a transcription 97.67
cd06283267 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of 97.66
cd06274264 PBP1_FruR Ligand binding domain of DNA transcripti 97.66
PRK11303328 DNA-binding transcriptional regulator FruR; Provis 97.65
COG1609333 PurR Transcriptional regulators [Transcription] 97.63
cd06318282 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-bi 97.62
cd06313272 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-bi 97.61
cd06324305 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-b 97.61
TIGR01481329 ccpA catabolite control protein A. Catabolite cont 97.61
cd06277268 PBP1_LacI_like_1 Ligand-binding domain of uncharac 97.59
cd06299265 PBP1_LacI_like_13 Ligand-binding domain of DNA-bin 97.59
cd06296270 PBP1_CatR_like Ligand-binding domain of a LacI-lik 97.58
cd01538288 PBP1_ABC_xylose_binding Periplasmic xylose-binding 97.58
cd06270268 PBP1_GalS_like Ligand binding domain of DNA transc 97.57
cd06314271 PBP1_tmGBP Periplasmic sugar-binding domain of The 97.54
cd06294270 PBP1_ycjW_transcription_regulator_like Ligand-bind 97.53
TIGR02417327 fruct_sucro_rep D-fructose-responsive transcriptio 97.53
cd06293269 PBP1_LacI_like_11 Ligand-binding domain of unchara 97.51
PRK10014342 DNA-binding transcriptional repressor MalI; Provis 97.5
TIGR02955295 TMAO_TorT TMAO reductase system periplasmic protei 97.49
cd06292273 PBP1_LacI_like_10 Ligand-binding domain of unchara 97.49
cd06291265 PBP1_Qymf_like Ligand binding domain of the lacI-l 97.45
cd06286260 PBP1_CcpB_like Ligand-binding domain of a novel tr 97.42
PF04392294 ABC_sub_bind: ABC transporter substrate binding pr 97.39
cd06285265 PBP1_LacI_like_7 Ligand-binding domain of uncharac 97.38
PRK10703341 DNA-binding transcriptional repressor PurR; Provis 97.35
cd01541273 PBP1_AraR Ligand-binding domain of DNA transcripti 97.33
PRK10423327 transcriptional repressor RbsR; Provisional 97.32
cd06280263 PBP1_LacI_like_4 Ligand-binding domain of uncharac 97.3
cd06302298 PBP1_LsrB_Quorum_Sensing Periplasmic binding domai 97.3
PRK09492315 treR trehalose repressor; Provisional 97.25
cd06290265 PBP1_LacI_like_9 Ligand-binding domain of uncharac 97.24
cd06304260 PBP1_BmpA_like Periplasmic binding component of a 97.23
cd06307275 PBP1_uncharacterized_sugar_binding Periplasmic sug 97.2
cd06279283 PBP1_LacI_like_3 Ligand-binding domain of uncharac 97.18
cd01543265 PBP1_XylR Ligand-binding domain of DNA transcripti 97.18
PRK09526342 lacI lac repressor; Reviewed 97.16
cd06297269 PBP1_LacI_like_12 Ligand-binding domain of unchara 97.16
PRK11553314 alkanesulfonate transporter substrate-binding subu 97.14
TIGR02634302 xylF D-xylose ABC transporter, substrate-binding p 97.1
TIGR01729 300 taurine_ABC_bnd taurine ABC transporter, periplasm 97.06
cd06272261 PBP1_hexuronate_repressor_like Ligand-binding doma 97.04
PRK10727343 DNA-binding transcriptional regulator GalR; Provis 97.03
TIGR02637302 RhaS rhamnose ABC transporter, rhamnose-binding pr 97.01
PRK14987331 gluconate operon transcriptional regulator; Provis 96.99
PF12974243 Phosphonate-bd: ABC transporter, phosphonate, peri 96.97
cd06354265 PBP1_BmpA_PnrA_like Periplasmic binding domain of 96.93
PRK10401346 DNA-binding transcriptional regulator GalS; Provis 96.88
PRK11041309 DNA-binding transcriptional regulator CytR; Provis 96.8
TIGR02405311 trehalos_R_Ecol trehalose operon repressor, proteo 96.73
PF13379252 NMT1_2: NMT1-like family; PDB: 2G29_A 3UN6_A 2I4C_ 96.68
cd06315280 PBP1_ABC_sugar_binding_like_6 Periplasmic sugar-bi 96.61
PF09084216 NMT1: NMT1/THI5 like; InterPro: IPR015168 This ent 96.54
TIGR03427 328 ABC_peri_uca ABC transporter periplasmic binding p 96.53
cd01544270 PBP1_GalR Ligand-binding domain of DNA transcripti 96.45
cd06353258 PBP1_BmpA_Med_like Periplasmic binding domain of t 96.17
COG4213341 XylF ABC-type xylose transport system, periplasmic 95.93
TIGR02122320 TRAP_TAXI TRAP transporter solute receptor, TAXI f 95.91
PF14503232 YhfZ_C: YhfZ C-terminal domain; PDB: 2OZZ_B. 95.79
TIGR01728288 SsuA_fam ABC transporter, substrate-binding protei 95.64
COG3221299 PhnD ABC-type phosphate/phosphonate transport syst 95.51
COG1744345 Med Uncharacterized ABC-type transport system, per 95.37
PRK11480 320 tauA taurine transporter substrate binding subunit 94.81
cd06287269 PBP1_LacI_like_8 Ligand-binding domain of uncharac 94.67
PF12727193 PBP_like: PBP superfamily domain; InterPro: IPR024 94.47
TIGR00787257 dctP tripartite ATP-independent periplasmic transp 94.27
PF0788579 Ion_trans_2: Ion channel; InterPro: IPR013099 This 94.12
TIGR02990239 ectoine_eutA ectoine utilization protein EutA. Mem 93.61
COG2358321 Imp TRAP-type uncharacterized transport system, pe 93.42
TIGR01256216 modA molybdenum ABC transporter, periplasmic molyb 92.76
PRK10339327 DNA-binding transcriptional repressor EbgR; Provis 92.3
PF02608306 Bmp: Basic membrane protein; InterPro: IPR003760 T 92.13
COG1638332 DctP TRAP-type C4-dicarboxylate transport system, 91.78
PF03480286 SBP_bac_7: Bacterial extracellular solute-binding 91.37
COG1910223 Periplasmic molybdate-binding protein/domain [Inor 91.18
cd06353258 PBP1_BmpA_Med_like Periplasmic binding domain of t 90.86
PF13531230 SBP_bac_11: Bacterial extracellular solute-binding 90.76
PF12683275 DUF3798: Protein of unknown function (DUF3798); In 90.64
PF03466209 LysR_substrate: LysR substrate binding domain; Int 90.46
cd06276247 PBP1_FucR_like Ligand-binding domain of a transcri 89.77
cd05466197 PBP2_LTTR_substrate The substrate binding domain o 89.72
COG0715 335 TauA ABC-type nitrate/sulfonate/bicarbonate transp 89.4
COG3473238 Maleate cis-trans isomerase [Secondary metabolites 88.9
cd08442193 PBP2_YofA_SoxR_like The C-terminal substrate bindi 88.18
cd08459201 PBP2_DntR_NahR_LinR_like The C-terminal substrate 86.97
cd08418201 PBP2_TdcA The C-terminal substrate binding domain 86.88
cd08426199 PBP2_LTTR_like_5 The C-terminal substrate binding 85.78
PRK10200230 putative racemase; Provisional 85.55
KOG1419 654 consensus Voltage-gated K+ channel KCNQ [Inorganic 84.85
cd08468202 PBP2_Pa0477 The C-terminal substrate biniding doma 84.25
PF01177216 Asp_Glu_race: Asp/Glu/Hydantoin racemase; InterPro 84.09
cd08433198 PBP2_Nac The C-teminal substrate binding domain of 83.34
cd08421198 PBP2_LTTR_like_1 The C-terminal substrate binding 83.19
cd08434195 PBP2_GltC_like The substrate binding domain of Lys 82.84
COG1464268 NlpA ABC-type metal ion transport system, periplas 82.45
cd08419197 PBP2_CbbR_RubisCO_like The C-terminal substrate bi 82.38
cd08412198 PBP2_PAO1_like The C-terminal substrate-binding do 82.12
PF03808172 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/Cp 81.9
cd08462200 PBP2_NodD The C-terminal substsrate binding domain 81.51
cd08414197 PBP2_LTTR_aromatics_like The C-terminal substrate 81.34
cd08427195 PBP2_LTTR_like_2 The C-terminal substrate binding 81.31
TIGR00035229 asp_race aspartate racemase. 80.84
PF13377160 Peripla_BP_3: Periplasmic binding protein-like dom 80.59
cd08460200 PBP2_DntR_like_1 The C-terminal substrate binding 80.54
PF02608306 Bmp: Basic membrane protein; InterPro: IPR003760 T 80.47
cd08438197 PBP2_CidR The C-terminal substrate binding domain 80.14
cd08417200 PBP2_Nitroaromatics_like The C-terminal substrate 80.11
>KOG1054 consensus Glutamate-gated AMPA-type ion channel receptor subunit GluR2 and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=6.4e-81  Score=630.11  Aligned_cols=679  Identities=19%  Similarity=0.312  Sum_probs=550.2

Q ss_pred             CCcEEEEEEEeCCCcCchHHHHHHHHHHHHHhcCCC--C--cEEEEEEec-CCCCHHHHHHHHHHHHhcCCeEEEEcCCc
Q 004136           32 EEVTKIGAIVDANSQMGKQAITAMKIAVQNFNSDSR--N--HKLSLQIRD-HNRDPFQAATAAQELINKEKVKVIAGMET  106 (771)
Q Consensus        32 ~~~I~IG~i~p~s~~~g~~~~~a~~~Av~~iN~~~~--g--~~i~l~~~D-~~~~~~~a~~~~~~li~~~~v~aviGp~~  106 (771)
                      +.+|.||.+||...   .+...|+++|+...|....  .  .++..++.. ...+......+.|+.. +++|.||+|-..
T Consensus        24 ~~tiqigglF~~n~---~qe~~Afr~~~~~~~~~~~~~~~pf~L~~~~d~~e~a~Sf~~tnafCsq~-s~Gv~Aifg~yd   99 (897)
T KOG1054|consen   24 PNTIQIGGLFPRNT---DQEHSAFRFAVQLYNTNQNTTEKPFKLNPHVDNLESANSFAVTNAFCSQF-SRGVYAIFGFYD   99 (897)
T ss_pred             CCceeeccccCCcc---hHHHHHHHHHHHHhhcCCCCCCCCcccccccchhhhhhhHHHHHHHHHHH-hhhHhhheeccc
Confidence            46799999999974   4567899999998887541  2  333333322 2257778888899988 899999999999


Q ss_pred             hHhHHHHHHhhccCCccEEeecCCCCCCCccCCCCceEEEeecCcHHHHHHHHHHHHHcCCeEEEEEEEeCCCCCCcchH
Q 004136          107 WEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKL  186 (771)
Q Consensus       107 s~~~~~v~~~~~~~~iP~Is~~a~~~~~~l~~~~~p~~fr~~p~~~~~~~a~~~~l~~~~w~~v~ii~~~~~~g~~~~~~  186 (771)
                      -.....+..+|...++|+|+++..      .+...++..++.|+   +-.++++++.||+|.++.++|+.+. |  ....
T Consensus       100 ~ks~~~ltsfc~aLh~~~vtpsfp------~~~~~~Fviq~RP~---l~~al~s~i~hy~W~~fv~lyD~~r-g--~s~L  167 (897)
T KOG1054|consen  100 KKSVNTLTSFCGALHVSFVTPSFP------TDGDNQFVIQMRPA---LKGALLSLIDHYKWEKFVYLYDTDR-G--LSIL  167 (897)
T ss_pred             ccchhhhhhhccceeeeeecccCC------cCCCceEEEEeCch---HHHHHHHHHHhcccceEEEEEcccc-h--HHHH
Confidence            999999999999999999988765      34556899999998   5789999999999999999998876 5  7778


Q ss_pred             HHHHHHHhccCCeEEEEeeecCCCCCCCCchHHHHHHHHHhhhCCceEEEEEecChhHHHHHHHHHHHcCCCCCCeEEEe
Q 004136          187 ALLAEALQNVSSSEIQSRLVLPPISSISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIV  266 (771)
Q Consensus       187 ~~l~~~~~~~g~~~i~~~~~~~~~~~~~d~~~~~~~~l~~l~~~~~~vIv~~~~~~~~~~~il~~a~~~g~~~~~~~~i~  266 (771)
                      +++-+.+.+++ +.|...-.-...+     ...++.+++.+...+.+-|++ .|..+....++.++-+.+-..++|+++.
T Consensus       168 qai~~~a~~~n-w~VtA~~v~~~~d-----~~~yr~~f~~l~~r~e~rv~i-Dce~~~~~~il~q~i~~~k~~~~YHYvl  240 (897)
T KOG1054|consen  168 QAIMEAAAQNN-WQVTAINVGNIND-----VKEYRMLFEMLDRRQENRVLI-DCESERRNRILLQVIELGKHVKGYHYVL  240 (897)
T ss_pred             HHHHHHHHhcC-ceEEEEEcCCccc-----HHHHHHHHHHHhccccceEEE-EcccHHHHHHHHHHHHHhhhccceEEEE
Confidence            88888998889 8888764332222     145999999999888888888 8999998999999888888889999999


Q ss_pred             eCcccccccccChhhhhccccEEEEEeeccCCChhHHHHHHHHHHhcccCCCCCCCCCCchhhhhHhHHHHHHHHHHHhh
Q 004136          267 TNTVANALDSLNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRL  346 (771)
Q Consensus       267 ~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~a~~~YDav~~~a~Al~~~  346 (771)
                      .+......+.  ........++.++.....++ |..++|.++|++.-..+++...+..+..-++.+|||++++++|++.+
T Consensus       241 aNl~f~d~dl--~~f~~g~aNitgFqivn~~~-~~~~k~~~~~~~l~~~~~~g~~~~~~k~tsAlthDailV~~eaf~~~  317 (897)
T KOG1054|consen  241 ANLGFTDIDL--ERFQHGGANITGFQIVNKNN-PMVKKFIQRWKELDEREYPGASNDPIKYTSALTHDAILVMAEAFRSL  317 (897)
T ss_pred             eeCCCchhhH--HHHhcCCcceeEEEEecCCC-hHHHHHHHHHhhhcccccCCCCCCCcchhhhhhhhHHHHHHHHHHHH
Confidence            8875433322  22234456788888877777 89999999999877667776656667778999999999999999987


Q ss_pred             ccC--------------------CCChHHHHHHHHcCceeceeeeEEEeCCCCCCCCeEEEEEeeCCceEEEEEecCCCC
Q 004136          347 NYN--------------------ISSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFG  406 (771)
Q Consensus       347 ~~~--------------------~~~~~~l~~~l~~~~f~G~tG~v~Fd~~g~~~~~~~~I~~~~~~~~~~vg~w~~~~~  406 (771)
                      ..+                    |..|..+.++|+++.++|+||.|.||..|.|.|.+.+|++++.++..++|.|+...+
T Consensus       318 ~~q~~~~~rRG~~GD~~an~~~p~~qG~~I~ralk~v~~eGLTGniqFd~~G~R~Nyt~~i~elk~~~~rk~~~W~e~~~  397 (897)
T KOG1054|consen  318 RRQRIDISRRGNAGDCLANPAVPWEQGIDIERALKQVQVEGLTGNIQFDKYGRRTNYTIDIVELKSNGSRKVGYWNEGEG  397 (897)
T ss_pred             HHhhhchhccCCCccccCCCCCchhcchhHHHHHHheeecccccceeecccCccccceEEEEEeccCCcceeeeecccCc
Confidence            643                    567888999999999999999999999999999999999999999999999999988


Q ss_pred             CccccCCCccccccCccccCCCCcceecCCCCCCCCCCccccCCCCCceEEEeccCCCccceEEeccCCCCCCCCCCCcc
Q 004136          407 FSKTSSKHNVGDISSNIAAEGFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLR  486 (771)
Q Consensus       407 ~~~~~~~~~~~~~~~~~~~~~~~~~i~Wp~~~~~~~p~~~~~~~~~~~~~v~~~~~~~~~p~~~~~~~~~~~~~g~~~~~  486 (771)
                      +.......            .       .++       +..-..+.+ +.|.+...   .||+|.+++-+. ..|  |++
T Consensus       398 fv~~~t~a------------~-------~~~-------d~~~~~n~t-vvvttiL~---spyvm~kkn~~~-~eg--n~r  444 (897)
T KOG1054|consen  398 FVPGSTVA------------Q-------SRN-------DQASKENRT-VVVTTILE---SPYVMLKKNHEQ-LEG--NER  444 (897)
T ss_pred             eeeccccc------------c-------ccc-------cccccccce-EEEEEecC---CchhHHHhhHHH-hcC--Ccc
Confidence            76432110            0       000       001112333 34444433   357888876422 234  678


Q ss_pred             cccchHHHHHHHHHHCCCcccEEEecC--------CCC-hHHHHHHHhcccccEEEeeEeeeccceeeeecccceeeccE
Q 004136          487 YDGFSIELFRLVVDHLNYDLPYEFVPH--------DGV-YDDLINGVYDKTYDAAVGDLTILGNRTEYVEFTQPYAESGF  557 (771)
Q Consensus       487 ~~G~~~~l~~~~a~~l~f~~~~~~~~~--------~~~-~~~~i~~l~~~~~D~~~~~~~~t~~r~~~~~fs~p~~~~~~  557 (771)
                      ++|||+||+.+||+..+++|++.++.+        +++ |+||+++|..|++|++++++|||.+|++++|||.||+..|+
T Consensus       445 yEGyCvdLa~~iAkhi~~~Y~l~iv~dgkyGardaD~k~WnGMvGeLv~grAdiavApLTIt~~REeviDFSKPfMslGI  524 (897)
T KOG1054|consen  445 YEGYCVDLAAEIAKHIGIKYKLFIVGDGKYGARDADTKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGI  524 (897)
T ss_pred             cceeHHHHHHHHHHhcCceEEEEEecCCcccccCCCcccccchhHHHhcCccceEEeeeeeehhhhhhhccccchhhcCe
Confidence            999999999999999999987777744        455 99999999999999999999999999999999999999999


Q ss_pred             EEEEecCCCC--CccccccCCCHHHHHHHHHHHHHHHHhhhhhccccCccCcCc-------------ccchHHHHHHHHH
Q 004136          558 SMIVPAKQEE--STWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEFRGT-------------LKDQISNILWFAF  622 (771)
Q Consensus       558 ~~~v~~~~~~--~~~~~~~pF~~~vW~~i~~~~~~~~~~~~~~~~~~~~~~~~~-------------~~~~~~~~~~~~~  622 (771)
                      +||+++|.+.  +.|+|+.|+..++|+||+.+++.+++++++..|++|.+++..             ...++.||+|+++
T Consensus       525 SIMIKKPqKsk~gVFSFldPLa~eIWm~ivfaYiGVSvvlFLVSrFSPYEwh~Ee~~rg~~t~~~~~NeFgifNsLWFsL  604 (897)
T KOG1054|consen  525 SIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFERGRFTPSDPPNEFGIFNSLWFSL  604 (897)
T ss_pred             EEEEeCcccCCCCeeeecchhHHHHHHHHHHHHhcceEEEEEEeccCchheeccccccCCCCCCCCCccchhhHHHHHHH
Confidence            9999999765  799999999999999999999999999999999998776432             1235889999999


Q ss_pred             HHhhccC-cccccchhhHHHHHHHHHHHHHHHHHhhcccccceeecccCCCCCChhHhh-hCCceEEEecChHHHHHHHH
Q 004136          623 STIFFSH-RANIQSNLTRVVVVLWLFVVFILTSSYTASLSSLLTVRRLEPNVTDIQSLK-SGNLKVGCVDDSFVKKYLEE  700 (771)
Q Consensus       623 ~~~~~~~-~~~~~~~s~Rl~~~~~~~~~li~~~~Yta~L~s~lt~~~~~~~i~~~~dL~-~~~~~~g~~~~s~~~~~l~~  700 (771)
                      ++++||| -..|++.|+|++.++||||+|||+++||||||||||++++.+||+|.|||+ ++.+.+|+..+.....|++.
T Consensus       605 gAFMQQG~DI~PRslSGRIvggvWWFFTlIIiSSYTANLAAFLTvErMvsPIESaEDLAkQteIaYGt~~~GSTkeFFr~  684 (897)
T KOG1054|consen  605 GAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRR  684 (897)
T ss_pred             HHHHhcCCCCCccccccceeccchhhhhhhhhhhhhhHHHHHHhHHhhcCcchhHHHHhhcceeeeeecCCCchHHHHhh
Confidence            9999999 457899999999999999999999999999999999999999999999998 56899999888888888876


Q ss_pred             h--------cCCCC-CCcccCCCCHHHHHHHHHc-CCceEEEecchhHHHHHHh-cCCceeEeeeeeeceEEEEEecCCC
Q 004136          701 V--------LGFRS-GNIVPFGNTEANYIQKFEN-NTIDSLFLERPYEKVFLDK-YCKKYTAINTYRFGGLGFVSNIIYS  769 (771)
Q Consensus       701 ~--------~~~~~-~~~~~~~~~~~~~~~~v~~-~~~~a~i~~~~~~~~~~~~-~c~~l~~~~~~~~~~~g~~~~k~s~  769 (771)
                      .        ..++. .....|..+..|++++|++ ++.|||+.|++.-+|.-++ .|+.+++.+.+.+.+||+|.||||.
T Consensus       685 Skiavy~kMW~yM~SaepsVFv~t~aeGv~rVRksKGkyAfLLEsTmNey~eqRkPCDTMKVGgNLds~GYGiATp~Gss  764 (897)
T KOG1054|consen  685 SKIAVYEKMWTYMKSAEPSVFVRTTAEGVARVRKSKGKYAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSS  764 (897)
T ss_pred             hhHHHHHHHHHHHhcCCcceeeehhhhHHHHHHhcCCceEeehHhhhhhhhhccCCccceecccccCCcceeecCCCCcc
Confidence            3        11111 1222233358999999995 4469999999999987765 6994444449999999999999995

>KOG4440 consensus NMDA selective glutamate-gated ion channel receptor subunit GRIN1 [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1053 consensus Glutamate-gated NMDA-type ion channel receptor subunit GRIN2A and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1052 consensus Glutamate-gated kainate-type ion channel receptor subunit GluR5 and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor Back     alignment and domain information
>cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
>cd06362 PBP1_mGluR Ligand binding domain of the metabotropic glutamate receptors (mGluR) Back     alignment and domain information
>cd06364 PBP1_CaSR Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06374 PBP1_mGluR_groupI Ligand binding domain of the group I metabotropic glutamate receptor Back     alignment and domain information
>cd06365 PBP1_Pheromone_receptor Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor Back     alignment and domain information
>cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor Back     alignment and domain information
>cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor Back     alignment and domain information
>cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor Back     alignment and domain information
>cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor Back     alignment and domain information
>cd06373 PBP1_NPR_like Ligand binding domain of natriuretic peptide receptor (NPR) family Back     alignment and domain information
>cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors Back     alignment and domain information
>cd06372 PBP1_GC_G_like Ligand-binding domain of membrane guanylyl cyclase G Back     alignment and domain information
>cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor Back     alignment and domain information
>cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor Back     alignment and domain information
>cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor Back     alignment and domain information
>cd06370 PBP1_Speract_GC_like Ligand-binding domain of membrane bound guanylyl cyclases Back     alignment and domain information
>cd06390 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor Back     alignment and domain information
>cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>cd06389 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor Back     alignment and domain information
>cd06384 PBP1_NPR_B Ligand-binding domain of type B natriuretic peptide receptor Back     alignment and domain information
>cd06388 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor Back     alignment and domain information
>cd06371 PBP1_sensory_GC_DEF_like Ligand-binding domain of membrane guanylyl cyclases (GC-D, GC-E, and GC-F) that are specifically expressed in sensory tissues Back     alignment and domain information
>cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06387 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor Back     alignment and domain information
>cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors Back     alignment and domain information
>cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family Back     alignment and domain information
>PRK15404 leucine ABC transporter subunit substrate-binding protein LivK; Provisional Back     alignment and domain information
>cd06394 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor Back     alignment and domain information
>cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) Back     alignment and domain information
>KOG1056 consensus Glutamate-gated metabotropic ion channel receptor subunit GRM2 and related subunits, G-protein coupled receptor superfamily [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd06338 PBP1_ABC_ligand_binding_like_5 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06345 PBP1_ABC_ligand_binding_like_10 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [] Back     alignment and domain information
>cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>cd06355 PBP1_FmdD_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06381 PBP1_iGluR_delta_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 Back     alignment and domain information
>COG0683 LivK ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism] Back     alignment and domain information
>cd06343 PBP1_ABC_ligand_binding_like_8 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>TIGR03669 urea_ABC_arch urea ABC transporter, substrate-binding protein, archaeal type Back     alignment and domain information
>cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) Back     alignment and domain information
>TIGR03407 urea_ABC_UrtA urea ABC transporter, urea binding protein Back     alignment and domain information
>cd06344 PBP1_ABC_ligand_binding_like_9 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06349 PBP1_ABC_ligand_binding_like_14 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems Back     alignment and domain information
>cd06327 PBP1_SBP_like_1 Periplasmic solute-binding domain of active transport proteins that belong to the type I periplasmic binding fold protein family Back     alignment and domain information
>PF13458 Peripla_BP_6: Periplasmic binding protein; PDB: 4EVS_A 4EY3_A 4EYG_B 4EYK_A 3H5L_B 3TD9_A 3EAF_A 1Z18_A 1Z17_A 2LIV_A Back     alignment and domain information
>cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF) Back     alignment and domain information
>cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06329 PBP1_SBP_like_3 Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>cd06359 PBP1_Nba_like Type I periplasmic binding component of active transport systems that are predicted to be involved in 2-nitrobenzoic acid degradation pathway Back     alignment and domain information
>cd06357 PBP1_AmiC Periplasmic binding domain of amidase (AmiC) that belongs to the type I periplasmic binding fold protein family Back     alignment and domain information
>cd06336 PBP1_ABC_ligand_binding_like_3 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06360 PBP1_alkylbenzenes_like Type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene Back     alignment and domain information
>cd06378 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family Back     alignment and domain information
>cd06328 PBP1_SBP_like_2 Periplasmic solute-binding domain of active transport proteins found in gram-negative and gram-positive bacteria Back     alignment and domain information
>cd06330 PBP1_Arsenic_SBP_like Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>cd06356 PBP1_Amide_Urea_BP_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>cd06358 PBP1_NHase Type I periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides Back     alignment and domain information
>cd06335 PBP1_ABC_ligand_binding_like_2 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06334 PBP1_ABC_ligand_binding_like_1 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06332 PBP1_aromatic_compounds_like Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes Back     alignment and domain information
>cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors Back     alignment and domain information
>cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06351 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) Back     alignment and domain information
>cd06377 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR3 subunit of NMDA receptor family Back     alignment and domain information
>KOG1055 consensus GABA-B ion channel receptor subunit GABABR1 and related subunits, G-protein coupled receptor superfamily [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF13433 Peripla_BP_5: Periplasmic binding protein domain; PDB: 1QNL_A 1QO0_A 1PEA_A Back     alignment and domain information
>cd06326 PBP1_STKc_like Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins Back     alignment and domain information
>cd06339 PBP1_YraM_LppC_lipoprotein_like Periplasmic binding component of lipoprotein LppC, an immunodominant antigen Back     alignment and domain information
>cd06341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>TIGR03863 PQQ_ABC_bind ABC transporter, substrate binding protein, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids Back     alignment and domain information
>cd06369 PBP1_GC_C_enterotoxin_receptor Ligand-binding domain of the membrane guanylyl cyclase C Back     alignment and domain information
>cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>PRK15010 ABC transporter lysine/arginine/ornithine binding periplasmic protein; Provisional Back     alignment and domain information
>PF00497 SBP_bac_3: Bacterial extracellular solute-binding proteins, family 3; InterPro: IPR001638 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>PRK15007 putative ABC transporter arginine-biding protein; Provisional Back     alignment and domain information
>TIGR01096 3A0103s03R lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information
>PRK15437 histidine ABC transporter substrate-binding protein HisJ; Provisional Back     alignment and domain information
>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein Back     alignment and domain information
>PRK10859 membrane-bound lytic transglycosylase F; Provisional Back     alignment and domain information
>TIGR03870 ABC_MoxJ methanol oxidation system protein MoxJ Back     alignment and domain information
>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory Back     alignment and domain information
>TIGR03871 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associated probable ABC transporter substrate-binding protein Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>COG0834 HisJ ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02285 conserved hypothetical protein Back     alignment and domain information
>smart00062 PBPb Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>cd00134 PBPb Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>PF04348 LppC: LppC putative lipoprotein; InterPro: IPR007443 This entry includes several bacterial outer membrane antigens, whose molecular function is unknown Back     alignment and domain information
>COG4623 Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF10613 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- and glycine-binding site; InterPro: IPR019594 This entry, sometimes called the S1 domain, is the luminal domain just upstream of the first, M1, transmembrane region of transmembrane ion-channel proteins, and binds L-glutamate and glycine [, ] Back     alignment and domain information
>TIGR01098 3A0109s03R phosphate/phosphite/phosphonate ABC transporters, periplasmic binding protein Back     alignment and domain information
>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems Back     alignment and domain information
>cd01536 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>smart00079 PBPe Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information
>COG3107 LppC Putative lipoprotein [General function prediction only] Back     alignment and domain information
>cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily Back     alignment and domain information
>cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily Back     alignment and domain information
>cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis Back     alignment and domain information
>cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>cd06282 PBP1_GntR_like_2 Ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK10653 D-ribose transporter subunit RbsB; Provisional Back     alignment and domain information
>cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs Back     alignment and domain information
>PRK00489 hisG ATP phosphoribosyltransferase; Reviewed Back     alignment and domain information
>PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A Back     alignment and domain information
>cd06319 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06317 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06301 PBP1_rhizopine_binding_like Periplasmic binding proteins specific to rhizopines Back     alignment and domain information
>cd06312 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06309 PBP1_YtfQ_like Periplasmic binding domain of ABC-type YtfQ-like transport systems Back     alignment and domain information
>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK10936 TMAO reductase system periplasmic protein TorT; Provisional Back     alignment and domain information
>cd06311 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK09701 D-allose transporter subunit; Provisional Back     alignment and domain information
>COG1879 RbsB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>PRK15395 methyl-galactoside ABC transporter galactose-binding periplasmic protein MglB; Provisional Back     alignment and domain information
>cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation Back     alignment and domain information
>cd06303 PBP1_LuxPQ_Quorum_Sensing Periplasmic binding protein (LuxP) of autoinducer-2 (AI-2) receptor LuxPQ from Vibrio harveyi and its close homologs Back     alignment and domain information
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein Back     alignment and domain information
>cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species Back     alignment and domain information
>cd06322 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06308 PBP1_sensor_kinase_like Periplasmic binding domain of two-component sensor kinase signaling systems Back     alignment and domain information
>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria Back     alignment and domain information
>cd06321 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06271 PBP1_AglR_RafR_like Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06284 PBP1_LacI_like_6 Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria Back     alignment and domain information
>PF00532 Peripla_BP_1: Periplasmic binding proteins and sugar binding domain of LacI family; InterPro: IPR001761 This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators Back     alignment and domain information
>PRK15408 autoinducer 2-binding protein lsrB; Provisional Back     alignment and domain information
>cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK10355 xylF D-xylose transporter subunit XylF; Provisional Back     alignment and domain information
>cd01540 PBP1_arabinose_binding Periplasmic L-arabinose-binding protein (ABP), a member of a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily Back     alignment and domain information
>cd06306 PBP1_TorT-like TorT-like proteins, a periplasmic binding protein family that activates induction of the Tor respiratory system upon trimethylamine N-oxide (TMAO) electron-acceptor binding in bacteria Back     alignment and domain information
>cd06316 PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd01574 PBP1_LacI Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06278 PBP1_LacI_like_2 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli Back     alignment and domain information
>cd06288 PBP1_sucrose_transcription_regulator Ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR Back     alignment and domain information
>cd06274 PBP1_FruR Ligand binding domain of DNA transcription repressor specific for fructose (FruR) and its close homologs Back     alignment and domain information
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional Back     alignment and domain information
>COG1609 PurR Transcriptional regulators [Transcription] Back     alignment and domain information
>cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06313 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06324 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>TIGR01481 ccpA catabolite control protein A Back     alignment and domain information
>cd06277 PBP1_LacI_like_1 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06299 PBP1_LacI_like_13 Ligand-binding domain of DNA-binding regulatory protein from Corynebacterium glutamicum which has a unique ability to produce significant amounts of L-glutamate directly from cheap sugar and ammonia Back     alignment and domain information
>cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation Back     alignment and domain information
>cd01538 PBP1_ABC_xylose_binding Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>cd06270 PBP1_GalS_like Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism Back     alignment and domain information
>cd06314 PBP1_tmGBP Periplasmic sugar-binding domain of Thermotoga maritima glucose-binding protein (tmGBP) and its close homologs Back     alignment and domain information
>cd06294 PBP1_ycjW_transcription_regulator_like Ligand-binding domain of uncharacterized transcription regulator ycjW which is a member of the LacI-GalR family repressors Back     alignment and domain information
>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor Back     alignment and domain information
>cd06293 PBP1_LacI_like_11 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>TIGR02955 TMAO_TorT TMAO reductase system periplasmic protein TorT Back     alignment and domain information
>cd06292 PBP1_LacI_like_10 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06291 PBP1_Qymf_like Ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs Back     alignment and domain information
>cd06286 PBP1_CcpB_like Ligand-binding domain of a novel transcription factor implicated in catabolite repression in Bacillus and Clostridium species Back     alignment and domain information
>PF04392 ABC_sub_bind: ABC transporter substrate binding protein; InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional Back     alignment and domain information
>cd01541 PBP1_AraR Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK10423 transcriptional repressor RbsR; Provisional Back     alignment and domain information
>cd06280 PBP1_LacI_like_4 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06302 PBP1_LsrB_Quorum_Sensing Periplasmic binding domain of autoinducer-2 (AI-2) receptor LsrB from Salmonella typhimurium and its close homologs Back     alignment and domain information
>PRK09492 treR trehalose repressor; Provisional Back     alignment and domain information
>cd06290 PBP1_LacI_like_9 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06304 PBP1_BmpA_like Periplasmic binding component of a family of basic membrane lipoproteins from Borrelia and various putative lipoproteins from other bacteria Back     alignment and domain information
>cd06307 PBP1_uncharacterized_sugar_binding Periplasmic sugar-binding domain of uncharacterized transport systems Back     alignment and domain information
>cd06279 PBP1_LacI_like_3 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd01543 PBP1_XylR Ligand-binding domain of DNA transcription repressor specific for xylose (XylR) Back     alignment and domain information
>PRK09526 lacI lac repressor; Reviewed Back     alignment and domain information
>cd06297 PBP1_LacI_like_12 Ligand-binding domain of uncharacterized transcription regulators from Thermus thermophilus and close homologs Back     alignment and domain information
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional Back     alignment and domain information
>TIGR02634 xylF D-xylose ABC transporter, substrate-binding protein Back     alignment and domain information
>TIGR01729 taurine_ABC_bnd taurine ABC transporter, periplasmic binding protein Back     alignment and domain information
>cd06272 PBP1_hexuronate_repressor_like Ligand-binding domain of DNA transcription repressor for the hexuronate utilization operon from Bacillus species and its close homologs from other bacteria, all of which are a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK10727 DNA-binding transcriptional regulator GalR; Provisional Back     alignment and domain information
>TIGR02637 RhaS rhamnose ABC transporter, rhamnose-binding protein Back     alignment and domain information
>PRK14987 gluconate operon transcriptional regulator; Provisional Back     alignment and domain information
>PF12974 Phosphonate-bd: ABC transporter, phosphonate, periplasmic substrate-binding protein ; PDB: 3N5L_B 3QUJ_C 3P7I_A 3QK6_A 3S4U_A Back     alignment and domain information
>cd06354 PBP1_BmpA_PnrA_like Periplasmic binding domain of basic membrane lipoprotein, PnrA, in Treponema pallidum and its homologs from other bacteria and Archaea Back     alignment and domain information
>PRK10401 DNA-binding transcriptional regulator GalS; Provisional Back     alignment and domain information
>PRK11041 DNA-binding transcriptional regulator CytR; Provisional Back     alignment and domain information
>TIGR02405 trehalos_R_Ecol trehalose operon repressor, proteobacterial Back     alignment and domain information
>PF13379 NMT1_2: NMT1-like family; PDB: 2G29_A 3UN6_A 2I4C_A 2I49_A 2I4B_A 2I48_A 3QSL_A Back     alignment and domain information
>cd06315 PBP1_ABC_sugar_binding_like_6 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PF09084 NMT1: NMT1/THI5 like; InterPro: IPR015168 This entry is found in the NMT1 and THI5 proteins Back     alignment and domain information
>TIGR03427 ABC_peri_uca ABC transporter periplasmic binding protein, urea carboxylase region Back     alignment and domain information
>cd01544 PBP1_GalR Ligand-binding domain of DNA transcription repressor GalR which is one of two regulatory proteins involved in galactose transport and metabolism Back     alignment and domain information
>cd06353 PBP1_BmpA_Med_like Periplasmic binding domain of the basic membrane lipoprotein Med in Bacillus and its close homologs from other bacteria and Archaea Back     alignment and domain information
>COG4213 XylF ABC-type xylose transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02122 TRAP_TAXI TRAP transporter solute receptor, TAXI family Back     alignment and domain information
>PF14503 YhfZ_C: YhfZ C-terminal domain; PDB: 2OZZ_B Back     alignment and domain information
>TIGR01728 SsuA_fam ABC transporter, substrate-binding protein, aliphatic sulfonates family Back     alignment and domain information
>COG3221 PhnD ABC-type phosphate/phosphonate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1744 Med Uncharacterized ABC-type transport system, periplasmic component/surface lipoprotein [General function prediction only] Back     alignment and domain information
>PRK11480 tauA taurine transporter substrate binding subunit; Provisional Back     alignment and domain information
>cd06287 PBP1_LacI_like_8 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PF12727 PBP_like: PBP superfamily domain; InterPro: IPR024370 This entry represents members of the periplasmic binding domain superfamily [] Back     alignment and domain information
>TIGR00787 dctP tripartite ATP-independent periplasmic transporter solute receptor, DctP family Back     alignment and domain information
>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] Back     alignment and domain information
>TIGR02990 ectoine_eutA ectoine utilization protein EutA Back     alignment and domain information
>COG2358 Imp TRAP-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>TIGR01256 modA molybdenum ABC transporter, periplasmic molybdate-binding protein Back     alignment and domain information
>PRK10339 DNA-binding transcriptional repressor EbgR; Provisional Back     alignment and domain information
>PF02608 Bmp: Basic membrane protein; InterPro: IPR003760 This is a family of basic membrane lipoproteins from Borrelia and various putative lipoproteins from other bacteria Back     alignment and domain information
>COG1638 DctP TRAP-type C4-dicarboxylate transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03480 SBP_bac_7: Bacterial extracellular solute-binding protein, family 7; InterPro: IPR018389 This family of proteins are involved in binding extracellular solutes for transport across the bacterial cytoplasmic membrane Back     alignment and domain information
>COG1910 Periplasmic molybdate-binding protein/domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd06353 PBP1_BmpA_Med_like Periplasmic binding domain of the basic membrane lipoprotein Med in Bacillus and its close homologs from other bacteria and Archaea Back     alignment and domain information
>PF13531 SBP_bac_11: Bacterial extracellular solute-binding protein; PDB: 2HXW_B 3FJG_C 3FJM_B 3FJ7_B 3FIR_B 3AXF_C 1WOD_A 1AMF_A 3R26_A 1SBP_A Back     alignment and domain information
>PF12683 DUF3798: Protein of unknown function (DUF3798); InterPro: IPR024258 This entry represents functionally uncharacterised proteins that are found in bacteria Back     alignment and domain information
>PF03466 LysR_substrate: LysR substrate binding domain; InterPro: IPR005119 The structure of this domain is known and is similar to the periplasmic binding proteins [] Back     alignment and domain information
>cd06276 PBP1_FucR_like Ligand-binding domain of a transcription repressor, FucR, which functions as a molecular sensor of L-fucose availability Back     alignment and domain information
>cd05466 PBP2_LTTR_substrate The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily Back     alignment and domain information
>COG0715 TauA ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3473 Maleate cis-trans isomerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd08442 PBP2_YofA_SoxR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08459 PBP2_DntR_NahR_LinR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators that are involved in the catabolism of dinitrotoluene, naphthalene and gamma-hexachlorohexane; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08418 PBP2_TdcA The C-terminal substrate binding domain of LysR-type transcriptional regulator TdcA, which is involved in the degradation of L-serine and L-threonine, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08426 PBP2_LTTR_like_5 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>PRK10200 putative racemase; Provisional Back     alignment and domain information
>KOG1419 consensus Voltage-gated K+ channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd08468 PBP2_Pa0477 The C-terminal substrate biniding domain of an uncharacterized LysR-like transcriptional regulator Pa0477 related to DntR, contains the type 2 periplasmic binding fold Back     alignment and domain information
>PF01177 Asp_Glu_race: Asp/Glu/Hydantoin racemase; InterPro: IPR015942 This entry represents a group of related proteins that includes aspartate racemase, glutamate racemase, hydantoin racemase and arylmalonate decarboxylase Back     alignment and domain information
>cd08433 PBP2_Nac The C-teminal substrate binding domain of LysR-like nitrogen assimilation control (NAC) protein, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08421 PBP2_LTTR_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08434 PBP2_GltC_like The substrate binding domain of LysR-type transcriptional regulator GltC, which activates gltA expression of glutamate synthase operon, contains type 2 periplasmic binding fold Back     alignment and domain information
>COG1464 NlpA ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd08419 PBP2_CbbR_RubisCO_like The C-terminal substrate binding of LysR-type transcriptional regulator (CbbR) of RubisCO operon, which is involved in the carbon dioxide fixation, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08412 PBP2_PAO1_like The C-terminal substrate-binding domain of putative LysR-type transcriptional regulator PAO1-like, a member of the type 2 periplasmic binding fold protein superfamily Back     alignment and domain information
>PF03808 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/CpsF family; InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli Back     alignment and domain information
>cd08462 PBP2_NodD The C-terminal substsrate binding domain of NodD family of LysR-type transcriptional regulators that regulates the expression of nodulation (nod) genes; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08414 PBP2_LTTR_aromatics_like The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold Back     alignment and domain information
>cd08427 PBP2_LTTR_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>TIGR00035 asp_race aspartate racemase Back     alignment and domain information
>PF13377 Peripla_BP_3: Periplasmic binding protein-like domain; PDB: 3K9C_B 3BIL_B 3JVD_B 1ZAY_A 1VPW_A 1DBQ_A 2PUA_A 1QQA_A 1PNR_A 1JHZ_A Back     alignment and domain information
>cd08460 PBP2_DntR_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold Back     alignment and domain information
>PF02608 Bmp: Basic membrane protein; InterPro: IPR003760 This is a family of basic membrane lipoproteins from Borrelia and various putative lipoproteins from other bacteria Back     alignment and domain information
>cd08438 PBP2_CidR The C-terminal substrate binding domain of LysR-like transcriptional regulator CidR, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08417 PBP2_Nitroaromatics_like The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query771
4f11_A433 Crystal Structure Of The Extracellular Domain Of Hu 1e-10
4ey3_A368 Crystal Structure Of Solute Binding Protein Of Abc 7e-08
3kg2_A 823 Ampa Subtype Ionotropic Glutamate Receptor In Compl 1e-07
3lmk_A492 Ligand Binding Domain Of Metabotropoc Glutamate Rec 6e-06
4evs_A371 Crystal Structure Of Abc Transporter From R. Palust 7e-05
3ks9_A496 Metabotropic Glutamate Receptor Mglur1 Complexed Wi 8e-05
3mq4_A481 Metabotropic Glutamate Receptor Mglur7 Complexed Wi 1e-04
2liv_A344 Periplasmic Binding Protein Structure And Function. 1e-04
2e4z_A501 Crystal Structure Of The Ligand-Binding Region Of T 1e-04
1ewk_A490 Crystal Structure Of Metabotropic Glutamate Recepto 1e-04
3g3k_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 1e-04
3oek_A286 Crystal Structure Of Glun2d Ligand-Binding Core In 2e-04
3g3i_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 2e-04
1z15_A344 Crystal Structure Analysis Of Periplasmic Leu/ile/v 2e-04
3g3j_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 2e-04
2e4u_A555 Crystal Structure Of The Extracellular Region Of Th 2e-04
3sm9_A479 Crystal Structure Of Metabotropic Glutamate Recepto 2e-04
4f06_A371 Crystal Structure Of Solute Binding Protein Of Abc 3e-04
>pdb|4F11|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Gaba(B) Receptor Gbr2 Length = 433 Back     alignment and structure 
Iteration: 1

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 88/403 (21%), Positives = 163/403 (40%), Gaps = 74/403 (18%)
Query: 43  ANSQMGKQAITAMKIAVQNFNSDS--RNHKLSLQIRDHNRDPFQAATAAQELI--NKEKV 98
           A   +G+  + A+++A++   ++S  R + L L++ D   D  +   A  + I      +
Sbjct: 28  AKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHL 87
Query: 99  KVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTP-LSMSRRWPYLIRMASNDSEQMKC 157
            V  G+     T+++AE      +  LSFAA   TP L+  +++PY  R   +D+     
Sbjct: 88  MVFGGVCP-SVTSIIAESLQGWNLVQLSFAA--TTPVLADKKKYPYFFRTVPSDNAVNPA 144
Query: 158 IADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPISSIS-DP 216
           I  L + Y W+RV  + +D         +   +E   +++       + +    S S DP
Sbjct: 145 ILKLLKHYQWKRVGTLTQD---------VQRFSEVRNDLTGVLYGEDIEISDTESFSNDP 195
Query: 217 KEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIV---------- 266
             +V    KK++    R+ I+ Q   +M   +F  A    + G    WI+          
Sbjct: 196 CTSV----KKLKGNDVRI-ILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWE 250
Query: 267 -TNTVANALDSLNTTVISSMEGTLGIKXXXXXXXXPYKEFSALFRRNFTSEY-PEEDHFH 324
             +T AN+   L   ++++MEG +G+           K  S    + +  EY  +     
Sbjct: 251 QVHTEANSSRCLRKNLLAAMEGYIGVDFEPLSSKQ-IKTISGKTPQQYEREYNNKRSGVG 309
Query: 325 PSIHALRAHDSIKIITEAIGR----------------LNYNISS-PEMLLRQMLSSDFSG 367
           PS     A+D I +I + + R                 NY   +   ++L  M  ++F G
Sbjct: 310 PSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFG 369
Query: 368 LSGKIRFKDGELLN---------------------ADTLRIVN 389
           ++G++ F++GE +                      ADTL I+N
Sbjct: 370 VTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIIN 412
>pdb|4EY3|A Chain A, Crystal Structure Of Solute Binding Protein Of Abc Transporter In Complex With P-Hydroxybenzoic Acid Length = 368 Back     alignment and structure
>pdb|3KG2|A Chain A, Ampa Subtype Ionotropic Glutamate Receptor In Complex With Competitive Antagonist Zk 200775 Length = 823 Back     alignment and structure
>pdb|3LMK|A Chain A, Ligand Binding Domain Of Metabotropoc Glutamate Receptor Mglur5 Complexed With Glutamate Length = 492 Back     alignment and structure
>pdb|4EVS|A Chain A, Crystal Structure Of Abc Transporter From R. Palustris - Solute Binding Protein (Rpa0985) In Complex With 4-Hydroxybenzoate Length = 371 Back     alignment and structure
>pdb|3KS9|A Chain A, Metabotropic Glutamate Receptor Mglur1 Complexed With Ly341495 Antagonist Length = 496 Back     alignment and structure
>pdb|3MQ4|A Chain A, Metabotropic Glutamate Receptor Mglur7 Complexed With Ly3414 Antagonist Length = 481 Back     alignment and structure
>pdb|2LIV|A Chain A, Periplasmic Binding Protein Structure And Function. Refined X-Ray Structures Of The LeucineISOLEUCINEVALINE-Binding Protein And Its Complex With Leucine Length = 344 Back     alignment and structure
>pdb|2E4Z|A Chain A, Crystal Structure Of The Ligand-Binding Region Of The Group Iii Metabotropic Glutamate Receptor Length = 501 Back     alignment and structure
>pdb|1EWK|A Chain A, Crystal Structure Of Metabotropic Glutamate Receptor Subtype 1 Complexed With Glutamate Length = 490 Back     alignment and structure
>pdb|3G3K|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k E757q Mutant With Glutamate And Nacl At 1.24 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3OEK|A Chain A, Crystal Structure Of Glun2d Ligand-Binding Core In Complex With L- Aspartate Length = 286 Back     alignment and structure
>pdb|3G3I|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e I749l Q753k Mutant With Glutamate And Nacl At 1.37 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|1Z15|A Chain A, Crystal Structure Analysis Of Periplasmic Leu/ile/val-binding Protein In Superopen Form Length = 344 Back     alignment and structure
>pdb|3G3J|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k Mutant With Glutamate And Nacl At 1.32 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|2E4U|A Chain A, Crystal Structure Of The Extracellular Region Of The Group Ii Metabotropic Glutamate Receptor Complexed With L-glutamate Length = 555 Back     alignment and structure
>pdb|3SM9|A Chain A, Crystal Structure Of Metabotropic Glutamate Receptor 3 Precursor In Presence Of Ly341495 Antagonist Length = 479 Back     alignment and structure
>pdb|4F06|A Chain A, Crystal Structure Of Solute Binding Protein Of Abc Transporter From Rhodopseudomonas Palustris Haa2 Rpb_2270 In Complex With P- Hydroxybenzoic Acid Length = 371 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query771
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 1e-129
3om0_A393 Glutamate receptor, ionotropic kainate 5; membrane 6e-64
3h6g_A395 Glutamate receptor, ionotropic kainate 2; membrane 3e-61
4f11_A433 Gamma-aminobutyric acid type B receptor subunit 2; 7e-54
3hsy_A376 Glutamate receptor 2; ligand-gated ION channel, sy 4e-52
3o21_A389 Glutamate receptor 3; periplasmatic binding protei 6e-50
3saj_A384 Glutamate receptor 1; rossman fold, ION channel, m 2e-48
3qel_B364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 7e-48
3qek_A384 NMDA glutamate receptor subunit; amino terminal do 2e-45
1jdp_A441 NPR-C, atrial natriuretic peptide clearance recept 1e-42
1dp4_A435 Atrial natriuretic peptide receptor A; periplasmic 6e-38
4evq_A375 Putative ABC transporter subunit, substrate-bindi 1e-28
4eyg_A368 Twin-arginine translocation pathway signal; PSI-bi 1e-25
3sg0_A386 Extracellular ligand-binding receptor; structural 2e-24
3i45_A387 Twin-arginine translocation pathway signal protei; 4e-23
3eaf_A391 ABC transporter, substrate binding protein; PSI2, 3e-20
3lkb_A392 Probable branched-chain amino acid ABC transporter 5e-20
3lop_A364 Substrate binding periplasmic protein; protein str 2e-19
3i09_A375 Periplasmic branched-chain amino acid-binding Pro; 2e-19
4f06_A371 Extracellular ligand-binding receptor; PSI-biology 5e-19
1usg_A346 Leucine-specific binding protein; leucine-binding 5e-19
3ipc_A356 ABC transporter, substrate binding protein (amino; 3e-18
3snr_A362 Extracellular ligand-binding receptor; structural 5e-18
3snr_A362 Extracellular ligand-binding receptor; structural 3e-04
3mq4_A481 Mglur7, metabotropic glutamate receptor 7; glutama 6e-18
3hut_A358 Putative branched-chain amino acid ABC transporter 3e-17
3hut_A358 Putative branched-chain amino acid ABC transporter 6e-05
3n0x_A374 Possible substrate binding protein of ABC transpo 8e-17
3ks9_A496 Mglur1, metabotropic glutamate receptor 1; glutama 9e-17
3n0w_A379 ABC branched chain amino acid family transporter, 2e-16
1pea_A385 Amidase operon; gene regulator, receptor, binding 3e-16
3sm9_A479 Mglur3, metabotropic glutamate receptor 3; structu 2e-15
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 4e-15
3td9_A366 Branched chain amino acid ABC transporter, peripl 1e-14
2e4u_A555 Metabotropic glutamate receptor 3; G-protein-coupl 2e-14
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-13
3h5l_A419 Putative branched-chain amino acid ABC transporter 1e-12
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 1e-11
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 2e-11
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 3e-10
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 2e-09
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 2e-08
3k4u_A245 Binding component of ABC transporter; structural g 4e-08
3tql_A227 Arginine-binding protein; transport and binding pr 5e-08
2h4a_A325 YRAM (HI1655); perplasmic binding protein, lipopro 6e-08
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 6e-08
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 1e-07
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 1e-07
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 1e-07
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 2e-07
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 2e-07
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 3e-07
3kzg_A237 Arginine 3RD transport system periplasmic binding 4e-07
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 4e-07
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 5e-07
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 6e-07
2yln_A283 Putative ABC transporter, periplasmic binding Pro 6e-07
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 6e-07
3qax_A268 Probable ABC transporter arginine-binding protein; 8e-07
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 1e-06
3hv1_A268 Polar amino acid ABC uptake transporter substrate 2e-06
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 2e-06
4eq9_A246 ABC transporter substrate-binding protein-amino A 2e-06
3del_B242 Arginine binding protein; alpha and beta protein ( 3e-06
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 8e-06
2q88_A257 EHUB, putative ABC transporter amino acid-binding 1e-05
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 2e-05
2vha_A287 Periplasmic binding transport protein; periplasmic 3e-05
2o1m_A258 Probable amino-acid ABC transporter extracellular- 3e-05
1xt8_A292 Putative amino-acid transporter periplasmic solut 6e-05
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure
 Score =  402 bits (1034), Expect = e-129
 Identities = 128/787 (16%), Positives = 256/787 (32%), Gaps = 123/787 (15%)

Query: 36  KIGAIVDANSQMGKQAITAMKIAVQNFNSDSRNHKLSLQIRDHNR-DPFQAATAAQELIN 94
           +IG +    +    Q  +A ++ +  F++     +L+  I +    + F    A     +
Sbjct: 4   QIGGLFPRGA---DQEYSAFRVGMVQFSTS--EFRLTPHIDNLEVANSFAVTNAFCSQFS 58

Query: 95  KEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDSEQ 154
           +  V  I G    +    +      + V  ++ +             P++I+M     + 
Sbjct: 59  R-GVYAIFGFYDKKSVNTITSFCGTLHVSFITPS------FPTDGTHPFVIQMRP---DL 108

Query: 155 MKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPISSIS 214
              +  L   Y W + A +Y+ +        L  + ++       ++ +  V    +   
Sbjct: 109 KGALLSLIEYYQWDKFAYLYDSDRGLST---LQAVLDSAAE-KKWQVTAINVGNINNDKK 164

Query: 215 DPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVANAL 274
           D  E  R   + ++ K+ R  I+     D    +  +   +G   K   +I+ N      
Sbjct: 165 D--ETYRSLFQDLELKKERRVIL-DCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDG 221

Query: 275 DSLNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHD 334
           D L      +      I      D S   +F   +      EYP          +   +D
Sbjct: 222 DLLKIQFGGAEVSGFQI---VDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYD 278

Query: 335 SIKIITEAIGRLNYN--------------------ISSPEMLLRQMLSSDFSGLSGKIRF 374
           +++++TEA   L                             + R +      GLSG I+F
Sbjct: 279 AVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKF 338

Query: 375 KDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSSKHNVGDISSNIAAEGFTGPVIW 434
                    T+ I+ +     +++ +W        T    +                   
Sbjct: 339 DQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVLTEDDTS------------------G 380

Query: 435 PGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLRYDGFSIEL 494
                         P                  +V++K +      N+   RY+G+ ++L
Sbjct: 381 LEQKTVVVTTILESP------------------YVMMKANHAALAGNE---RYEGYCVDL 419

Query: 495 FRLVVDHLNYDLPYEFVPH---------DGVYDDLINGVYDKTYDAAVGDLTILGNRTEY 545
              +  H  +      V             +++ ++  +     D A+  LTI   R E 
Sbjct: 420 AAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEV 479

Query: 546 VEFTQPYAESGFSMIV--PAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQS- 602
           ++F++P+   G S+++  P K +   + F  P  +E+WM    ++I    +++L+   S 
Sbjct: 480 IDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSP 539

Query: 603 ----NPEFRGTLKDQ---------ISNILWFAFSTIFFSHRANIQSNL-TRVVVVLWLFV 648
                 EF    + Q         I N LWF+              +L  R+V  +W F 
Sbjct: 540 YEWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGADISPRSLSGRIVGGVWWFF 599

Query: 649 VFILTSSYTASLSSLLTVRRLEPNVTDIQSL-KSGNLKVGCVDDSFVKKYLEEVLGF--- 704
             I+ SSYTA+L++ LTV R+   +   + L K   +  G +D    K++          
Sbjct: 600 TLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFD 659

Query: 705 ------RSGNIVPFGNTEANYIQK-FENNTIDSLFLERPYEKVFLDKYCKKYTAI-NTYR 756
                 RS     F  T A  + +  ++    +  LE    +    +       +     
Sbjct: 660 KMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLD 719

Query: 757 FGGLGFV 763
             G G  
Sbjct: 720 SKGYGIA 726
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Length = 393 Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Length = 395 Back     alignment and structure
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Length = 433 Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Length = 376 Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Length = 389 Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Length = 384 Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Length = 364 Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Length = 384 Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Length = 441 Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Length = 435 Back     alignment and structure
>4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Length = 375 Back     alignment and structure
>4eyg_A Twin-arginine translocation pathway signal; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: VNL; 1.86A {Rhodopseudomonas palustris} PDB: 4ey3_A* 3t0n_A* 4eyk_A* Length = 368 Back     alignment and structure
>3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* Length = 386 Back     alignment and structure
>3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Length = 387 Back     alignment and structure
>3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} Length = 391 Back     alignment and structure
>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Length = 392 Back     alignment and structure
>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Length = 364 Back     alignment and structure
>3i09_A Periplasmic branched-chain amino acid-binding Pro; type I periplasmic binding protein, structural genomics, JOI for structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} Length = 375 Back     alignment and structure
>4f06_A Extracellular ligand-binding receptor; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: MSE PHB; 1.30A {Rhodopseudomonas palustris} PDB: 4evs_A* Length = 371 Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Length = 346 Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Length = 356 Back     alignment and structure
>3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} PDB: 2e4z_A* Length = 481 Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Length = 358 Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Length = 358 Back     alignment and structure
>3n0x_A Possible substrate binding protein of ABC transpo system; receptor family ligand binding region, structural genomics; HET: MSE; 1.50A {Rhodopseudomonas palustris} PDB: 3nnd_B Length = 374 Back     alignment and structure
>3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* Length = 496 Back     alignment and structure
>3n0w_A ABC branched chain amino acid family transporter, periplasmic ligand binding protein...; receptor family ligand binding region; HET: MSE; 1.88A {Burkholderia xenovorans} Length = 379 Back     alignment and structure
>1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A Length = 385 Back     alignment and structure
>3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} Length = 479 Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Length = 312 Back     alignment and structure
>3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} Length = 366 Back     alignment and structure
>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* Length = 555 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Length = 265 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} Length = 419 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Length = 259 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Length = 263 Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Length = 284 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Length = 292 Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Length = 239 Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} Length = 245 Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} Length = 227 Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Length = 228 Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Length = 267 Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Length = 249 Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Length = 294 Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Length = 233 Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Length = 259 Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Length = 229 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} Length = 237 Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Length = 239 Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Length = 226 Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} Length = 232 Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Length = 283 Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Length = 271 Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Length = 268 Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Length = 272 Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Length = 268 Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} Length = 234 Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Length = 246 Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} Length = 242 Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Length = 291 Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Length = 257 Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Length = 259 Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Length = 287 Back     alignment and structure
>2o1m_A Probable amino-acid ABC transporter extracellular-binding protein YTMK; NESG X-RAY O34852 YTMK_bacsu, structural genomics, PSI-2; 2.00A {Bacillus subtilis} Length = 258 Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Length = 292 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query771
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 100.0
4f11_A433 Gamma-aminobutyric acid type B receptor subunit 2; 100.0
3o21_A389 Glutamate receptor 3; periplasmatic binding protei 100.0
3hsy_A376 Glutamate receptor 2; ligand-gated ION channel, sy 100.0
1jdp_A441 NPR-C, atrial natriuretic peptide clearance recept 100.0
3om0_A393 Glutamate receptor, ionotropic kainate 5; membrane 100.0
3h6g_A395 Glutamate receptor, ionotropic kainate 2; membrane 100.0
3saj_A384 Glutamate receptor 1; rossman fold, ION channel, m 100.0
4gpa_A389 Glutamate receptor 4; PBP fold, ligand-gated ION c 100.0
1dp4_A435 Atrial natriuretic peptide receptor A; periplasmic 100.0
2e4u_A555 Metabotropic glutamate receptor 3; G-protein-coupl 100.0
3qek_A384 NMDA glutamate receptor subunit; amino terminal do 100.0
3sm9_A479 Mglur3, metabotropic glutamate receptor 3; structu 100.0
3ks9_A496 Mglur1, metabotropic glutamate receptor 1; glutama 100.0
3mq4_A481 Mglur7, metabotropic glutamate receptor 7; glutama 100.0
3i45_A387 Twin-arginine translocation pathway signal protei; 100.0
4f06_A371 Extracellular ligand-binding receptor; PSI-biology 100.0
3h5l_A419 Putative branched-chain amino acid ABC transporter 100.0
3td9_A366 Branched chain amino acid ABC transporter, peripl 100.0
4gnr_A353 ABC transporter substrate-binding protein-branche 100.0
3i09_A375 Periplasmic branched-chain amino acid-binding Pro; 100.0
3ipc_A356 ABC transporter, substrate binding protein (amino; 100.0
3n0w_A379 ABC branched chain amino acid family transporter, 100.0
3hut_A358 Putative branched-chain amino acid ABC transporter 100.0
4evq_A375 Putative ABC transporter subunit, substrate-bindi 100.0
1usg_A346 Leucine-specific binding protein; leucine-binding 100.0
4eyg_A368 Twin-arginine translocation pathway signal; PSI-bi 100.0
3lkb_A392 Probable branched-chain amino acid ABC transporter 100.0
3qel_B364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 100.0
3n0x_A374 Possible substrate binding protein of ABC transpo 100.0
3eaf_A391 ABC transporter, substrate binding protein; PSI2, 100.0
3lop_A364 Substrate binding periplasmic protein; protein str 100.0
3sg0_A386 Extracellular ligand-binding receptor; structural 100.0
1pea_A385 Amidase operon; gene regulator, receptor, binding 100.0
3snr_A362 Extracellular ligand-binding receptor; structural 100.0
2h4a_A325 YRAM (HI1655); perplasmic binding protein, lipopro 99.96
3ckm_A327 YRAM (HI1655), LPOA; periplasmic-binding protein, 99.96
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 99.88
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 99.86
4h5g_A243 Amino acid ABC superfamily ATP binding cassette tr 99.85
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 99.85
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 99.84
4gvo_A243 LMO2349 protein; structural genomics, IDP05245, L- 99.84
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 99.82
3k4u_A245 Binding component of ABC transporter; structural g 99.81
3kzg_A237 Arginine 3RD transport system periplasmic binding 99.81
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 99.81
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 99.8
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 99.8
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 99.8
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 99.79
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 99.79
3del_B242 Arginine binding protein; alpha and beta protein ( 99.79
3hv1_A268 Polar amino acid ABC uptake transporter substrate 99.78
3tql_A227 Arginine-binding protein; transport and binding pr 99.77
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 99.77
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 99.77
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 99.77
4eq9_A246 ABC transporter substrate-binding protein-amino A 99.75
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 99.75
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 99.74
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 99.74
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 99.74
2q88_A257 EHUB, putative ABC transporter amino acid-binding 99.72
1xt8_A292 Putative amino-acid transporter periplasmic solut 99.71
3qax_A268 Probable ABC transporter arginine-binding protein; 99.71
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 99.7
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 99.7
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 99.69
4i62_A269 Amino acid ABC transporter, periplasmic amino ACI 99.69
2vha_A287 Periplasmic binding transport protein; periplasmic 99.68
2yln_A283 Putative ABC transporter, periplasmic binding Pro 99.67
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 99.56
2ozz_A231 Hypothetical protein YHFZ; alpha-beta structure, s 98.97
3ksm_A276 ABC-type sugar transport system, periplasmic COMP; 98.47
2h3h_A313 Sugar ABC transporter, periplasmic sugar-binding p 98.46
3n5l_A310 Binding protein component of ABC phosphonate TRAN; 98.44
2rjo_A332 Twin-arginine translocation pathway signal protei; 98.43
3p7i_A321 PHND, subunit of alkylphosphonate ABC transporter; 98.36
3brs_A289 Periplasmic binding protein/LACI transcriptional; 98.35
3l49_A291 ABC sugar (ribose) transporter, periplasmic substr 98.35
3o74_A272 Fructose transport system repressor FRUR; dual tra 98.27
3o1i_D304 Periplasmic protein TORT; ligand free, two compone 98.27
2qh8_A302 Uncharacterized protein; conserved domain protein, 98.26
2fn9_A290 Ribose ABC transporter, periplasmic ribose-bindin; 98.25
3brq_A296 HTH-type transcriptional regulator ASCG; transcrip 98.25
1dbq_A289 Purine repressor; transcription regulation, DNA-bi 98.25
1tjy_A316 Sugar transport protein; protein-ligand complex, s 98.25
2x7x_A325 Sensor protein; transferase, sensor histidine kina 98.25
3rot_A297 ABC sugar transporter, periplasmic sugar binding; 98.23
3d02_A303 Putative LACI-type transcriptional regulator; peri 98.22
3h75_A350 Periplasmic sugar-binding domain protein; protein 98.21
2qu7_A288 Putative transcriptional regulator; structural gen 98.2
3lft_A295 Uncharacterized protein; ABC, ATPase, cassette, L- 98.19
2iks_A293 DNA-binding transcriptional dual regulator; escher 98.18
3c3k_A285 Alanine racemase; structural genomics, protein str 98.13
3l6u_A293 ABC-type sugar transport system periplasmic compo; 98.12
2fvy_A309 D-galactose-binding periplasmic protein; periplasm 98.12
2fep_A289 Catabolite control protein A; CCPA, transcriptiona 98.11
3m9w_A313 D-xylose-binding periplasmic protein; xylose bindi 98.11
3g1w_A305 Sugar ABC transporter; sugar-binding protein, baci 98.11
2ioy_A283 Periplasmic sugar-binding protein; ribose binding 98.11
3gbv_A304 Putative LACI-family transcriptional regulator; NY 98.09
2vk2_A306 YTFQ, ABC transporter periplasmic-binding protein 98.08
3egc_A291 Putative ribose operon repressor; structural genom 98.07
3lkv_A302 Uncharacterized conserved domain protein; ATPase b 98.01
8abp_A306 L-arabinose-binding protein; binding proteins; HET 98.0
1jx6_A342 LUXP protein; protein-ligand complex, signaling pr 97.99
2o20_A332 Catabolite control protein A; CCPA, transcriptiona 97.96
3dbi_A338 Sugar-binding transcriptional regulator, LACI FAM; 97.95
3bbl_A287 Regulatory protein of LACI family; protein structu 97.92
3clk_A290 Transcription regulator; 11017J, PSI-II, NYSGXRC, 97.92
3d8u_A275 PURR transcriptional regulator; APC91343.1, vibrio 97.9
3k4h_A292 Putative transcriptional regulator; structural gen 97.89
3gyb_A280 Transcriptional regulators (LACI-family transcript 97.88
3uif_A 348 Sulfonate ABC transporter, periplasmic sulfonate- 97.88
2h0a_A276 TTHA0807, transcriptional regulator; repressor, st 97.87
2rgy_A290 Transcriptional regulator, LACI family; 11011J, NY 97.84
3k9c_A289 Transcriptional regulator, LACI family protein; PS 97.83
2hsg_A332 Glucose-resistance amylase regulator; CCPA, transc 97.82
3ctp_A330 Periplasmic binding protein/LACI transcriptional; 97.82
3kke_A303 LACI family transcriptional regulator; structural 97.81
3hcw_A295 Maltose operon transcriptional repressor; RNA-bind 97.81
1gud_A288 ALBP, D-allose-binding periplasmic protein; peripl 97.79
1qpz_A340 PURA, protein (purine nucleotide synthesis repress 97.79
3tb6_A298 Arabinose metabolism transcriptional repressor; tr 97.77
3jy6_A276 Transcriptional regulator, LACI family; NYSGXRC, P 97.77
3gv0_A288 Transcriptional regulator, LACI family; transcript 97.76
3qk7_A294 Transcriptional regulators; structural genomics, N 97.73
2dri_A271 D-ribose-binding protein; sugar transport; HET: RI 97.72
1byk_A255 Protein (trehalose operon repressor); LACI family, 97.72
3e61_A277 Putative transcriptional repressor of ribose OPER; 97.71
3huu_A305 Transcription regulator like protein; PSI-II, NYSG 97.68
3kjx_A344 Transcriptional regulator, LACI family; LACL famil 97.65
3uug_A330 Multiple sugar-binding periplasmic receptor CHVE; 97.64
3bil_A348 Probable LACI-family transcriptional regulator; st 97.64
3e3m_A355 Transcriptional regulator, LACI family; structural 97.63
3h5o_A339 Transcriptional regulator GNTR; transcription regu 97.62
3g85_A289 Transcriptional regulator (LACI family); transcrip 97.62
3hs3_A277 Ribose operon repressor; PSI-II, NYSGXRC, periplas 97.58
3cs3_A277 Sugar-binding transcriptional regulator, LACI FAM; 97.58
3jvd_A333 Transcriptional regulators; structural genomics, P 97.57
2x26_A 308 Periplasmic aliphatic sulphonates-binding protein; 97.54
3ksx_A 324 Nitrate transport protein; SSUA, alkanesulfonate-b 97.54
3qsl_A 346 Putative exported protein; unknown, structural gen 97.5
4fe7_A412 Xylose operon regulatory protein; HTH_ARAC, helix- 97.5
2fqx_A318 Membrane lipoprotein TMPC; ABC transport system, l 97.45
3ix1_A302 N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine 97.45
3miz_A301 Putative transcriptional regulator protein, LACI f 97.44
2hqb_A296 Transcriptional activator of COMK gene; berkeley s 97.34
1jye_A349 Lactose operon repressor; gene regulation, protein 97.25
3un6_A341 Hypothetical protein saouhsc_00137; structural gen 97.21
3s99_A356 Basic membrane lipoprotein; ssgcid, structural gen 97.12
3qi7_A371 Putative transcriptional regulator; periplasmic bi 97.11
2f5x_A312 BUGD; periplasmic binding protein, transport prote 96.99
2qpq_A301 Protein BUG27; alpha/beta domain, venus flytrap, t 96.85
3h5t_A366 Transcriptional regulator, LACI family; DNA-depend 96.84
4ddd_A327 Immunogenic protein; ssgcid, structural genomics, 96.73
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 96.5
2dvz_A314 BUGE, putative exported protein; periplamsic bindi 96.5
2x7q_A 321 Ca3427, possible thiamine biosynthesis enzyme; unk 96.38
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 96.2
2a9h_A155 Voltage-gated potassium channel; potassium channel 96.1
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 95.83
4h33_A137 LMO2059 protein; bilayers, KVLM, lipidic cubic pha 95.62
2g29_A 417 Nitrate transport protein NRTA; solute-binding pro 95.55
2zzv_A361 ABC transporter, solute-binding protein; periplasm 94.95
1us5_A314 Putative GLUR0 ligand binding core; receptor, memb 94.92
3ouf_A97 Potassium channel protein; ION channel, membrane, 94.63
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 94.56
2q67_A114 Potassium channel protein; inverted teepee, helix 94.06
3ixl_A240 Amdase, arylmalonate decarboxylase; enantioselecti 93.93
2i49_A 429 Bicarbonate transporter; alpha-beta protein, C-cla 93.51
3jv9_A219 OXYR, transcriptional regulator, LYSR family; LYSR 93.5
2pfy_A301 Putative exported protein; extracytoplasmic solute 93.28
1p7b_A333 Integral membrane channel and cytosolic domains; t 92.98
2hzl_A365 Trap-T family sorbitol/mannitol transporter, perip 92.97
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 92.83
1xl4_A301 Inward rectifier potassium channel; integral membr 92.69
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 92.68
4esw_A 342 Pyrimidine biosynthesis enzyme THI13; thiamin pyri 92.58
2pfz_A301 Putative exported protein; extracytoplasmic solute 92.47
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 91.55
1zbm_A280 Hypothetical protein AF1704; alpha-beta protein, s 91.07
4ab5_A222 Transcriptional regulator, LYSR family; transcript 90.8
3ho7_A232 OXYR; beta-alpha-barrels, DNA-binding, transcripti 90.59
2qks_A321 KIR3.1-prokaryotic KIR channel chimera; G-protein 90.37
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 90.26
1atg_A231 MODA, periplasmic molybdate-binding protein; tungs 89.96
1sw5_A275 Osmoprotection protein (PROX); binding-protein, co 89.42
1lnq_A 336 MTHK channels, potassium channel related protein; 89.26
3r26_A237 Molybdate-binding periplasmic protein; protein bin 89.24
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 89.17
3oxn_A241 Putative transcriptional regulator, LYSR family; s 89.15
3s99_A356 Basic membrane lipoprotein; ssgcid, structural gen 88.68
2hpg_A327 ABC transporter, periplasmic substrate-binding pro 88.06
2fqx_A318 Membrane lipoprotein TMPC; ABC transport system, l 87.94
2de3_A 365 Dibenzothiophene desulfurization enzyme B; alpha-b 86.77
3gzg_A253 Molybdate-binding periplasmic protein; permease; m 86.76
3l6g_A256 Betaine ABC transporter permease and substrate BI 86.03
2y7p_A218 LYSR-type regulatory protein; transcription regula 84.79
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 84.49
2rin_A298 Putative glycine betaine-binding ABC transporter p 84.48
3tmg_A280 Glycine betaine, L-proline ABC transporter, glycin 84.47
2esn_A310 Probable transcriptional regulator; PA0477, APC582 84.08
2xwv_A312 Sialic acid-binding periplasmic protein SIAP; tran 84.07
2hqb_A296 Transcriptional activator of COMK gene; berkeley s 83.6
3k6v_A354 Solute-binding protein MA_0280; MODA, molybdate, p 83.36
1r9l_A309 Glycine betaine-binding periplasmic protein; perip 82.85
2xxp_A 398 CPS2A; replication, peptidoglycan, LCP, LYTR; HET: 80.44
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
Probab=100.00  E-value=1.8e-84  Score=775.98  Aligned_cols=670  Identities=19%  Similarity=0.308  Sum_probs=558.3

Q ss_pred             cEEEEEEEeCCCcCchHHHHHHHHHHHHHhcCCCCcEEEEEEecCCC-CHHHHHHHHHHHHhcCCeEEEEcCCchHhHHH
Q 004136           34 VTKIGAIVDANSQMGKQAITAMKIAVQNFNSDSRNHKLSLQIRDHNR-DPFQAATAAQELINKEKVKVIAGMETWEETAV  112 (771)
Q Consensus        34 ~I~IG~i~p~s~~~g~~~~~a~~~Av~~iN~~~~g~~i~l~~~D~~~-~~~~a~~~~~~li~~~~v~aviGp~~s~~~~~  112 (771)
                      +||||+++|+++.   ....|+++|+++||+++  ++|++++.|+++ ++..+.+.+|+++ +++|.+||||.+|..+.+
T Consensus         2 ~ikIG~l~~~tg~---~~~~a~~lAveeiN~~~--~~l~~~~~D~~~~~~~~a~~~~~~l~-~~~V~aiiG~~~S~~~~a   75 (823)
T 3kg2_A            2 SIQIGGLFPRGAD---QEYSAFRVGMVQFSTSE--FRLTPHIDNLEVANSFAVTNAFCSQF-SRGVYAIFGFYDKKSVNT   75 (823)
T ss_dssp             EEEEEEEEETTCH---HHHHHHHHHHHHTCCSS--CEEEEEEEEECTTCHHHHHHHHHHHH-HTTCSEEEECCCTTTHHH
T ss_pred             cceEEEEeCCCCh---HHHHHHHHHHHHHhcCC--eEEEEEEEEcCCCChHHHHHHHHHHH-hcCcEEEEcCCChhHHHH
Confidence            6999999999954   88999999999999996  999999999998 9999999999999 679999999999999999


Q ss_pred             HHHhhccCCccEEeecCCCCCCCccCCCCceEEEeecCcHHHHHHHHHHHHHcCCeEEEEEEEeCCCCCCcchHHHHHHH
Q 004136          113 VAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEA  192 (771)
Q Consensus       113 v~~~~~~~~iP~Is~~a~~~~~~l~~~~~p~~fr~~p~~~~~~~a~~~~l~~~~w~~v~ii~~~~~~g~~~~~~~~l~~~  192 (771)
                      ++++++.+++|+|++..    +..  ..+||+||+.|+   ++.+++++++++||++|++|+ |++||  ....+.++++
T Consensus        76 ~~~i~~~~~iP~is~~~----~~~--~~~~~~~r~~p~---~~~a~~~l~~~~gw~~v~ii~-d~~~g--~~~~~~~~~~  143 (823)
T 3kg2_A           76 ITSFCGTLHVSFITPSF----PTD--GTHPFVIQMRPD---LKGALLSLIEYYQWDKFAYLY-DSDRG--LSTLQAVLDS  143 (823)
T ss_dssp             HHHHHHHTTCEEEECSC----CCS--SCCSSEEECSCC---CHHHHHHHHHHTTCSEEEEEE-CGGGC--THHHHHHHHH
T ss_pred             HHHHhhcCCCceeeccc----CCC--CCCceEEEeCCC---HHHHHHHHHHHCCCCEEEEEE-eCChh--HHHHHHHHHH
Confidence            99999999999999743    332  467899999999   899999999999999999999 77889  9999999999


Q ss_pred             HhccCCeEEEEeeecCCCCCCCCchHHHHHHHHHhhhCCceEEEEEecChhHHHHHHHHHHHcCCCCCCeEEEeeCcccc
Q 004136          193 LQNVSSSEIQSRLVLPPISSISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVAN  272 (771)
Q Consensus       193 ~~~~g~~~i~~~~~~~~~~~~~d~~~~~~~~l~~l~~~~~~vIv~~~~~~~~~~~il~~a~~~g~~~~~~~~i~~~~~~~  272 (771)
                      +++.| ++|+..+.++......+  +++..++.+++++++|+|++ .++..++..++++|+++||.++.|+||.++....
T Consensus       144 ~~~~g-~~v~~~~~~~~~~~~~~--~d~~~~l~~i~~~~~~vii~-~~~~~~~~~~~~~a~~~g~~~~~~~~i~~~~~~~  219 (823)
T 3kg2_A          144 AAEKK-WQVTAINVGNINNDKKD--ETYRSLFQDLELKKERRVIL-DCERDKVNDIVDQVITIGKHVKGYHYIIANLGFT  219 (823)
T ss_dssp             HHHTT-CEEEEEECSSCCSSSTT--TTTTTHHHHTTTTTCCEEEE-ECCHHHHHHHHHHHHHHTTTBTTCEEEECSSBSS
T ss_pred             hhccC-CceEEEEeecCCCCccc--hhHHHHHHHHHhcCCeEEEE-ECCHHHHHHHHHHHHHcCcCCCCeEEEEeccccc
Confidence            99999 99999887765521111  56899999999999999999 9999999999999999999999999999985433


Q ss_pred             cccccChhhhhccccEEEEEeeccCCChhHHHHHHHHHHhcccCCCCCCCCCCchhhhhHhHHHHHHHHHHHhhccC---
Q 004136          273 ALDSLNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRLNYN---  349 (771)
Q Consensus       273 ~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~a~~~YDav~~~a~Al~~~~~~---  349 (771)
                      ....  ........+++++.++.+.. |.+++|.++|+++|..+++......++.+++++||||+++++|+++++.+   
T Consensus       220 ~~~~--~~~~~~~~~~~~~~~~~~~~-~~~~~f~~~~~~~~~~~~~~~~~~~~~~~a~~~YDAv~~la~Al~~~~~~~~~  296 (823)
T 3kg2_A          220 DGDL--LKIQFGGAEVSGFQIVDYDD-SLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRIE  296 (823)
T ss_dssp             SSCC--SSSSSSBCEEEEEESSCTTS-HHHHHHHHHHTTSCTTTSTTCCSSCCCHHHHHHHHHHHHHHHHHHHHHTTTCC
T ss_pred             ccch--HHhhcCCCCceEeeeecCCc-hHHHHHHHHHHhhcccccCCCCccccchhhHHHHHHHHHHHHHHHHHHhhccc
Confidence            2221  11223445688888777766 89999999999988777665444567888999999999999999997631   


Q ss_pred             -----------------CCChHHHHHHHHcCceeceeeeEEEeCCCCCCCCeEEEEEeeCCceEEEEEecCCCCCccccC
Q 004136          350 -----------------ISSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSS  412 (771)
Q Consensus       350 -----------------~~~~~~l~~~l~~~~f~G~tG~v~Fd~~g~~~~~~~~I~~~~~~~~~~vg~w~~~~~~~~~~~  412 (771)
                                       +.+++.|.++|++++|+|++|+++||++|++.+..|+|++++++++++||.|++..++.....
T Consensus       297 ~~~~~~~~~c~~~~~~~~~~g~~l~~~l~~~~f~G~tG~i~fd~~G~~~~~~~~I~~~~~~g~~~vg~w~~~~g~~~~~~  376 (823)
T 3kg2_A          297 ISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVLTED  376 (823)
T ss_dssp             CCCSSCCCCTTCSSCCCCTHHHHHHHHHTTCCCEETTEECCBCSSSCBCSCEEEEEEECSSCEEEEEEEETTTEEEECCC
T ss_pred             cccCCCCCCccCCCCCcccchHHHHHHHHhcccCCcccCeEECCCCcccccEEEEEEEcCCCCeeEEEEcCCCCceeccC
Confidence                             357889999999999999999999999999998999999999999999999999876553210


Q ss_pred             CCccccccCccccCCCCcceecCCCCCCCCCCccccCCCCCceEEEeccCCCccceEEeccCCCCCCCCCCCcccccchH
Q 004136          413 KHNVGDISSNIAAEGFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLRYDGFSI  492 (771)
Q Consensus       413 ~~~~~~~~~~~~~~~~~~~i~Wp~~~~~~~p~~~~~~~~~~~~~v~~~~~~~~~p~~~~~~~~~~~~~g~~~~~~~G~~~  492 (771)
                                             .  .        ....+++++|++...|||   .+.+++.+   ..+++.++.|||+
T Consensus       377 -----------------------~--~--------~~~~~~~l~v~~~~~~P~---~~~~~~~~---~~~~~~~~~G~~~  417 (823)
T 3kg2_A          377 -----------------------D--T--------SGLEQKTVVVTTILESPY---VMMKANHA---ALAGNERYEGYCV  417 (823)
T ss_dssp             -----------------------C--C--------SSCCCCCEEEEECCCTTT---SEECTTGG---GCCGGGGEESHHH
T ss_pred             -----------------------c--c--------cccCCCEEEEEEecCCCc---EEEecCcc---ccCCCCceEEEHH
Confidence                                   0  0        123578999999877665   45533211   0112448999999


Q ss_pred             HHHHHHHHHCCCcccEEEecC---------CCChHHHHHHHhcccccEEEeeEeeeccceeeeecccceeeccEEEEEec
Q 004136          493 ELFRLVVDHLNYDLPYEFVPH---------DGVYDDLINGVYDKTYDAAVGDLTILGNRTEYVEFTQPYAESGFSMIVPA  563 (771)
Q Consensus       493 ~l~~~~a~~l~f~~~~~~~~~---------~~~~~~~i~~l~~~~~D~~~~~~~~t~~r~~~~~fs~p~~~~~~~~~v~~  563 (771)
                      ||++++++++||+++++.+++         +|+|++++++|.+|++|++++++++|.+|.+.+|||.||+.+++++++|+
T Consensus       418 dl~~~~a~~l~~~~~~~~~~~~~~g~~~~~~g~~~~~~~~l~~~~~D~~~~~~~~t~~R~~~~dfs~py~~~~~~~~v~~  497 (823)
T 3kg2_A          418 DLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKK  497 (823)
T ss_dssp             HHHHHHHHHHTCCEEEEECSSCCCCCBCTTTCCBCHHHHHHHTTSCSEECSCCBCCHHHHTTEEECSCSEEECEEEEEEC
T ss_pred             HHHHHHHHHcCCcEEEEEccCCcccccCCCCCchhhHHHhhccccCcEEecceecchhheeeEEeccchhhCCEEEEEEC
Confidence            999999999999988887662         46799999999999999999999999999999999999999999999999


Q ss_pred             CCCC--CccccccCCCHHHHHHHHHHHHHHHHhhhhhccccCccCcC--------------cccchHHHHHHHHHHHhhc
Q 004136          564 KQEE--STWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEFRG--------------TLKDQISNILWFAFSTIFF  627 (771)
Q Consensus       564 ~~~~--~~~~~~~pF~~~vW~~i~~~~~~~~~~~~~~~~~~~~~~~~--------------~~~~~~~~~~~~~~~~~~~  627 (771)
                      +...  +++.|++||++.+|++++++++++++++|+++|.++.++..              ....++.+++|++++++++
T Consensus       498 ~~~~~~~~~~fl~Pf~~~vW~~i~~~~~~~~~~l~~~~~~~p~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~  577 (823)
T 3kg2_A          498 PQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQ  577 (823)
T ss_dssp             CCCCCCCGGGTTTTSCHHHHHHHHHHHHHHHTTGGGTC-----------------------CHHHHHHHHHHHTTTTSCC
T ss_pred             CCcccccchHhhcCCchhHHHHHHHHHHHHHHHHHHHHhcChhhccCcccccccccccccccccccHHHHHHHHHHHHHh
Confidence            8653  68899999999999999999999999999999976543321              1123578999999999999


Q ss_pred             cC-cccccchhhHHHHHHHHHHHHHHHHHhhcccccceeecccCCCCCChhHhhh-CCceEEEecChHHHHHHHHhcCCC
Q 004136          628 SH-RANIQSNLTRVVVVLWLFVVFILTSSYTASLSSLLTVRRLEPNVTDIQSLKS-GNLKVGCVDDSFVKKYLEEVLGFR  705 (771)
Q Consensus       628 ~~-~~~~~~~s~Rl~~~~~~~~~li~~~~Yta~L~s~lt~~~~~~~i~~~~dL~~-~~~~~g~~~~s~~~~~l~~~~~~~  705 (771)
                      |+ ...|++.++|+++++||||+||++++|||+|+|+||.+++.++|+|++||.+ .++++|+..++....++++. ...
T Consensus       578 ~g~~~~p~~~~~R~~~~~w~~~~lil~~~Yta~L~s~Lt~~~~~~~I~s~~dL~~~~~i~~~~~~~~~~~~~~~~~-~~~  656 (823)
T 3kg2_A          578 QGADISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRS-KIA  656 (823)
T ss_dssp             ------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCSSHHHHHCCSSEEECBSSSHHHHHHHHC-CCH
T ss_pred             cCCCcCCcchhhhhHHHHHHHHHHHHHHHHHHHHHHHhcccccCCCCCCHHHHhhCCCeeEEEEeCCcHHHHHHhc-cch
Confidence            98 4567999999999999999999999999999999999999999999999986 46889998877778888762 111


Q ss_pred             C-----------CCcccCCCCHHHHHHHHH-cCCceEEEecchhHHHHHHhc-CCceeEee-eeeeceEEEEEecCCCC
Q 004136          706 S-----------GNIVPFGNTEANYIQKFE-NNTIDSLFLERPYEKVFLDKY-CKKYTAIN-TYRFGGLGFVSNIIYSH  770 (771)
Q Consensus       706 ~-----------~~~~~~~~~~~~~~~~v~-~~~~~a~i~~~~~~~~~~~~~-c~~l~~~~-~~~~~~~g~~~~k~s~~  770 (771)
                      .           .....+.+ .+|++++++ +++.+|++.|.+.++|..+++ |+ +++++ .+...+||+++|||||+
T Consensus       657 ~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~A~~~~~~~~~y~~~~~~c~-l~~v~~~~~~~~~~~~~~k~spl  733 (823)
T 3kg2_A          657 VFDKMWTYMRSAEPSVFVRT-TAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCD-TMKVGGNLDSKGYGIATPKGSSL  733 (823)
T ss_dssp             HHHHHHHHHHHCSSCCCBSS-HHHHHHHHHTTTTSEEEEEEHHHHHHHHTSTTCC-EEEESCCSSCEEECCEEETTCSS
T ss_pred             HHHHHHHHHHhcCCccccCC-HHHHHHHHhccCCceEEEechHHHHHHHhcCCCc-eEEccccccccceeEeecCCChH
Confidence            0           01112346 999999997 566799999999999888776 98 89999 99999999999999986
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Back     alignment and structure
>4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Back     alignment and structure
>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Back     alignment and structure
>3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} Back     alignment and structure
>3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} SCOP: c.93.1.1 PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* Back     alignment and structure
>3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} SCOP: c.93.1.0 PDB: 2e4z_A* Back     alignment and structure
>3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Back     alignment and structure
>4f06_A Extracellular ligand-binding receptor; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: MSE PHB; 1.30A {Rhodopseudomonas palustris} PDB: 4evs_A* Back     alignment and structure
>3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} Back     alignment and structure
>3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} Back     alignment and structure
>4gnr_A ABC transporter substrate-binding protein-branche amino acid transport; amino acid-binding protein, surface-exposed protein; HET: MLY; 1.00A {Streptococcus pneumoniae} Back     alignment and structure
>3i09_A Periplasmic branched-chain amino acid-binding Pro; type I periplasmic binding protein, structural genomics, JOI for structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Back     alignment and structure
>3n0w_A ABC branched chain amino acid family transporter, periplasmic ligand binding protein...; receptor family ligand binding region; HET: MSE; 1.88A {Burkholderia xenovorans} Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Back     alignment and structure
>4eyg_A Twin-arginine translocation pathway signal; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: VNL; 1.86A {Rhodopseudomonas palustris} PDB: 4ey3_A* 3t0n_A* 4eyk_A* Back     alignment and structure
>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Back     alignment and structure
>3n0x_A Possible substrate binding protein of ABC transpo system; receptor family ligand binding region, structural genomics; HET: MSE; 1.50A {Rhodopseudomonas palustris} PDB: 3nnd_B Back     alignment and structure
>3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} Back     alignment and structure
>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Back     alignment and structure
>3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* Back     alignment and structure
>1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A Back     alignment and structure
>3ckm_A YRAM (HI1655), LPOA; periplasmic-binding protein, lipoprotein, unliganded, biosynthetic protein; 1.35A {Haemophilus influenzae} SCOP: c.93.1.1 Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Back     alignment and structure
>4h5g_A Amino acid ABC superfamily ATP binding cassette transporter, binding protein; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: ARG; 1.78A {Streptococcus pneumoniae} PDB: 4h5f_A* Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Back     alignment and structure
>4gvo_A LMO2349 protein; structural genomics, IDP05245, L-cystine, ABC transporter, periplasmic binding protein, niaid; HET: HIS; 1.45A {Listeria monocytogenes} PDB: 2o1m_A Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} SCOP: c.94.1.0 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} SCOP: c.94.1.0 Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} SCOP: c.94.1.0 Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} SCOP: c.94.1.0 Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} SCOP: c.94.1.0 Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} SCOP: c.94.1.0 Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Back     alignment and structure
>4i62_A Amino acid ABC transporter, periplasmic amino ACI protein, putative; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases (NIAI niaid; HET: ARG; 1.05A {Streptococcus pneumoniae} Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Back     alignment and structure
>2ozz_A Hypothetical protein YHFZ; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shigella flexneri 2A} SCOP: c.94.1.1 Back     alignment and structure
>3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} Back     alignment and structure
>2h3h_A Sugar ABC transporter, periplasmic sugar-binding protein; glucose binding protein, periplasmic binding protein, GBP; HET: BGC; 1.70A {Thermotoga maritima} PDB: 2qvc_A* 3c6q_B* Back     alignment and structure
>3n5l_A Binding protein component of ABC phosphonate TRAN; structural genomics, joint center for structural genomics; HET: UNL; 1.97A {Pseudomonas aeruginosa} Back     alignment and structure
>2rjo_A Twin-arginine translocation pathway signal protei; PSI-2, NYSGXRC, twin arginine translocation pathway signal P structural genomics; HET: GAL; 2.05A {Burkholderia phytofirmans} Back     alignment and structure
>3p7i_A PHND, subunit of alkylphosphonate ABC transporter; phosphonate binding protein, transport protein; 1.71A {Escherichia coli UTI89} PDB: 3qk6_A 3quj_A* 3s4u_A Back     alignment and structure
>3brs_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; 2.00A {Clostridium phytofermentans} Back     alignment and structure
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
>3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* Back     alignment and structure
>3o1i_D Periplasmic protein TORT; ligand free, two component sensor, periplasmic binding prote signaling protein; HET: PE4; 2.80A {Vibrio parahaemolyticus} PDB: 3o1h_B* 3o1j_C Back     alignment and structure
>2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* Back     alignment and structure
>3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} Back     alignment and structure
>1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A Back     alignment and structure
>1tjy_A Sugar transport protein; protein-ligand complex, signaling protein; HET: PAV; 1.30A {Salmonella typhimurium} SCOP: c.93.1.1 PDB: 1tm2_A 3t95_A* 3ejw_A* Back     alignment and structure
>2x7x_A Sensor protein; transferase, sensor histidine kinase; HET: FRU; 2.64A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rot_A ABC sugar transporter, periplasmic sugar binding; nysgrc, PSI-biology, structural genomics; 1.91A {Legionella pneumophila subsp} Back     alignment and structure
>3d02_A Putative LACI-type transcriptional regulator; periplasmic sugar-binding protein, structura genomics; HET: MSE GOL; 1.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>2qu7_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 2.30A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} Back     alignment and structure
>2iks_A DNA-binding transcriptional dual regulator; escherichia coli structural genomics, PSI-2, protein structure initiative; 1.85A {Escherichia coli} Back     alignment and structure
>3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK research center for structural genomics, nysgxrc; 1.99A {Actinobacillus succinogenes} Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,; HET: BGC; 0.92A {Escherichia coli} SCOP: c.93.1.1 PDB: 1glg_A* 2fw0_A* 2gbp_A* 2qw1_A* 2hph_A* 2ipn_A* 2ipm_A* 2ipl_A* 1gca_A* 1gcg_A 3ga5_A* 3gbp_A* Back     alignment and structure
>2fep_A Catabolite control protein A; CCPA, transcriptional regulator; HET: SEP; 2.45A {Bacillus subtilis} PDB: 2nzu_G* 1sxh_A 1sxi_A 1sxg_A* 2nzv_G* 2oen_G* Back     alignment and structure
>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* Back     alignment and structure
>3g1w_A Sugar ABC transporter; sugar-binding protein, bacillus halod target 11229F, transport protein, structural genomics; 2.02A {Bacillus halodurans c-125} Back     alignment and structure
>2ioy_A Periplasmic sugar-binding protein; ribose binding protein, thermophilic proteins; HET: RIP; 1.90A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structur genomics, protein structure initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>2vk2_A YTFQ, ABC transporter periplasmic-binding protein YTFQ; transport protein, galactofuranose; HET: GZL; 1.20A {Escherichia coli} Back     alignment and structure
>3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} Back     alignment and structure
>3lkv_A Uncharacterized conserved domain protein; ATPase binding cassette, PSI, MCSG, structural genomics, Pro structure initiative; HET: PHE; 2.20A {Vibrio cholerae} Back     alignment and structure
>8abp_A L-arabinose-binding protein; binding proteins; HET: GLA GAL; 1.49A {Escherichia coli} SCOP: c.93.1.1 PDB: 7abp_A* 6abp_A* 1abe_A* 1abf_A* 5abp_A* 1bap_A* 1apb_A* 9abp_A* 2wrz_A Back     alignment and structure
>1jx6_A LUXP protein; protein-ligand complex, signaling protein; HET: AI2; 1.50A {Vibrio harveyi} SCOP: c.93.1.1 PDB: 1zhh_A* 2hj9_A* Back     alignment and structure
>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} Back     alignment and structure
>3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} Back     alignment and structure
>3bbl_A Regulatory protein of LACI family; protein structure initiative II, PSI-II, NYSGXRC, transcript regulator, periplasmic binding protein; 2.35A {Chloroflexus aggregans} Back     alignment and structure
>3clk_A Transcription regulator; 11017J, PSI-II, NYSGXRC, dimer, structural genomics, protein structure initiative; 2.08A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3d8u_A PURR transcriptional regulator; APC91343.1, vibrio parahaem RIMD 2210633, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.88A {Vibrio parahaemolyticus} Back     alignment and structure
>3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} Back     alignment and structure
>3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>3uif_A Sulfonate ABC transporter, periplasmic sulfonate- protein SSUA; structural genomics; 2.60A {Methylobacillus flagellatus} Back     alignment and structure
>2h0a_A TTHA0807, transcriptional regulator; repressor, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>2rgy_A Transcriptional regulator, LACI family; 11011J, NYSGXRC, transctiptional regulator, SUG binding protein, structural genomics, PSI-2; 2.05A {Burkholderia phymatum} Back     alignment and structure
>3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, PR structure initiative; 2.14A {Rhodococcus jostii} Back     alignment and structure
>2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A 3oqo_A* 3oqm_A* 3oqn_A* Back     alignment and structure
>3ctp_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; HET: XLF; 1.41A {Alkaliphilus metalliredigens} Back     alignment and structure
>3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} Back     alignment and structure
>3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, STRU genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>1gud_A ALBP, D-allose-binding periplasmic protein; periplasmic binding protein, X-RAY crystallography, hinge bending, conformational change; 1.7A {Escherichia coli} SCOP: c.93.1.1 PDB: 1gub_A 1rpj_A* Back     alignment and structure
>1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ... Back     alignment and structure
>3tb6_A Arabinose metabolism transcriptional repressor; transcription regulation, arabinose binding, DNA binding Pro; HET: ARB; 2.21A {Bacillus subtilis} Back     alignment and structure
>3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} Back     alignment and structure
>3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>3qk7_A Transcriptional regulators; structural genomics, NEW YORK structural genomix research CO NYSGXRC, PSI-2, protein structur initiative; 2.70A {Yersinia pestis} Back     alignment and structure
>2dri_A D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli} SCOP: c.93.1.1 PDB: 1urp_A* 1ba2_A 1dbp_A* 1drj_A* 1drk_A* 2gx6_A* Back     alignment and structure
>1byk_A Protein (trehalose operon repressor); LACI family, phosphate binding, protein structure, trehalose repressor, gene regulation; HET: T6P; 2.50A {Escherichia coli} SCOP: c.93.1.1 Back     alignment and structure
>3e61_A Putative transcriptional repressor of ribose OPER; structural genomics, DNA-binding, transcripti regulation, PSI-2; 2.00A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} Back     alignment and structure
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>3uug_A Multiple sugar-binding periplasmic receptor CHVE; periplasmic binding protein, sugar-binding protein, sugar binding protein; HET: BDP; 1.75A {Agrobacterium tumefaciens} PDB: 3urm_A* Back     alignment and structure
>3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3g85_A Transcriptional regulator (LACI family); transcription regulator, PSI-II, structural genomics structure initiative; 1.84A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3hs3_A Ribose operon repressor; PSI-II, NYSGXRC, periplasmic binding protein, structural genomics, protein structure initiative; 1.60A {Lactobacillus acidophilus} Back     alignment and structure
>3cs3_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative; 2.40A {Enterococcus faecalis} Back     alignment and structure
>3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>2x26_A Periplasmic aliphatic sulphonates-binding protein; transport protein; 1.75A {Escherichia coli} Back     alignment and structure
>3ksx_A Nitrate transport protein; SSUA, alkanesulfonate-binding protein, periplasmic-binding P transport protein; HET: MPO; 1.70A {Xanthomonas axonopodis PV} PDB: 3e4r_A* 3ksj_A* Back     alignment and structure
>3qsl_A Putative exported protein; unknown, structural genomics, PSI-biology, midwest center FO structural genomics, MCSG, unknown function; HET: MSE CIT; 2.00A {Bordetella bronchiseptica} Back     alignment and structure
>4fe7_A Xylose operon regulatory protein; HTH_ARAC, helix-turn-helix, PBP, periplasmic binding protein binding transcription regulator, DNA xylose; HET: XYS; 2.90A {Escherichia coli} PDB: 4fe4_A Back     alignment and structure
>2fqx_A Membrane lipoprotein TMPC; ABC transport system, ligand-binding protein, guanosine, TP0319, transport protein; HET: GMP; 1.70A {Treponema pallidum} PDB: 2fqw_A* 2fqy_A* Back     alignment and structure
>3ix1_A N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine protein; periplasmic N-formyl-4-amino-5-aminomethyl-2-methylpyrimidin protein; HET: NFM; 2.40A {Bacillus halodurans c-125} Back     alignment and structure
>3miz_A Putative transcriptional regulator protein, LACI family; LACL family, protein structure initiative II (PSI II), NYSGXRC, structural genomics; 1.91A {Rhizobium etli} Back     alignment and structure
>2hqb_A Transcriptional activator of COMK gene; berkeley structure genomics center target 1957B, structural genomics, PSI; 2.70A {Bacillus halodurans} Back     alignment and structure
>1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ... Back     alignment and structure
>3un6_A Hypothetical protein saouhsc_00137; structural genomics, center for structural genomics of infec diseases, csgid; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3s99_A Basic membrane lipoprotein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, adenine; HET: ADE; 2.05A {Brucella melitensis biovar abortus} Back     alignment and structure
>3qi7_A Putative transcriptional regulator; periplasmic binding protein-like, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.86A {Clostridium difficile} Back     alignment and structure
>2f5x_A BUGD; periplasmic binding protein, transport protein; 1.72A {Bordetella pertussis tohama I} Back     alignment and structure
>2qpq_A Protein BUG27; alpha/beta domain, venus flytrap, transport protein; HET: CIT; 1.92A {Bordetella pertussis} Back     alignment and structure
>3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum} Back     alignment and structure
>4ddd_A Immunogenic protein; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, immune system; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Back     alignment and structure
>2dvz_A BUGE, putative exported protein; periplamsic binding proteins, carboxylate binding, glutamate, transport protein; HET: GLU; 2.30A {Bordetella pertussis} Back     alignment and structure
>2x7q_A Ca3427, possible thiamine biosynthesis enzyme; unknown function; 2.00A {Candida albicans} PDB: 2x7p_A Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Back     alignment and structure
>4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A Back     alignment and structure
>2g29_A Nitrate transport protein NRTA; solute-binding protein, alpha-beta protein; 1.50A {Synechocystis SP} Back     alignment and structure
>2zzv_A ABC transporter, solute-binding protein; periplasmic substrate binding protein, calcium, lactate, trap transporter, transport protein; 1.40A {Thermus thermophilus} PDB: 2zzw_A 2zzx_A Back     alignment and structure
>1us5_A Putative GLUR0 ligand binding core; receptor, membrane protein, glutamate receptor, L-glutamate; HET: GLU; 1.5A {Thermus thermophilus} SCOP: c.94.1.1 PDB: 1us4_A* Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Back     alignment and structure
>3ixl_A Amdase, arylmalonate decarboxylase; enantioselective decarboxylation, lyase; HET: CME PAC; 1.45A {Bordetella bronchiseptica} PDB: 3ixm_A 2vlb_A 3dg9_A 3ip8_A* 3dtv_A* 3eis_A* Back     alignment and structure
>2i49_A Bicarbonate transporter; alpha-beta protein, C-clamp, ABC transporter, periplasmic SO binding protein, bicarbonate-binding protein; 1.35A {Synechocystis SP} PDB: 2i48_A 2i4b_A 2i4c_A Back     alignment and structure
>3jv9_A OXYR, transcriptional regulator, LYSR family; LYSR-type transcriptional regulator, LTTR, redox, structural genomics, OPPF; 2.39A {Neisseria meningitidis} Back     alignment and structure
>2pfy_A Putative exported protein; extracytoplasmic solute receptor, tripartite ATP independent periplasmic transport, pyroglutamic acid; 1.95A {Bordetella pertussis tohama I} Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Back     alignment and structure
>2hzl_A Trap-T family sorbitol/mannitol transporter, periplasmic binding protein, SMOM; trap transporter, periplasmic subunit, ligand binding; 1.40A {Rhodobacter sphaeroides 2} PDB: 2hzk_A Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>4esw_A Pyrimidine biosynthesis enzyme THI13; thiamin pyrimidine biosynthesis, transferase; HET: CIT; 1.60A {Candida albicans} PDB: 4esx_A* Back     alignment and structure
>2pfz_A Putative exported protein; extracytoplasmic solute receptor, tripartite ATP independent periplasmic transport, pyroglutamic acid; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Back     alignment and structure
>1zbm_A Hypothetical protein AF1704; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.30A {Archaeoglobus fulgidus} SCOP: c.94.1.1 Back     alignment and structure
>4ab5_A Transcriptional regulator, LYSR family; transcription factors; 2.51A {Neisseria meningitidis serogroup B} PDB: 4ab6_A Back     alignment and structure
>3ho7_A OXYR; beta-alpha-barrels, DNA-binding, transcription, transcriptio regulation; 1.58A {Porphyromonas gingivalis} Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Back     alignment and structure
>1atg_A MODA, periplasmic molybdate-binding protein; tungstate, ABC transporter; 1.20A {Azotobacter vinelandii} SCOP: c.94.1.1 Back     alignment and structure
>1sw5_A Osmoprotection protein (PROX); binding-protein, compatible solutes, cation-PI interactions, classical hydrogen bonds, protein binding; 1.80A {Archaeoglobus fulgidus} SCOP: c.94.1.1 PDB: 1sw4_A 1sw1_A 1sw2_A 3mam_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3r26_A Molybdate-binding periplasmic protein; protein binding; 1.70A {Escherichia coli} SCOP: c.94.1.1 PDB: 3axf_A 1amf_A 1wod_A Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>3oxn_A Putative transcriptional regulator, LYSR family; structural genomics, PSI-2, protein structure initiative; 2.70A {Vibrio parahaemolyticus} Back     alignment and structure
>3s99_A Basic membrane lipoprotein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, adenine; HET: ADE; 2.05A {Brucella melitensis biovar abortus} Back     alignment and structure
>2hpg_A ABC transporter, periplasmic substrate-binding protein; periplasmic binding protein, thermophilic proteins, trap- transport; HET: MSE; 1.90A {Thermotoga maritima} Back     alignment and structure
>2fqx_A Membrane lipoprotein TMPC; ABC transport system, ligand-binding protein, guanosine, TP0319, transport protein; HET: GMP; 1.70A {Treponema pallidum} PDB: 2fqw_A* 2fqy_A* Back     alignment and structure
>2de3_A Dibenzothiophene desulfurization enzyme B; alpha-beta, hydrolase; HET: OBP; 1.60A {Rhodococcus SP} PDB: 2de4_A* 2de2_A Back     alignment and structure
>3gzg_A Molybdate-binding periplasmic protein; permease; molybdate complex, mutant K127S, metal binding protein; 1.55A {Xanthomonas axonopodis PV} PDB: 2h5y_A Back     alignment and structure
>3l6g_A Betaine ABC transporter permease and substrate BI protein; glycine betaine binding, substrate binding domain, venus FLY cell membrane; HET: B3P; 1.90A {Lactococcus lactis} PDB: 3l6h_A Back     alignment and structure
>2y7p_A LYSR-type regulatory protein; transcription regulator, DNA-binding, transcription, transcr factor, transcription regulation; HET: SAL PEU; 1.85A {Burkholderia SP} PDB: 2y7k_A* 2y84_A 2y7w_A 2y7r_A Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>2rin_A Putative glycine betaine-binding ABC transporter protein; type II binding protein, aromatic BOX, acetylcholine, protein binding; HET: ACH; 1.80A {Rhizobium meliloti} PDB: 2rej_A 2rf1_A 2reg_A* 3hcq_A Back     alignment and structure
>3tmg_A Glycine betaine, L-proline ABC transporter, glycine/betaine/L-proline-binding protein...; ssgcid, structural genomics; 1.90A {Borrelia burgdorferi} Back     alignment and structure
>2esn_A Probable transcriptional regulator; PA0477, APC5828,transcription, PSI, protein struc initiative, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.37 c.94.1.1 Back     alignment and structure
>2xwv_A Sialic acid-binding periplasmic protein SIAP; transport protein, trap, sugar transport; HET: SLB; 1.05A {Haemophilus influenzae} PDB: 2xxk_A* 2xa5_A* 2wyp_A* 2wx9_A* 2xwo_A* 2xwk_A* 2v4c_A* 2wyk_A* 2xwi_A* 3b50_A* 2cey_A 2cex_A Back     alignment and structure
>2hqb_A Transcriptional activator of COMK gene; berkeley structure genomics center target 1957B, structural genomics, PSI; 2.70A {Bacillus halodurans} Back     alignment and structure
>3k6v_A Solute-binding protein MA_0280; MODA, molybdate, periplasmic BIN protein, ABC transporter, transport protein, ligand, metal- protein; HET: CIT; 1.69A {Methanosarcina acetivorans} PDB: 3k6u_A* 3k6w_A 3k6x_A Back     alignment and structure
>1r9l_A Glycine betaine-binding periplasmic protein; periplasmic binding protein, cation-PI interactions, tryptophan BOX, protein binding; 1.59A {Escherichia coli} SCOP: c.94.1.1 PDB: 1r9q_A* Back     alignment and structure
>2xxp_A CPS2A; replication, peptidoglycan, LCP, LYTR; HET: DSL PEG; 1.69A {Streptococcus pneumoniae} PDB: 3tep_A* 3tfl_A* 2xxq_A* 3tel_A* 4de8_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 771
d1jdpa_401 c.93.1.1 (A:) Hormone binding domain of the atrial 4e-32
d1dp4a_425 c.93.1.1 (A:) Hormone binding domain of the atrial 4e-31
d1ewka_477 c.93.1.1 (A:) Metabotropic glutamate receptor subt 5e-18
d1qo0a_373 c.93.1.1 (A:) Amide receptor/negative regulator of 1e-16
d1usga_346 c.93.1.1 (A:) Leucine-binding protein {Escherichia 1e-14
d3ckma1317 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemo 7e-12
d1mqia_260 c.94.1.1 (A:) Glutamate receptor ligand binding co 2e-11
d2a5sa1277 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate 7e-11
d1pb7a_289 c.94.1.1 (A:) N-methyl-D-aspartate receptor subuni 3e-08
d1wdna_223 c.94.1.1 (A:) Glutamine-binding protein {Escherich 8e-06
d2f34a1246 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor li 7e-05
d1ii5a_226 c.94.1.1 (A:) Glutamate receptor ligand binding co 0.002
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 401 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like I
superfamily: Periplasmic binding protein-like I
family: L-arabinose binding protein-like
domain: Hormone binding domain of the atrial natriuretic peptide receptor
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  127 bits (318), Expect = 4e-32
 Identities = 53/397 (13%), Positives = 134/397 (33%), Gaps = 36/397 (9%)

Query: 36  KIGAIVDANSQM---GKQAITAMKIAVQNFNSDSR-------NHKLSLQIRDHNRDPFQA 85
           ++  ++  +        +   A++ A+++   +           +  +   D +      
Sbjct: 9   EVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRAL 68

Query: 86  ATAAQELI--NKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPY 143
            +    +      K  +I G       A VA +AS   +P+LS  A A         + +
Sbjct: 69  FSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEYSH 128

Query: 144 LIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQS 203
           L R+A   ++  + +  L R ++W R A +Y D+    +        E +  V   E   
Sbjct: 129 LTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERN---CYFTLEGVHEVFQEEGLH 185

Query: 204 RLVLPPISSISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSV 263
             +     +     E +         + S   +++ AS D    +   A+R G+   D  
Sbjct: 186 TSIYSFDETKDLDLEDI-----VRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYA 240

Query: 264 WI---------VTNTVANALDSLNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFT 314
           +            +      D  +     +      + +        +++FS   + +  
Sbjct: 241 FFNIELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTV-TLLRTVKPEFEKFSMEVKSSVE 299

Query: 315 SEYPEEDHFHPSIHALRAHDSIKIITEAIGRL---NYNISSPEMLLRQMLSSDFSGLSGK 371
            +       + ++     HD+I +   A+  +    Y+      +++Q  +  F G++G+
Sbjct: 300 -KQGLNMEDYVNMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQ 358

Query: 372 IRF-KDGE-LLNADTLRIVNVVGKKYKELDFWLPNFG 406
           +    +G+   +   + + +V     + +  +    G
Sbjct: 359 VSIDANGDRYGDFSVIAMTDVEAGTQEVIGDYFGKEG 395
>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 425 Back     information, alignment and structure
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 477 Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Length = 373 Back     information, alignment and structure
>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d3ckma1 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 317 Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Length = 260 Back     information, alignment and structure
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Length = 277 Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 289 Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Length = 223 Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Length = 246 Back     information, alignment and structure
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Length = 226 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query771
d1dp4a_425 Hormone binding domain of the atrial natriuretic p 100.0
d1ewka_477 Metabotropic glutamate receptor subtype 1 {Rat (Ra 100.0
d1jdpa_401 Hormone binding domain of the atrial natriuretic p 100.0
d1usga_346 Leucine-binding protein {Escherichia coli [TaxId: 100.0
d1qo0a_373 Amide receptor/negative regulator of the amidase o 100.0
d3ckma1317 YraM C-terminal domain {Haemophilus influenzae [Ta 99.95
d2a5sa1277 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.9
d1pb7a_289 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.86
d1wdna_223 Glutamine-binding protein {Escherichia coli [TaxId 99.84
d1xt8a1248 Putative amino-acid transporter CjaA {Campylobacte 99.83
d1ii5a_226 Glutamate receptor ligand binding core {Synechocys 99.81
d1mqia_260 Glutamate receptor ligand binding core {Rat (Rattu 99.78
d1lsta_238 Lysine-,arginine-,ornithine-binding (LAO) protein 99.72
d2f34a1246 Glutamate receptor ligand binding core {Rat (Rattu 99.66
d1jx6a_338 Quorum-sensing signal (autoinducer-2) binding prot 98.24
d2fvya1305 Galactose/glucose-binding protein {Escherichia col 98.11
d1jyea_271 Lac-repressor (lacR) core (C-terminal domain) {Esc 98.07
d2ozza1228 Hypothetical protein YhfZ {Shigella flexneri [TaxI 98.02
d8abpa_305 L-arabinose-binding protein {Escherichia coli [Tax 97.79
d1guda_288 D-allose-binding protein {Escherichia coli [TaxId: 97.7
d2dria_271 D-ribose-binding protein {Escherichia coli, strain 97.7
d1byka_255 Trehalose repressor, C-terminal domain {Escherichi 97.59
d1dbqa_282 Purine repressor (PurR), C-terminal domain {Escher 97.55
d2nzug1275 Glucose-resistance amylase regulator CcpA, C-termi 97.38
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 96.78
d1tjya_316 AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370 96.36
d1us5a_298 Putative GluR0 ligand binding core {Thermus thermo 95.61
d1xl4a2116 Inward rectifier potassium channel kirbac3.1 {Magn 94.91
d1p7ba2116 Inward rectifier potassium channel Kirbac1.1 {Burk 92.35
d1al3a_237 Cofactor-binding fragment of LysR-type protein Cys 86.24
d2fyia1220 LysR-type regulatory protein Cbl {Escherichia coli 85.6
d2esna2212 Probable LysR-type transcriptional regulator PA047 83.96
>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like I
superfamily: Periplasmic binding protein-like I
family: L-arabinose binding protein-like
domain: Hormone binding domain of the atrial natriuretic peptide receptor
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=6.8e-44  Score=389.74  Aligned_cols=378  Identities=15%  Similarity=0.192  Sum_probs=308.1

Q ss_pred             cEEEEEEEeCCCc----CchHHHHHHHHHHHHHhcCC---CCcEEEEEEecCCC-----CHHHHHHHHHHHHhcCCeEEE
Q 004136           34 VTKIGAIVDANSQ----MGKQAITAMKIAVQNFNSDS---RNHKLSLQIRDHNR-----DPFQAATAAQELINKEKVKVI  101 (771)
Q Consensus        34 ~I~IG~i~p~s~~----~g~~~~~a~~~Av~~iN~~~---~g~~i~l~~~D~~~-----~~~~a~~~~~~li~~~~v~av  101 (771)
                      .|+||+++|+++.    .|.+...|+++|+++||+++   +|++|+++++|+++     ++..++..+.+++.+++|.+|
T Consensus         2 ~i~vg~~lPltg~~~~~~~~~~~~A~~lAv~~IN~~~~~l~g~~l~~~~~D~~~~~~~~~~~~~~~~a~~~~~~~~V~ai   81 (425)
T d1dp4a_           2 DLTVAVVLPLTNTSYPWSWARVGPAVELALARVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVF   81 (425)
T ss_dssp             EEEEEEEECSSCCCSTTCHHHHHHHHHHHHHHHHTCTTSSTTCEEEEEEEECBCTTSSBCTTHHHHHHHHHHHHHCCSEE
T ss_pred             cEEEEEEECCCCcccccchhhHHHHHHHHHHHHHhCCCCCCCcEEEEEEEECCCcccccCHHHHHHHHHHHHhcCCCeEE
Confidence            5999999999942    36778889999999999988   59999999999974     788999999999989999999


Q ss_pred             EcCCchHhHHHHHHhhccCCccEEeecCCCCCCCccC-CCCceEEEeecCcHHHHHHHHHHHHHcCCeEEEEEEEeCCCC
Q 004136          102 AGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMS-RRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYG  180 (771)
Q Consensus       102 iGp~~s~~~~~v~~~~~~~~iP~Is~~a~~~~~~l~~-~~~p~~fr~~p~~~~~~~a~~~~l~~~~w~~v~ii~~~~~~g  180 (771)
                      |||.||..+.+++++++.+++|+|+++++  ++.+++ ..+|++||+.|++..++.++++++++++|+++++++.++.||
T Consensus        82 iG~~~S~~~~~v~~~~~~~~ip~is~~st--~~~ls~~~~~~~~~r~~p~~~~~~~~~~~~l~~~~~~~vaii~~~d~~g  159 (425)
T d1dp4a_          82 LGPGCVYSAAPVGRFTAHWRVPLLTAGAP--ALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLG  159 (425)
T ss_dssp             ECCCSHHHHHHHHHHHHHHTCCEEESCCC--CGGGGCTTTSTTEEECSCCHHHHHHHHHHHHHHHTCCSEEEEEEECCSS
T ss_pred             ECCCChHHhhhhhhhhHhhCCeEEeeecc--cccccccccCCccccccccchHHHHHHHHHHHhccCceEEEEEeccccc
Confidence            99999999999999999999999999999  899987 788999999999999999999999999999999999999998


Q ss_pred             CCcch------HHHHHHHHhccCCeEEEEeeecCCCCCCCCchHHHHHHHHHhhhCCceEEEEEecChhHHHHHHHHHHH
Q 004136          181 GDSGK------LALLAEALQNVSSSEIQSRLVLPPISSISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANR  254 (771)
Q Consensus       181 ~~~~~------~~~l~~~~~~~g~~~i~~~~~~~~~~~~~d~~~~~~~~l~~l~~~~~~vIv~~~~~~~~~~~il~~a~~  254 (771)
                        ...      ...+++...+.+ +++......+...      +++...++.+++ .+++|++ .+.++++..++++|++
T Consensus       160 --~~~~~~~~~~~~~~~~~~~~~-~~v~~~~~~~~~~------~~~~~~~~~~~~-~~~~vi~-~~~~~~~~~~~~~a~~  228 (425)
T d1dp4a_         160 --DDRPCFFIVEGLYMRVRERLN-ITVNHQEFVEGDP------DHYPKLLRAVRR-KGRVIYI-CSSPDAFRNLMLLALN  228 (425)
T ss_dssp             --SCCHHHHHHHHHHHHHHHHHC-CEEEEEEECTTCG------GGHHHHHHHHHH-HCSEEEE-ESCHHHHHHHHHHHHH
T ss_pred             --cchhhHHHHHHHHHHHHHhcc-eEEeeeeecCCch------hHHHHHHHHhhh-cceeEEE-ecchhHHHHHHHHHHH
Confidence              643      233444455666 7777666555544      456666666554 5788888 8999999999999999


Q ss_pred             cCCCCCCeEEEeeCccccccccc---------------ChhhhhccccEEEEEeeccCCChhHHHHHHHHHHhcccCCCC
Q 004136          255 MGLVGKDSVWIVTNTVANALDSL---------------NTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPE  319 (771)
Q Consensus       255 ~g~~~~~~~~i~~~~~~~~~~~~---------------~~~~~~~~~g~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~  319 (771)
                      +|+.++.|+||..+.+.......               ........++++.+.+..+.. +.+++|.+++++.+...+..
T Consensus       229 ~g~~~~~~v~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~  307 (425)
T d1dp4a_         229 AGLTGEDYVFFHLDVFGQSLKSAQGLVPQKPWERGDGQDRSARQAFQAAKIITYKEPDN-PEYLEFLKQLKLLADKKFNF  307 (425)
T ss_dssp             TTCCTTTCEEEEECTTCTTSCSSCTTSCBCTTCCSSSCHHHHHHHGGGEEEEEECCCCS-HHHHHHHHHHHHHHHHHHCC
T ss_pred             hCCCCCceEEEEecccccccccccccccccceeeccchhhHHHHHHhheeeeccCCCCC-hHHHHHHHHHHHHhhccCCC
Confidence            99999999999987654322110               112335677888888777666 88999988887665443321


Q ss_pred             -CCCCCCchhhhhHhHHHHHHHHHHHhhccC---CCChHHHHHHHHcCceeceeeeEEEeCCCCCCCCeEEEEEee--CC
Q 004136          320 -EDHFHPSIHALRAHDSIKIITEAIGRLNYN---ISSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRIVNVV--GK  393 (771)
Q Consensus       320 -~~~~~~~~~a~~~YDav~~~a~Al~~~~~~---~~~~~~l~~~l~~~~f~G~tG~v~Fd~~g~~~~~~~~I~~~~--~~  393 (771)
                       ..+..++.+++++|||++++++|++++..+   ..++..+.++|++++|+|++|+|+||++|+|. +.|.|++++  ++
T Consensus       308 ~~~~~~~~~~~~~~yDav~~~a~Al~~~~~~~~~~~~~~~l~~~l~~~~f~G~tG~v~fd~nGdr~-~~y~i~~~~~~~~  386 (425)
T d1dp4a_         308 TVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRD-TDFSLWDMDPETG  386 (425)
T ss_dssp             CCCCSGGGHHHHHHHHHHHHHHHHHHHHHHTTCCTTCHHHHHHTTTTEEEEETTEEEEECTTSBBC-CCEEEEEECTTTC
T ss_pred             CccccccchHHHHHHHHHHHHHHHHHHHHhcCCCCCCHHHHHHHHhCCeEecCCeeEEECCCCCcc-cceEEEEEECCCC
Confidence             124567889999999999999999988543   46789999999999999999999999999996 899999986  58


Q ss_pred             ceEEEEEecCCCCCccccCCCccccccCccccCCCCcceecCCCCCCCCCCc
Q 004136          394 KYKELDFWLPNFGFSKTSSKHNVGDISSNIAAEGFTGPVIWPGNLINRNPKG  445 (771)
Q Consensus       394 ~~~~vg~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~Wp~~~~~~~p~~  445 (771)
                      .++.||.|++.++....+.                .++|+||+|   .+|++
T Consensus       387 ~~~~vg~~~~~~~~~~~~~----------------~~~i~W~~~---~~P~d  419 (425)
T d1dp4a_         387 AFRVVLNYNGTSQELMAVS----------------EHKLYWPLG---YPPPD  419 (425)
T ss_dssp             CEEEEEEECTTTCCEEEST----------------TCCCCCTTS---SCCCS
T ss_pred             eEEEEEEEECCCCeEEecC----------------CceeECCCC---CCCCC
Confidence            8999999998653221111                167999999   67765
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3ckma1 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Back     information, alignment and structure
>d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Back     information, alignment and structure
>d1jx6a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2fvya1 c.93.1.1 (A:2-306) Galactose/glucose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d8abpa_ c.93.1.1 (A:) L-arabinose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dria_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]} Back     information, alignment and structure
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1us5a_ c.94.1.1 (A:) Putative GluR0 ligand binding core {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1al3a_ c.94.1.1 (A:) Cofactor-binding fragment of LysR-type protein CysB {Klebsiella aerogenes [TaxId: 28451]} Back     information, alignment and structure
>d2fyia1 c.94.1.1 (A:88-307) LysR-type regulatory protein Cbl {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure