Citrus Sinensis ID: 004228

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------

MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGNKVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSERSLKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTSGSSWGISSIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPTGLPKIHGLPTSSMYTTSSGSNDSYTASPKNPKSRKSSHSGELQSHLFSNADSNGSGRMYMPGLYPTVDH

ccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccEEEEcccccccHHHHHHHHccccccccccccccccccEEEEEcccccccEEEEcccccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHccccccccccEEEccccccccccHHHHHHcccccccccEEEEEcccHHHHHHHHcHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcHHcHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

ccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccHcHHHHHHHcccccccccccEccccEEEEEEccccHHHHHHHHcccccEEcccccccHHHHHHHHHHHHHHccccccHHcccHHHHHHHHHccccccccEEEEEEEccHcccccHHHHHcccEEEEEccEEEEEEccHHHHcccccHHHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccccEccHHccccHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHcHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

madepatnttaaqsqpsavplggsvipLVNKLQDIFAQLgsqstielpqvavvgsqssgkssVLEALvgrdflprgndictrrPLVLQLLQTKTDEeygeflhlpgkrfydfsEIRREIQAQTdkeaggnkvtpansdlansdalqiagiadpdgyrtigiitkldimdrgTDARNLLLGKviplrlgyvgvvnrsqedimfNRSIKDALVAEEKFfrsrpvyngladrcgvPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHasygeiteskagQGALLLNILSKYSEAFSSMVegkneemstselsggaRIHYIFQSIFVksleevdpcedltddDIRTAIQnatgpksalfvpdvpfEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFlreglepsetMIGHIIEMEMDyintshpnfigGSKAVEIALQQIksskvplpitrhkdgvepdkapssersLKSRAILARQVNgimadqgvrptvevekvapagntsgsswgissifggsdnrvpagkesvtnkpfsepvqnVEHAFAMIhlrepptilrpseshseqENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTldelpleadsvergynmsadptglpkihglptssmyttssgsndsytaspknpksrksshsgelqshlfsnadsngsgrmympglyptvdh

madepatnttaaqsqpsavpLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFlprgndictrrPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQaqtdkeaggnkVTPANSDLANSDALQIagiadpdgyrTIGIITKLDIMDRGTDARNLLLGkviplrlgyvgvvnrsqedimFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASygeiteskagqGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQnatgpksalfvpDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGnflreglepsETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKsskvplpitrhkdgvepdkapsserslksRAILARQVNGIMADQGVRPTVEVEKVapagntsgsswgisSIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQafrtldelpleadsVERGYNMSADPTGLPKIHGLPTSSMYTTSSGSNDSYTASPKNPKSRKSSHSGELQSHLfsnadsngsgrmYMPGLYPTVDH

MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGNKVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSERSLKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTsgsswgissifggsDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPTGLPKIHGLPTSSMYTTSSGSNDSYTASPKNPKSRKSSHSGELQSHLFSNADSNGSGRMYMPGLYPTVDH

*********************GGSVIPLVNKLQDIFAQLGSQSTIELPQVAVV*********VLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIR***************************ALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYS*********************GARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQI*************************************VNGIM**********************************************************HAFAMIHL******************VEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEM******************RVLQQAFRT*******************************************************************************************

***********************SVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGNKVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQE**********ALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHA*************ALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGS******************************************************************************************************************************************IAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLEA***********************************************************************************

****************SAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVV*********VLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGNKVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSM*************SGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKD*************LKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTSGSSWGISSIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRP********NVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPTGLPKIHGLPTSSMY****************************QSHLFSNADSNGSGRMYMPGLYPTVDH

*******************PLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGNKVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIK****************************************************************************************************AFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPTGL*******************************************************************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		767	2.2.26 [Sep-21-2011]
Q8S944		808	Dynamin-related protein 3	yes	no	0.726	0.689	0.778	0.0
Q8LFT2		780	Dynamin-related protein 3	no	no	0.874	0.860	0.621	0.0
P54861		757	Dynamin-related protein D	yes	no	0.668	0.677	0.371	1e-104
Q09748		781	Dynamin-like protein C12C	yes	no	0.705	0.692	0.349	1e-99
Q9URZ5		678	Vacuolar protein sorting-	no	no	0.624	0.706	0.356	9e-98
Q2KIA5		749	Dynamin-1-like protein OS	yes	no	0.694	0.711	0.374	1e-97
O35303		755	Dynamin-1-like protein OS	yes	no	0.696	0.707	0.380	4e-97
O00429		736	Dynamin-1-like protein OS	yes	no	0.694	0.724	0.376	7e-97
Q8K1M6		742	Dynamin-1-like protein OS	yes	no	0.688	0.711	0.376	4e-96
Q7SXN5		691	Dynamin-1-like protein OS	yes	no	0.649	0.720	0.368	2e-94

>sp\|Q8S944\|DRP3A_ARATH Dynamin-related protein 3A OS=Arabidopsis thaliana GN=DRP3A PE=1 SV=2	Back alignment and function desciption

 Score =  920 bits (2377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/559 (77%), Positives = 498/559 (89%), Gaps = 2/559 (0%)

Query: 132 VTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVG 191
           VTPAN+DLANSDALQIA I DPDG+RTIG+ITKLDIMD+GTDAR LLLG V+PLRLGYVG
Sbjct: 210 VTPANTDLANSDALQIASIVDPDGHRTIGVITKLDIMDKGTDARKLLLGNVVPLRLGYVG 269

Query: 192 VVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAIL 251
           VVNR QEDI+ NR++K+AL+AEEKFFRS PVY+GLADR GVPQLAKKLNQILVQHIK +L
Sbjct: 270 VVNRCQEDILLNRTVKEALLAEEKFFRSHPVYHGLADRLGVPQLAKKLNQILVQHIKVLL 329

Query: 252 PGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTS 311
           P LKSRIS+ALV+ AKEH SYGE+TES+AGQGALLLN LSKY EA+SS++EGK+EEMSTS
Sbjct: 330 PDLKSRISNALVATAKEHQSYGELTESRAGQGALLLNFLSKYCEAYSSLLEGKSEEMSTS 389

Query: 312 ELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIR 371
           ELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGP+SALFVPDVPFEVL+R
Sbjct: 390 ELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPRSALFVPDVPFEVLVR 449

Query: 372 RQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSET 431
           RQI+RLLDPSLQCARFI++EL+KISH C++NELQRFPVLRKRMDEVIG+FLREGLEPSE 
Sbjct: 450 RQISRLLDPSLQCARFIFEELIKISHRCMMNELQRFPVLRKRMDEVIGDFLREGLEPSEA 509

Query: 432 MIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSER 491
           MIG II+MEMDYINTSHPNFIGG+KAVE A+ Q+KSS++P P+ R KD VEPD+  SS  
Sbjct: 510 MIGDIIDMEMDYINTSHPNFIGGTKAVEAAMHQVKSSRIPHPVARPKDTVEPDRTSSSTS 569

Query: 492 SLKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTSGSSWGISSIFGGSDNRVPAGKES 551
            +KSR+ L RQ NGI+ DQGV  + + EK  PA N S + WGI SIF G D R    K+S
Sbjct: 570 QVKSRSFLGRQANGIVTDQGV-VSADAEKAQPAANASDTRWGIPSIFRGGDTRA-VTKDS 627

Query: 552 VTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKN 611
           + NKPFSE V+++ H  +MI+L+EPP +LRP+E+HSEQE VEI +TKLLLRSYYDIVRKN
Sbjct: 628 LLNKPFSEAVEDMSHNLSMIYLKEPPAVLRPTETHSEQEAVEIQITKLLLRSYYDIVRKN 687

Query: 612 IEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQ 671
           IEDS+PKA+MHFLVNHTKRELHNVFIKKLYRENLFEEMLQEP+E+A+KRKRT++TL VLQ
Sbjct: 688 IEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRKRTQETLHVLQ 747

Query: 672 QAFRTLDELPLEADSVERG 690
           QA+RTLDELPLEADSV  G
Sbjct: 748 QAYRTLDELPLEADSVSAG 766

Involved in the control of mitochondrial division and morphology.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q8LFT2\|DRP3B_ARATH Dynamin-related protein 3B OS=Arabidopsis thaliana GN=DRP3B PE=1 SV=2	Back alignment and function description

>sp\|P54861\|DNM1_YEAST Dynamin-related protein DNM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNM1 PE=1 SV=1	Back alignment and function description

>sp\|Q09748\|YB68_SCHPO Dynamin-like protein C12C2.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.08 PE=3 SV=1	Back alignment and function description

>sp\|Q9URZ5\|VPS1_SCHPO Vacuolar protein sorting-associated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps1 PE=3 SV=2	Back alignment and function description

>sp\|Q2KIA5\|DNM1L_BOVIN Dynamin-1-like protein OS=Bos taurus GN=DNM1L PE=2 SV=1	Back alignment and function description

>sp\|O35303\|DNM1L_RAT Dynamin-1-like protein OS=Rattus norvegicus GN=Dnm1l PE=1 SV=1	Back alignment and function description

>sp\|O00429\|DNM1L_HUMAN Dynamin-1-like protein OS=Homo sapiens GN=DNM1L PE=1 SV=2	Back alignment and function description

>sp\|Q8K1M6\|DNM1L_MOUSE Dynamin-1-like protein OS=Mus musculus GN=Dnm1l PE=1 SV=2	Back alignment and function description

>sp\|Q7SXN5\|DNM1L_DANRE Dynamin-1-like protein OS=Danio rerio GN=dnm1l PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		767
359494701		831	PREDICTED: dynamin-related protein 3A-li	0.996	0.919	0.758	0.0
296088789		923	unnamed protein product [Vitis vinifera]	0.989	0.822	0.735	0.0
357445997		824	Dynamin-related protein 3A [Medicago tru	0.966	0.899	0.709	0.0
357445995		852	Dynamin-related protein 3A [Medicago tru	0.966	0.869	0.685	0.0
356519473		1174	PREDICTED: dynamin-related protein 3A-li	0.968	0.632	0.701	0.0
255584037		837	dynamin, putative [Ricinus communis] gi\|	0.825	0.756	0.870	0.0
224093258		835	predicted protein [Populus trichocarpa]	0.822	0.755	0.842	0.0
224132938		821	predicted protein [Populus trichocarpa]	0.804	0.751	0.828	0.0
449479057		817	PREDICTED: dynamin-related protein 3A-li	0.977	0.917	0.693	0.0
147835423		909	hypothetical protein VITISV_007523 [Viti	0.807	0.680	0.768	0.0

>gi\|359494701\|ref\|XP_002269774.2\| PREDICTED: dynamin-related protein 3A-like [Vitis vinifera]	Back alignment and taxonomy information

 Score = 1230 bits (3182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/832 (75%), Positives = 696/832 (83%), Gaps = 68/832 (8%)

Query: 1   MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK 60
           MA+E A ++    S  SA PLG SVIP+VNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK
Sbjct: 1   MAEE-AVSSNPTHSSSSAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK 59

Query: 61  SSVLEALVGRDFLPRGNDICTRRPLVLQL------------------------------- 89
           SSVLEALVGRDFLPRG+DICTRRPLVLQL                               
Sbjct: 60  SSVLEALVGRDFLPRGSDICTRRPLVLQLLQTKRRPDGSEEEYGEFLHLPGKKFFDFSEI 119

Query: 90  ---LQTKTDEEYGE----------------------FLHLPGKRFYDFSEIRREIQAQTD 124
              +Q +TD E GE                       + LPG       +   +I+A+  
Sbjct: 120 RREIQAETDREAGENKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR 179

Query: 125 KEAGGN---------KVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDAR 175
                           VTPANSDLANSDALQIAG ADPDGYRTIG+ITKLDIMDRGTDAR
Sbjct: 180 TMIMSYIKLPSCLILAVTPANSDLANSDALQIAGNADPDGYRTIGVITKLDIMDRGTDAR 239

Query: 176 NLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQL 235
           NLLLGKVIPLRLGY+GVVNRSQEDI+ NRS+KDALVAEEKFFRSRPVYNGLADRCG+ QL
Sbjct: 240 NLLLGKVIPLRLGYIGVVNRSQEDIIMNRSVKDALVAEEKFFRSRPVYNGLADRCGITQL 299

Query: 236 AKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSE 295
           AKKLNQILVQHIK +LPGLK R++SALVSVAKEHAS GEI ESKAGQGALLLNILSKY+E
Sbjct: 300 AKKLNQILVQHIKTVLPGLKLRMNSALVSVAKEHASIGEIPESKAGQGALLLNILSKYAE 359

Query: 296 AFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGP 355
           AFSS VEGKNEEMST+ELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGP
Sbjct: 360 AFSSRVEGKNEEMSTAELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGP 419

Query: 356 KSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMD 415
           +SALFVP+VPFEVL+RRQIARLLDPSLQCARFIYDEL+KISH CLV+E+QRFP+LRKRMD
Sbjct: 420 RSALFVPEVPFEVLVRRQIARLLDPSLQCARFIYDELVKISHRCLVSEMQRFPILRKRMD 479

Query: 416 EVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPIT 475
           EV+GNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVE+ALQQIKSS++P+P+ 
Sbjct: 480 EVMGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEMALQQIKSSRLPVPVA 539

Query: 476 RHKDGVEPDKAPSSERSLKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTSGSSWGIS 535
           R KDG+EPDKAP+SERSLK+RAILAR VNGI+ADQGVRP  +VEK   +G+T+GSSWGIS
Sbjct: 540 RQKDGLEPDKAPTSERSLKARAILARPVNGIVADQGVRPVADVEKFTSSGSTTGSSWGIS 599

Query: 536 SIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIA 595
           SIFGGSDNRV A KE  TNK +SEPVQ+VEH+ +MIHL+EPPTIL+PSESHSEQE +EI+
Sbjct: 600 SIFGGSDNRVSA-KEISTNKTYSEPVQSVEHSISMIHLKEPPTILKPSESHSEQEAIEIS 658

Query: 596 VTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEE 655
           VTKLLLRSYYDIVRKNIED++PKA+MHFLVNHTKRELHNVFI+KLYRENLFEEMLQEP+E
Sbjct: 659 VTKLLLRSYYDIVRKNIEDAVPKAIMHFLVNHTKRELHNVFIRKLYRENLFEEMLQEPDE 718

Query: 656 VAMKRKRTRDTLRVLQQAFRTLDELPLEADSVERGYNM-SADPTGLPKIHGLPTSSMYTT 714
           VAMKRKRT +TLRVLQQA RTLDELP EA++VE+GY++ S+DPTGLPKIHGLPTSS+YTT
Sbjct: 719 VAMKRKRTSETLRVLQQALRTLDELPQEAETVEKGYSLGSSDPTGLPKIHGLPTSSLYTT 778

Query: 715 SSGSNDSYTASPKNPKSRKSSHSGELQSHLFSNADSNGSGRMYMPGLYPTVD 766
           S GS  SYTASPKNPKSRKSSHSGELQS    NADSNG GR YMPGLYPT+D
Sbjct: 779 SGGSTQSYTASPKNPKSRKSSHSGELQSPFHGNADSNGGGRSYMPGLYPTLD 830

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|296088789\|emb\|CBI38239.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|357445997\|ref\|XP_003593276.1\| Dynamin-related protein 3A [Medicago truncatula] gi\|355482324\|gb\|AES63527.1\| Dynamin-related protein 3A [Medicago truncatula]	Back alignment and taxonomy information

>gi\|357445995\|ref\|XP_003593275.1\| Dynamin-related protein 3A [Medicago truncatula] gi\|355482323\|gb\|AES63526.1\| Dynamin-related protein 3A [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356519473\|ref\|XP_003528397.1\| PREDICTED: dynamin-related protein 3A-like [Glycine max]	Back alignment and taxonomy information

>gi\|255584037\|ref\|XP_002532763.1\| dynamin, putative [Ricinus communis] gi\|223527492\|gb\|EEF29620.1\| dynamin, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224093258\|ref\|XP_002309855.1\| predicted protein [Populus trichocarpa] gi\|222852758\|gb\|EEE90305.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224132938\|ref\|XP_002327916.1\| predicted protein [Populus trichocarpa] gi\|222837325\|gb\|EEE75704.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449479057\|ref\|XP_004155493.1\| PREDICTED: dynamin-related protein 3A-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|147835423\|emb\|CAN69849.1\| hypothetical protein VITISV_007523 [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		767
TAIR\|locus:2059445		809	DRP3B "dynamin related protein	0.504	0.478	0.643	1.5e-221
UNIPROTKB\|G8JLD5		712	DNM1L "Dynamin-1-like protein"	0.449	0.484	0.425	1e-116
UNIPROTKB\|Q2KIA5		749	DNM1L "Dynamin-1-like protein"	0.696	0.712	0.380	1.7e-115
UNIPROTKB\|E2QXL2		749	DNM1L "Uncharacterized protein	0.697	0.714	0.381	3.5e-115
UNIPROTKB\|J3KPI2		738	DNM1L "Dynamin-1-like protein"	0.688	0.715	0.384	4.5e-115
RGD\|620416		755	Dnm1l "dynamin 1-like" [Rattus	0.701	0.712	0.375	9.3e-115
UNIPROTKB\|O35303		755	Dnm1l "Dynamin-1-like protein"	0.701	0.712	0.375	9.3e-115
MGI\|MGI:1921256		742	Dnm1l "dynamin 1-like" [Mus mu	0.702	0.726	0.373	1.2e-114
ZFIN\|ZDB-GENE-040426-1556		691	dnm1l "dynamin 1-like" [Danio	0.447	0.496	0.417	3.1e-114
UNIPROTKB\|G4N7U4		802	MGG_06361 "Dynamin-A" [Magnapo	0.426	0.407	0.472	4e-114

TAIR\|locus:2059445 DRP3B "dynamin related protein" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1296 (461.3 bits), Expect = 1.5e-221, Sum P(3) = 1.5e-221
 Identities = 253/393 (64%), Positives = 311/393 (79%)

Query:   327 FVKSLE--EVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQC 384
             FV   +  EVDPCEDLT DDIRTAIQNATGP+SALFVPDVPFEVL+RRQI+RLLDPSLQC
Sbjct:   417 FVSGFQFLEVDPCEDLTADDIRTAIQNATGPRSALFVPDVPFEVLVRRQISRLLDPSLQC 476

Query:   385 ARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYI 444
             ARFI+DEL+KISH C++ ELQRFPVL+KRMDEVIGNFLREGLEPS+ MI  +IEMEMDYI
Sbjct:   477 ARFIFDELVKISHQCMMKELQRFPVLQKRMDEVIGNFLREGLEPSQAMIRDLIEMEMDYI 536

Query:   445 NTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSERSLKSRAILARQVN 504
             NTSHPNFIGG+KAVE A+Q +KSS++P P+ R +D VEP++  SS   +K+R+ L RQ N
Sbjct:   537 NTSHPNFIGGTKAVEQAMQTVKSSRIPHPVARPRDTVEPERTASSGSQIKTRSFLGRQAN 596

Query:   505 GIMADQGVRPTVEVEKVAPAGNTXXXXXXXXXXXXXXDNRVPAGKESVTNKPFSEPVQNV 564
             GI+ DQ V    + E+ APAG+T              D +  A K ++ NKPFSE  Q V
Sbjct:   597 GIITDQAVPTAADAERPAPAGSTSWSGFSSIFRGS--DGQA-AAKNNLLNKPFSETTQEV 653

Query:   565 EHAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFL 624
                 + I+L+EPPTIL+ SE+HSEQE+VEI +TKLLL+SYYDIVRKN+ED +PKA+MHFL
Sbjct:   654 YQNLSTIYLKEPPTILKSSETHSEQESVEIEITKLLLKSYYDIVRKNVEDLVPKAIMHFL 713

Query:   625 VNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFRTLDELPLEA 684
             VN+TKRELHNVFI+KLYRENL EE+L+EP+E+A+KRKRT++TLR+LQQA RTLDELPLEA
Sbjct:   714 VNYTKRELHNVFIEKLYRENLIEELLKEPDELAIKRKRTQETLRILQQANRTLDELPLEA 773

Query:   685 DSVERGYNMSADPTGLPKIHGLPTSSMYTTSSG 717
             +SVERGY + ++     ++ G   S   T  +G
Sbjct:   774 ESVERGYKIGSEAKH-EELPGTRRSRTETNGNG 805

GO:0003924 "GTPase activity" evidence=IEA;ISS

GO:0005525 "GTP binding" evidence=IEA;ISS

GO:0005739 "mitochondrion" evidence=ISM;IDA

GO:0005886 "plasma membrane" evidence=IDA

GO:0005777 "peroxisome" evidence=IDA

GO:0016559 "peroxisome fission" evidence=IMP

GO:0000266 "mitochondrial fission" evidence=IGI

GO:0005515 "protein binding" evidence=IPI

GO:0009791 "post-embryonic development" evidence=IGI

GO:0005829 "cytosol" evidence=IDA

GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA

UNIPROTKB\|G8JLD5 DNM1L "Dynamin-1-like protein" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q2KIA5 DNM1L "Dynamin-1-like protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QXL2 DNM1L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|J3KPI2 DNM1L "Dynamin-1-like protein" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

RGD\|620416 Dnm1l "dynamin 1-like" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|O35303 Dnm1l "Dynamin-1-like protein" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

MGI\|MGI:1921256 Dnm1l "dynamin 1-like" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-1556 dnm1l "dynamin 1-like" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|G4N7U4 MGG_06361 "Dynamin-A" [Magnaporthe oryzae 70-15 (taxid:242507)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q8S944	DRP3A_ARATH	No assigned EC number	0.7781	0.7262	0.6893	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00001878001	SubName- Full=Chromosome undetermined scaffold_123, whole genome shotgun sequence; (828 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		767
pfam01031		296	pfam01031, Dynamin_M, Dynamin central region	1e-128
cd08771		278	cd08771, DLP_1, Dynamin_like protein family includ	2e-43
smart00053		240	smart00053, DYNc, Dynamin, GTPase	1e-39
cd08771		278	cd08771, DLP_1, Dynamin_like protein family includ	8e-37
pfam00350		168	pfam00350, Dynamin_N, Dynamin family	2e-32
pfam02212		90	pfam02212, GED, Dynamin GTPase effector domain	2e-32
smart00302		92	smart00302, GED, Dynamin GTPase effector domain	3e-28
smart00053		240	smart00053, DYNc, Dynamin, GTPase	4e-26
COG0699		546	COG0699, COG0699, Predicted GTPases (dynamin-relat	9e-25
cd00882		161	cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s	8e-05
cd09912		180	cd09912, DLP_2, Dynamin-like protein including dyn	4e-04

>gnl\|CDD\|216255 pfam01031, Dynamin_M, Dynamin central region	Back alignment and domain information

 Score =  383 bits (987), Expect = e-128
 Identities = 142/292 (48%), Positives = 205/292 (70%), Gaps = 1/292 (0%)

Query: 174 ARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVP 233
           A ++L  KV PL+LGYVGVVNRSQ+DI   +SIK+AL  E  FF + P Y  LA+RCG P
Sbjct: 1   AVDILENKVYPLKLGYVGVVNRSQQDINDKKSIKEALEDERAFFENHPHYRTLAERCGTP 60

Query: 234 QLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGE-ITESKAGQGALLLNILSK 292
            LAKKLNQ LV HI+  LP LKS+I+  L    KE   YG+   E  A +GA LL++++ 
Sbjct: 61  YLAKKLNQELVNHIRKSLPDLKSQINKKLQETEKELERYGDDPPEDPAEKGAFLLDLITA 120

Query: 293 YSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNA 352
           +++ F ++++G+ +++ST+ELSGGARI YIF   F K L+ +DP E L+D++IRTAI+N 
Sbjct: 121 FNQDFKNLIDGEEDDLSTNELSGGARIRYIFHEWFPKLLKSIDPFEKLSDEEIRTAIRNY 180

Query: 353 TGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRK 412
            G +  LFVP+  FE+L+++QI RL +P+L+C   +Y+EL +I       EL RFP L++
Sbjct: 181 RGRRLPLFVPEKAFELLVKKQIKRLEEPALKCVDLVYEELRRIFLKIASKELSRFPNLKE 240

Query: 413 RMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQ 464
            + EV+ + LRE LEP+E M+  +I+ME+ YINT+HP+FIGG +AV+   ++
Sbjct: 241 AIKEVVEDILREQLEPTEKMVRDLIDMELAYINTNHPDFIGGLQAVKKKEEE 292

This region lies between the GTPase domain, see pfam00350, and the pleckstrin homology (PH) domain, see pfam00169. Length = 296

>gnl\|CDD\|206738 cd08771, DLP_1, Dynamin_like protein family includes dynamins and Mx proteins	Back alignment and domain information

>gnl\|CDD\|197491 smart00053, DYNc, Dynamin, GTPase	Back alignment and domain information

>gnl\|CDD\|206738 cd08771, DLP_1, Dynamin_like protein family includes dynamins and Mx proteins	Back alignment and domain information

>gnl\|CDD\|215874 pfam00350, Dynamin_N, Dynamin family	Back alignment and domain information

>gnl\|CDD\|202159 pfam02212, GED, Dynamin GTPase effector domain	Back alignment and domain information

>gnl\|CDD\|128597 smart00302, GED, Dynamin GTPase effector domain	Back alignment and domain information

>gnl\|CDD\|197491 smart00053, DYNc, Dynamin, GTPase	Back alignment and domain information

>gnl\|CDD\|223771 COG0699, COG0699, Predicted GTPases (dynamin-related) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases)	Back alignment and domain information

>gnl\|CDD\|206739 cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		767
KOG0446		657	consensus Vacuolar sorting protein VPS1, dynamin,	100.0
PF01031		295	Dynamin_M: Dynamin central region; InterPro: IPR00	100.0
smart00053		240	DYNc Dynamin, GTPase. Large GTPases that mediate v	100.0
KOG0447		980	consensus Dynamin-like GTP binding protein [Genera	99.95
smart00302		92	GED Dynamin GTPase effector domain.	99.93
PF02212		92	GED: Dynamin GTPase effector domain; InterPro: IPR	99.88
COG0218		200	Predicted GTPase [General function prediction only	99.49
COG0699		546	Predicted GTPases (dynamin-related) [General funct	99.46
PF00350		168	Dynamin_N: Dynamin family; InterPro: IPR001401 Mem	99.43
COG1160		444	Predicted GTPases [General function prediction onl	98.8
COG0486		454	ThdF Predicted GTPase [General function prediction	98.67
PRK00454		196	engB GTP-binding protein YsxC; Reviewed	98.49
TIGR00436		270	era GTP-binding protein Era. Era is an essential G	98.44
TIGR03598		179	GTPase_YsxC ribosome biogenesis GTP-binding protei	98.42
TIGR03156		351	GTP_HflX GTP-binding protein HflX. This protein fa	98.41
PF01926		116	MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I	98.39
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	98.39
PF02421		156	FeoB_N: Ferrous iron transport protein B; InterPro	98.39
cd01876		170	YihA_EngB The YihA (EngB) subfamily. This subfamil	98.31
PRK11058		426	GTPase HflX; Provisional	98.31
TIGR00450		442	mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE	98.3
PRK00089		292	era GTPase Era; Reviewed	98.29
COG1160		444	Predicted GTPases [General function prediction onl	98.24
PRK03003		472	GTP-binding protein Der; Reviewed	98.2
cd01853		249	Toc34_like Toc34-like (Translocon at the Outer-env	98.19
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	98.18
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	98.18
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	98.17
COG1159		298	Era GTPase [General function prediction only]	98.16
PRK05291		449	trmE tRNA modification GTPase TrmE; Reviewed	98.15
PRK00093		435	GTP-binding protein Der; Reviewed	98.14
cd01852		196	AIG1 AIG1 (avrRpt2-induced gene 1). This represent	98.14
cd01887		168	IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo	98.12
KOG1191		531	consensus Mitochondrial GTPase [Translation, ribos	98.12
COG1084		346	Predicted GTPase [General function prediction only	98.06
PRK04213		201	GTP-binding protein; Provisional	98.04
PRK09866		741	hypothetical protein; Provisional	98.04
PRK03003		472	GTP-binding protein Der; Reviewed	98.04
cd00880		163	Era_like Era (E. coli Ras-like protein)-like. This	98.01
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	97.98
cd01895		174	EngA2 EngA2 subfamily. This CD represents the seco	97.94
cd04104		197	p47_IIGP_like p47 (47-kDa) family. The p47 GTPase	97.93
TIGR00991		313	3a0901s02IAP34 GTP-binding protein (Chloroplast En	97.88
cd01897		168	NOG NOG1 is a nucleolar GTP-binding protein presen	97.86
cd04164		157	trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein	97.86
cd01894		157	EngA1 EngA1 subfamily. This CD represents the firs	97.85
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	97.83
PRK00093		435	GTP-binding protein Der; Reviewed	97.82
PRK15494		339	era GTPase Era; Provisional	97.82
cd01898		170	Obg Obg subfamily. The Obg nucleotide binding prot	97.75
cd01868		165	Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a	97.75
cd00154		159	Rab Rab family. Rab GTPases form the largest famil	97.74
cd01861		161	Rab6 Rab6 subfamily. Rab6 is involved in microtubu	97.74
cd04171		164	SelB SelB subfamily. SelB is an elongation factor	97.73
PRK12298		390	obgE GTPase CgtA; Reviewed	97.7
KOG2486		320	consensus Predicted GTPase [General function predi	97.69
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	97.69
cd01866		168	Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg	97.67
cd01867		167	Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp	97.64
TIGR02528		142	EutP ethanolamine utilization protein, EutP. This	97.64
PRK15467		158	ethanolamine utilization protein EutP; Provisional	97.62
cd04159		159	Arl10_like Arl10-like subfamily. Arl9/Arl10 was id	97.59
PF04548		212	AIG1: AIG1 family; InterPro: IPR006703 This entry	97.58
cd00881		189	GTP_translation_factor GTP translation factor fami	97.58
cd04142		198	RRP22 RRP22 subfamily. RRP22 (Ras-related protein	97.54
cd04112		191	Rab26 Rab26 subfamily. First identified in rat pan	97.5
cd01863		161	Rab18 Rab18 subfamily. Mammalian Rab18 is implicat	97.5
cd01879		158	FeoB Ferrous iron transport protein B (FeoB) subfa	97.5
PRK12299		335	obgE GTPase CgtA; Reviewed	97.5
TIGR02729		329	Obg_CgtA Obg family GTPase CgtA. This model descri	97.48
cd04114		169	Rab30 Rab30 subfamily. Rab30 appears to be associa	97.48
cd01865		165	Rab3 Rab3 subfamily. The Rab3 subfamily contains R	97.47
TIGR00231		161	small_GTP small GTP-binding protein domain. This m	97.46
cd01850		276	CDC_Septin CDC/Septin. Septins are a conserved fam	97.45
TIGR00993		763	3a0901s04IAP86 chloroplast protein import componen	97.45
cd04123		162	Rab21 Rab21 subfamily. The localization and functi	97.45
PRK12297		424	obgE GTPase CgtA; Reviewed	97.44
TIGR00491		590	aIF-2 translation initiation factor aIF-2/yIF-2. T	97.42
cd04119		168	RJL RJL (RabJ-Like) subfamily. RJLs are found in m	97.4
cd01862		172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	97.4
smart00175		164	RAB Rab subfamily of small GTPases. Rab GTPases ar	97.37
cd01869		166	Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev	97.37
COG3596		296	Predicted GTPase [General function prediction only	97.37
PF05049		376	IIGP: Interferon-inducible GTPase (IIGP); InterPro	97.35
cd01864		165	Rab19 Rab19 subfamily. Rab19 proteins are associat	97.34
cd01891		194	TypA_BipA TypA (tyrosine phosphorylated protein A)	97.34
cd01860		163	Rab5_related Rab5-related subfamily. This subfamil	97.33
cd04106		162	Rab23_lke Rab23-like subfamily. Rab23 is a member	97.32
cd04113		161	Rab4 Rab4 subfamily. Rab4 has been implicated in n	97.31
cd04156		160	ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su	97.3
cd04118		193	Rab24 Rab24 subfamily. Rab24 is distinct from othe	97.3
PRK09554		772	feoB ferrous iron transport protein B; Reviewed	97.3
PRK12296		500	obgE GTPase CgtA; Reviewed	97.3
cd04152		183	Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i	97.28
cd04157		162	Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub	97.27
cd04139		164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	97.22
cd04165		224	GTPBP1_like GTPBP1-like. Mammalian GTP binding pro	97.21
cd04145		164	M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf	97.21
cd01881		176	Obg_like The Obg-like subfamily consists of five w	97.21
cd01858		157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	97.2
cd00876		160	Ras Ras family. The Ras family of the Ras superfam	97.2
cd04122		166	Rab14 Rab14 subfamily. Rab14 GTPases are localized	97.18
smart00173		164	RAS Ras subfamily of RAS small GTPases. Similar in	97.16
cd04146		165	RERG_RasL11_like RERG/RasL11-like subfamily. RERG	97.15
cd00882		157	Ras_like_GTPase Ras-like GTPase superfamily. The R	97.14
cd04127		180	Rab27A Rab27a subfamily. The Rab27a subfamily cons	97.13
cd04136		163	Rap_like Rap-like subfamily. The Rap subfamily con	97.12
cd00878		158	Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik	97.1
cd04138		162	H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras,	97.08
cd01884		195	EF_Tu EF-Tu subfamily. This subfamily includes ort	97.02
PF00009		188	GTP_EFTU: Elongation factor Tu GTP binding domain;	97.02
cd01890		179	LepA LepA subfamily. LepA belongs to the GTPase fa	97.01
CHL00071		409	tufA elongation factor Tu	97.01
cd04111		211	Rab39 Rab39 subfamily. Found in eukaryotes, Rab39	97.0
cd04154		173	Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are	97.0
cd04169		267	RF3 RF3 subfamily. Peptide chain release factor 3	96.99
cd04162		164	Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9	96.99
CHL00189		742	infB translation initiation factor 2; Provisional	96.99
cd01893		166	Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr	96.98
PRK05306		787	infB translation initiation factor IF-2; Validated	96.96
cd04160		167	Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote	96.96
cd04124		161	RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily	96.96
cd00879		190	Sar1 Sar1 subfamily. Sar1 is an essential componen	96.94
cd04115		170	Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u	96.93
cd01849		155	YlqF_related_GTPase YlqF-related GTPases. These pr	96.93
cd04101		164	RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove	96.92
cd04147		198	Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v	96.9
cd04125		188	RabA_like RabA-like subfamily. RabA was first iden	96.89
smart00178		184	SAR Sar1p-like members of the Ras-family of small	96.89
TIGR00487		587	IF-2 translation initiation factor IF-2. This mode	96.88
cd04107		201	Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38	96.88
cd01892		169	Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr	96.86
cd01889		192	SelB_euk SelB subfamily. SelB is an elongation fac	96.86
cd04175		164	Rap1 Rap1 subgroup. The Rap1 subgroup is part of t	96.85
cd04116		170	Rab9 Rab9 subfamily. Rab9 is found in late endosom	96.84
cd04170		268	EF-G_bact Elongation factor G (EF-G) subfamily. Tr	96.83
cd04166		208	CysN_ATPS CysN_ATPS subfamily. CysN, together with	96.83
cd04110		199	Rab35 Rab35 subfamily. Rab35 is one of several Rab	96.81
cd04168		237	TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T	96.81
TIGR00475		581	selB selenocysteine-specific elongation factor Sel	96.8
cd01855		190	YqeH YqeH. YqeH is an essential GTP-binding protei	96.8
COG2262		411	HflX GTPases [General function prediction only]	96.79
cd04151		158	Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t	96.79
cd01888		203	eIF2_gamma eIF2-gamma (gamma subunit of initiation	96.79
PRK04004		586	translation initiation factor IF-2; Validated	96.78
cd04176		163	Rap2 Rap2 subgroup. The Rap2 subgroup is part of t	96.78
cd00157		171	Rho Rho (Ras homology) family. Members of the Rho	96.78
cd04108		170	Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr	96.78
cd04155		173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	96.78
cd04137		180	RheB Rheb (Ras Homolog Enriched in Brain) subfamil	96.75
PLN03118		211	Rab family protein; Provisional	96.69
cd04178		172	Nucleostemin_like Nucleostemin-like. Nucleostemin	96.66
PLN03110		216	Rab GTPase; Provisional	96.63
cd04140		165	ARHI_like ARHI subfamily. ARHI (A Ras homolog memb	96.63
cd04109		215	Rab28 Rab28 subfamily. First identified in maize,	96.57
cd04177		168	RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the	96.53
cd01882		225	BMS1 Bms1. Bms1 is an essential, evolutionarily co	96.52
cd01886		270	EF-G Elongation factor G (EF-G) subfamily. Translo	96.49
cd01857		141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	96.47
cd04141		172	Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p	96.47
PLN03127		447	Elongation factor Tu; Provisional	96.44
cd04148		221	RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki	96.44
cd00877		166	Ran Ran (Ras-related nuclear proteins) /TC4 subfam	96.42
cd04161		167	Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (	96.42
TIGR00437		591	feoB ferrous iron transporter FeoB. FeoB (773 amin	96.42
cd04153		174	Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a	96.42
cd01870		175	RhoA_like RhoA-like subfamily. The RhoA subfamily	96.39
cd04120		202	Rab12 Rab12 subfamily. Rab12 was first identified	96.37
cd04144		190	Ras2 Ras2 subfamily. The Ras2 subfamily, found exc	96.3
cd04173		222	Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb	96.22
cd04117		161	Rab15 Rab15 subfamily. Rab15 colocalizes with the	96.21
PRK00007		693	elongation factor G; Reviewed	96.19
PLN03108		210	Rab family protein; Provisional	96.18
cd04149		168	Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor	96.16
COG4917		148	EutP Ethanolamine utilization protein [Amino acid	96.16
KOG1423		379	consensus Ras-like GTPase ERA [Cell cycle control,	96.14
COG1100		219	GTPase SAR1 and related small G proteins [General	96.12
smart00174		174	RHO Rho (Ras homology) subfamily of Ras-like small	96.11
cd04132		187	Rho4_like Rho4-like subfamily. Rho4 is a GTPase th	96.1
TIGR03596		276	GTPase_YlqF ribosome biogenesis GTP-binding protei	96.09
cd04167		213	Snu114p Snu114p subfamily. Snu114p is one of sever	96.08
PTZ00369		189	Ras-like protein; Provisional	96.06
cd04135		174	Tc10 TC10 subfamily. TC10 is a Rho family protein	96.01
PRK10512		614	selenocysteinyl-tRNA-specific translation factor;	96.0
cd04143		247	Rhes_like Rhes_like subfamily. This subfamily incl	95.94
cd01851		224	GBP Guanylate-binding protein (GBP), N-terminal do	95.94
TIGR02034		406	CysN sulfate adenylyltransferase, large subunit. H	95.94
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	95.92
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	95.89
PRK09563		287	rbgA GTPase YlqF; Reviewed	95.86
PTZ00258		390	GTP-binding protein; Provisional	95.81
cd04102		202	RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove	95.75
PRK12735		396	elongation factor Tu; Reviewed	95.74
PLN03126		478	Elongation factor Tu; Provisional	95.73
PRK12317		425	elongation factor 1-alpha; Reviewed	95.72
smart00177		175	ARF ARF-like small GTPases; ARF, ADP-ribosylation	95.59
PRK12736		394	elongation factor Tu; Reviewed	95.58
TIGR00484		689	EF-G translation elongation factor EF-G. After pep	95.54
PRK05124		474	cysN sulfate adenylyltransferase subunit 1; Provis	95.52
PRK00049		396	elongation factor Tu; Reviewed	95.5
cd01885		222	EF2 EF2 (for archaea and eukarya). Translocation r	95.43
PRK12739		691	elongation factor G; Reviewed	95.43
cd01883		219	EF1_alpha Eukaryotic elongation factor 1 (EF1) alp	95.4
PLN00223		181	ADP-ribosylation factor; Provisional	95.36
cd04128		182	Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi	95.36
PLN03071		219	GTP-binding nuclear protein Ran; Provisional	95.33
COG1161		322	Predicted GTPases [General function prediction onl	95.31
TIGR00485		394	EF-Tu translation elongation factor TU. This align	95.3
cd04105		203	SR_beta Signal recognition particle receptor, beta	95.24
PRK09602		396	translation-associated GTPase; Reviewed	95.12
cd01900		274	YchF YchF subfamily. YchF is a member of the Obg f	95.0
TIGR00157		245	ribosome small subunit-dependent GTPase A. The Aqu	95.0
KOG2203		772	consensus GTP-binding protein [General function pr	95.0
cd01856		171	YlqF YlqF. Proteins of the YlqF family contain all	94.98
cd04130		173	Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive	94.97
cd01896		233	DRG The developmentally regulated GTP-binding prot	94.96
PRK12289		352	GTPase RsgA; Reviewed	94.94
TIGR03680		406	eif2g_arch translation initiation factor 2 subunit	94.91
TIGR01394		594	TypA_BipA GTP-binding protein TypA/BipA. This bact	94.9
PRK10218		607	GTP-binding protein; Provisional	94.84
KOG0448		749	consensus Mitofusin 1 GTPase, involved in mitochon	94.81
TIGR00490		720	aEF-2 translation elongation factor aEF-2. This mo	94.76
PRK00741		526	prfC peptide chain release factor 3; Provisional	94.75
cd04174		232	Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb	94.73
PRK12288		347	GTPase RsgA; Reviewed	94.72
cd01899		318	Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg	94.7
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	94.66
KOG1424		562	consensus Predicted GTP-binding protein MMR1 [Gene	94.65
TIGR03597		360	GTPase_YqeH ribosome biogenesis GTPase YqeH. This	94.61
PF03193		161	DUF258: Protein of unknown function, DUF258; Inter	94.5
PRK09601		364	GTP-binding protein YchF; Reviewed	94.38
PRK04000		411	translation initiation factor IF-2 subunit gamma;	94.35
PRK00098		298	GTPase RsgA; Reviewed	94.34
TIGR01393		595	lepA GTP-binding protein LepA. LepA (GUF1 in Sacca	94.08
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	94.08
PLN00116		843	translation elongation factor EF-2 subunit; Provis	94.05
PF00735		281	Septin: Septin; InterPro: IPR000038 Septins consti	93.97
PRK13351		687	elongation factor G; Reviewed	93.85
PRK13796		365	GTPase YqeH; Provisional	93.7
COG1163		365	DRG Predicted GTPase [General function prediction	93.59
PTZ00416		836	elongation factor 2; Provisional	93.57
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	93.43
cd01854		287	YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil	93.41
TIGR00503		527	prfC peptide chain release factor 3. This translat	93.39
KOG0410		410	consensus Predicted GTP binding protein [General f	93.19
KOG0446		657	consensus Vacuolar sorting protein VPS1, dynamin,	93.18
PRK07560		731	elongation factor EF-2; Reviewed	93.14
cd00071		137	GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.	92.98
cd04158		169	ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor	92.84
cd04134		189	Rho3 Rho3 subfamily. Rho3 is a member of the Rho f	92.84
PF00071		162	Ras: Ras family; InterPro: IPR001806 Small GTPases	92.79
COG0370		653	FeoB Fe2+ transport system protein B [Inorganic io	92.66
PF13555		62	AAA_29: P-loop containing region of AAA domain	92.58
TIGR03263		180	guanyl_kin guanylate kinase. Members of this famil	92.58
cd01859		156	MJ1464 MJ1464. This family represents archaeal GTP	92.51
cd04103		158	Centaurin_gamma Centaurin gamma. The centaurins (a	92.49
PF05879		742	RHD3: Root hair defective 3 GTP-binding protein (R	92.36
PF00005		137	ABC_tran: ABC transporter This structure is on hol	92.36
TIGR00483		426	EF-1_alpha translation elongation factor EF-1 alph	92.23
PF03205		140	MobB: Molybdopterin guanine dinucleotide synthesis	92.22
COG4107		258	PhnK ABC-type phosphonate transport system, ATPase	92.15
cd01874		175	Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas	92.07
cd04150		159	Arf1_5_like Arf1-Arf5-like subfamily. This subfami	92.05
COG1101		263	PhnK ABC-type uncharacterized transport system, AT	92.02
COG3840		231	ThiQ ABC-type thiamine transport system, ATPase co	92.02
PRK05433		600	GTP-binding protein LepA; Provisional	91.97
TIGR01166		190	cbiO cobalt transport protein ATP-binding subunit.	91.96
cd03225		211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	91.95
cd04131		178	Rnd Rnd subfamily. The Rnd subfamily contains Rnd1	91.94
cd03255		218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	91.82
COG5192		1077	BMS1 GTP-binding protein required for 40S ribosome	91.81
cd03261		235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	91.77
PTZ00327		460	eukaryotic translation initiation factor 2 gamma s	91.74
cd04121		189	Rab40 Rab40 subfamily. This subfamily contains Rab	91.73
PTZ00141		446	elongation factor 1- alpha; Provisional	91.72
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	91.69
cd03224		222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	91.68
cd03263		220	ABC_subfamily_A The ABCA subfamily mediates the tr	91.66
PRK00300		205	gmk guanylate kinase; Provisional	91.65
cd03264		211	ABC_drug_resistance_like ABC-type multidrug transp	91.65
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	91.6
cd03218		232	ABC_YhbG The ABC transporters belonging to the Yhb	91.59
COG2229		187	Predicted GTPase [General function prediction only	91.59
smart00176		200	RAN Ran (Ras-related nuclear proteins) /TC4 subfam	91.58
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	91.57
cd03266		218	ABC_NatA_sodium_exporter NatA is the ATPase compon	91.53
KOG1707		625	consensus Predicted Ras related/Rac-GTP binding pr	91.47
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	91.43
cd03269		210	ABC_putative_ATPase This subfamily is involved in	91.4
TIGR02673		214	FtsE cell division ATP-binding protein FtsE. This	91.34
PF13521		163	AAA_28: AAA domain; PDB: 1LW7_A.	91.32
cd03215		182	ABC_Carb_Monos_II This family represents domain II	91.32
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	91.3
PTZ00133		182	ADP-ribosylation factor; Provisional	91.3
cd03226		205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	91.27
PRK11629		233	lolD lipoprotein transporter ATP-binding subunit;	91.26
cd04172		182	Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE	91.23
PRK13541		195	cytochrome c biogenesis protein CcmA; Provisional	91.16
TIGR00960		216	3a0501s02 Type II (General) Secretory Pathway (IIS	91.15
COG0410		237	LivF ABC-type branched-chain amino acid transport	91.15
cd03293		220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	91.14
TIGR02315		243	ABC_phnC phosphonate ABC transporter, ATP-binding	91.12
cd04126		220	Rab20 Rab20 subfamily. Rab20 is one of several Rab	91.12
cd03259		213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	91.09
cd03265		220	ABC_DrrA DrrA is the ATP-binding protein component	91.04
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	91.0
cd03256		241	ABC_PhnC_transporter ABC-type phosphate/phosphonat	91.0
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	90.97
cd01871		174	Rac1_like Rac1-like subfamily. The Rac1-like subfa	90.94
cd03278		197	ABC_SMC_barmotin Barmotin is a tight junction-asso	90.92
cd04129		187	Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that	90.91
PRK15112		267	antimicrobial peptide ABC system ATP-binding prote	90.9
cd03292		214	ABC_FtsE_transporter FtsE is a hydrophilic nucleot	90.9
cd03369		207	ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty	90.89
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	90.87
PRK13540		200	cytochrome c biogenesis protein CcmA; Provisional	90.86
PRK15177		213	Vi polysaccharide export ATP-binding protein VexC;	90.82
cd03262		213	ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-	90.81
cd03254		229	ABCC_Glucan_exporter_like Glucan exporter ATP-bind	90.81
cd03258		233	ABC_MetN_methionine_transporter MetN (also known a	90.77
cd03229		178	ABC_Class3 This class is comprised of all BPD (Bin	90.74
cd03216		163	ABC_Carb_Monos_I This family represents the domain	90.7
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	90.68
cd03249		238	ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6)	90.68
PRK10895		241	lipopolysaccharide ABC transporter ATP-binding pro	90.66
cd03219		236	ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans	90.66
cd03231		201	ABC_CcmA_heme_exporter CcmA, the ATP-binding compo	90.61
TIGR03608		206	L_ocin_972_ABC putative bacteriocin export ABC tra	90.55
PRK11124		242	artP arginine transporter ATP-binding subunit; Pro	90.55
cd03246		173	ABCC_Protease_Secretion This family represents the	90.52
cd03257		228	ABC_NikE_OppD_transporters The ABC transporter sub	90.47
cd03298		211	ABC_ThiQ_thiamine_transporter ABC-type thiamine tr	90.45
PRK13651		305	cobalt transporter ATP-binding subunit; Provisiona	90.45
cd03245		220	ABCC_bacteriocin_exporters ABC-type bacteriocin ex	90.45
COG0536		369	Obg Predicted GTPase [General function prediction	90.43
cd03236		255	ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o	90.42
PRK14250		241	phosphate ABC transporter ATP-binding protein; Pro	90.38
cd03268		208	ABC_BcrA_bacitracin_resist The BcrA subfamily repr	90.38
cd03235		213	ABC_Metallic_Cations ABC component of the metal-ty	90.38
cd03253		236	ABCC_ATM1_transporter ATM1 is an ABC transporter t	90.36
TIGR02211		221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	90.35
PRK13641		287	cbiO cobalt transporter ATP-binding subunit; Provi	90.34
TIGR03864		236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	90.34
cd03260		227	ABC_PstB_phosphate_transporter Phosphate uptake is	90.32
cd03217		200	ABC_FeS_Assembly ABC-type transport system involve	90.29
TIGR01978		243	sufC FeS assembly ATPase SufC. SufC is part of the	90.28
cd03301		213	ABC_MalK_N The N-terminal ATPase domain of the mal	90.28
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	90.26
cd03300		232	ABC_PotA_N PotA is an ABC-type transporter and the	90.23
TIGR02324		224	CP_lyasePhnL phosphonate C-P lyase system protein	90.22
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	90.18
TIGR02323		253	CP_lyasePhnK phosphonate C-P lyase system protein	90.17
TIGR03410		230	urea_trans_UrtE urea ABC transporter, ATP-binding	90.1
PRK13543		214	cytochrome c biogenesis protein CcmA; Provisional	90.09
PRK11248		255	tauB taurine transporter ATP-binding subunit; Prov	90.07
PRK13635		279	cbiO cobalt transporter ATP-binding subunit; Provi	90.07
PRK10584		228	putative ABC transporter ATP-binding protein YbbA;	90.04
TIGR00968		237	3a0106s01 sulfate ABC transporter, ATP-binding pro	90.01
CHL00131		252	ycf16 sulfate ABC transporter protein; Validated	89.9
PRK13539		207	cytochrome c biogenesis protein CcmA; Provisional	89.89
cd03233		202	ABC_PDR_domain1 The pleiotropic drug resistance (P	89.89
TIGR01184		230	ntrCD nitrate transport ATP-binding subunits C and	89.88
PRK13632		271	cbiO cobalt transporter ATP-binding subunit; Provi	89.87
cd03250		204	ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.	89.84
cd03295		242	ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin	89.84
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	89.81
PRK13645		289	cbiO cobalt transporter ATP-binding subunit; Provi	89.81
cd01875		191	RhoG RhoG subfamily. RhoG is a GTPase with high se	89.79
PRK13643		288	cbiO cobalt transporter ATP-binding subunit; Provi	89.78
cd03232		192	ABC_PDR_domain2 The pleiotropic drug resistance-li	89.75
TIGR03740		223	galliderm_ABC gallidermin-class lantibiotic protec	89.74
PRK13538		204	cytochrome c biogenesis protein CcmA; Provisional	89.73
cd03251		234	ABCC_MsbA MsbA is an essential ABC transporter, cl	89.72
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	89.7
PRK10908		222	cell division protein FtsE; Provisional	89.7
cd03252		237	ABCC_Hemolysin The ABC-transporter hemolysin B is	89.68
cd03297		214	ABC_ModC_molybdenum_transporter ModC is an ABC-typ	89.67
PRK10253		265	iron-enterobactin transporter ATP-binding protein;	89.66
TIGR01277		213	thiQ thiamine ABC transporter, ATP-binding protein	89.65
PRK10247		225	putative ABC transporter ATP-binding protein YbbL;	89.57
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	89.55
cd03220		224	ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo	89.54
cd03294		269	ABC_Pro_Gly_Bertaine This family comprises the gly	89.53
PRK13652		277	cbiO cobalt transporter ATP-binding subunit; Provi	89.48
PRK13638		271	cbiO cobalt transporter ATP-binding subunit; Provi	89.46
cd03291		282	ABCC_CFTR1 The CFTR subfamily domain 1. The cystic	89.45
PRK11247		257	ssuB aliphatic sulfonates transport ATP-binding su	89.43
cd03296		239	ABC_CysA_sulfate_importer Part of the ABC transpor	89.39
COG3910		233	Predicted ATPase [General function prediction only	89.38
PRK13633		280	cobalt transporter ATP-binding subunit; Provisiona	89.36
TIGR01189		198	ccmA heme ABC exporter, ATP-binding protein CcmA.	89.33
PRK13639		275	cbiO cobalt transporter ATP-binding subunit; Provi	89.31
PRK13648		269	cbiO cobalt transporter ATP-binding subunit; Provi	89.3
KOG0094		221	consensus GTPase Rab6/YPT6/Ryh1, small G protein s	89.27
COG1120		258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	89.22
PRK10416		318	signal recognition particle-docking protein FtsY;	89.21
TIGR03771		223	anch_rpt_ABC anchored repeat-type ABC transporter,	89.2
TIGR03411		242	urea_trans_UrtD urea ABC transporter, ATP-binding	89.2
TIGR02769		265	nickel_nikE nickel import ATP-binding protein NikE	89.18
cd03244		221	ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.	89.17
PRK14738		206	gmk guanylate kinase; Provisional	89.13
PRK09580		248	sufC cysteine desulfurase ATPase component; Review	89.13
cd03237		246	ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o	89.11
PRK10575		265	iron-hydroxamate transporter ATP-binding subunit;	89.09
PRK14737		186	gmk guanylate kinase; Provisional	89.08
PRK11614		237	livF leucine/isoleucine/valine transporter ATP-bin	89.07
PRK10619		257	histidine/lysine/arginine/ornithine transporter su	89.05
PRK11264		250	putative amino-acid ABC transporter ATP-binding pr	89.03
COG1162		301	Predicted GTPases [General function prediction onl	88.99
TIGR03873		256	F420-0_ABC_ATP proposed F420-0 ABC transporter, AT	88.98
PRK11300		255	livG leucine/isoleucine/valine transporter ATP-bin	88.97
cd03248		226	ABCC_TAP TAP, the Transporter Associated with Anti	88.94
PRK11701		258	phnK phosphonate C-P lyase system protein PhnK; Pr	88.93
PRK13546		264	teichoic acids export protein ATP-binding subunit;	88.9
TIGR03348		1169	VI_IcmF type VI secretion protein IcmF. Members of	88.87
PRK13647		274	cbiO cobalt transporter ATP-binding subunit; Provi	88.84
cd03273		251	ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein	88.82
PRK13851		344	type IV secretion system protein VirB11; Provision	88.8
TIGR02982		220	heterocyst_DevA ABC exporter ATP-binding subunit,	88.74
PRK13636		283	cbiO cobalt transporter ATP-binding subunit; Provi	88.74
TIGR03005		252	ectoine_ehuA ectoine/hydroxyectoine ABC transporte	88.65
PRK13631		320	cbiO cobalt transporter ATP-binding subunit; Provi	88.64
cd03290		218	ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec	88.6
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	88.58
PRK11831		269	putative ABC transporter ATP-binding protein YrbF;	88.49
PRK13637		287	cbiO cobalt transporter ATP-binding subunit; Provi	88.48
PRK09493		240	glnQ glutamine ABC transporter ATP-binding protein	88.42
PRK13649		280	cbiO cobalt transporter ATP-binding subunit; Provi	88.38
COG3638		258	ABC-type phosphate/phosphonate transport system, A	88.37
PRK15056		272	manganese/iron transporter ATP-binding protein; Pr	88.36
COG0194		191	Gmk Guanylate kinase [Nucleotide transport and met	88.28
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	88.14
PRK13548		258	hmuV hemin importer ATP-binding subunit; Provision	88.09
PRK10771		232	thiQ thiamine transporter ATP-binding subunit; Pro	88.06
PRK11231		255	fecE iron-dicitrate transporter ATP-binding subuni	88.06
PRK13547		272	hmuV hemin importer ATP-binding subunit; Provision	88.03
PRK09544		251	znuC high-affinity zinc transporter ATPase; Review	88.03
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	87.91
PRK13646		286	cbiO cobalt transporter ATP-binding subunit; Provi	87.91
COG4559		259	ABC-type hemin transport system, ATPase component	87.89
cd04133		176	Rop_like Rop subfamily. The Rop (Rho-related prote	87.89
PRK13644		274	cbiO cobalt transporter ATP-binding subunit; Provi	87.88
PF13304		303	AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T	87.87
PF00025		175	Arf: ADP-ribosylation factor family The prints ent	87.79
PRK13642		277	cbiO cobalt transporter ATP-binding subunit; Provi	87.77
cd03275		247	ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein	87.75
PRK10078		186	ribose 1,5-bisphosphokinase; Provisional	87.75
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	87.7
TIGR01188		302	drrA daunorubicin resistance ABC transporter ATP-b	87.62
PRK10867		433	signal recognition particle protein; Provisional	87.57
cd03213		194	ABCG_EPDR ABCG transporters are involved in eye pi	87.56
COG0532		509	InfB Translation initiation factor 2 (IF-2; GTPase	87.54
cd03288		257	ABCC_SUR2 The SUR domain 2. The sulfonylurea recep	87.47
PRK10419		268	nikE nickel transporter ATP-binding protein NikE;	87.44
PRK13634		290	cbiO cobalt transporter ATP-binding subunit; Provi	87.41
PRK14269		246	phosphate ABC transporter ATP-binding protein; Pro	87.41
PRK13640		282	cbiO cobalt transporter ATP-binding subunit; Provi	87.39
cd03240		204	ABC_Rad50 The catalytic domains of Rad50 are simil	87.39
COG1121		254	ZnuC ABC-type Mn/Zn transport systems, ATPase comp	87.39
COG3839		338	MalK ABC-type sugar transport systems, ATPase comp	87.35
TIGR01288		303	nodI ATP-binding ABC transporter family nodulation	87.35
PRK12740		668	elongation factor G; Reviewed	87.31
cd03267		236	ABC_NatA_like Similar in sequence to NatA, this is	87.31
PTZ00132		215	GTP-binding nuclear protein Ran; Provisional	87.31
KOG1490		620	consensus GTP-binding protein CRFG/NOG1 (ODN super	87.29
TIGR02770		230	nickel_nikD nickel import ATP-binding protein NikD	87.22
TIGR00972		247	3a0107s01c2 phosphate ABC transporter, ATP-binding	87.19
COG4988		559	CydD ABC-type transport system involved in cytochr	87.17
PRK10851		353	sulfate/thiosulfate transporter subunit; Provision	87.04
PRK10751		173	molybdopterin-guanine dinucleotide biosynthesis pr	86.96
PRK14240		250	phosphate transporter ATP-binding protein; Provisi	86.84
TIGR02322		179	phosphon_PhnN phosphonate metabolism protein/1,5-b	86.84
TIGR00064		272	ftsY signal recognition particle-docking protein F	86.83
PRK03695		248	vitamin B12-transporter ATPase; Provisional	86.8
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	86.76
KOG2484		435	consensus GTPase [General function prediction only	86.76
PRK13650		279	cbiO cobalt transporter ATP-binding subunit; Provi	86.72
cd03299		235	ABC_ModC_like Archeal protein closely related to M	86.71
PRK10938		490	putative molybdenum transport ATP-binding protein	86.59
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	86.53
PRK11153		343	metN DL-methionine transporter ATP-binding subunit	86.45
PRK14239		252	phosphate transporter ATP-binding protein; Provisi	86.44
cd03234		226	ABCG_White The White subfamily represents ABC tran	86.44
PRK14262		250	phosphate ABC transporter ATP-binding protein; Pro	86.43
PRK14247		250	phosphate ABC transporter ATP-binding protein; Pro	86.38
PRK14261		253	phosphate ABC transporter ATP-binding protein; Pro	86.28
PRK14241		258	phosphate transporter ATP-binding protein; Provisi	86.27
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	86.2
PRK11650		356	ugpC glycerol-3-phosphate transporter ATP-binding	86.17
PRK11144		352	modC molybdate transporter ATP-binding protein; Pr	86.16
PLN00023		334	GTP-binding protein; Provisional	86.13
TIGR00235		207	udk uridine kinase. Model contains a number of lon	86.09
cd03289		275	ABCC_CFTR2 The CFTR subfamily domain 2. The cystic	86.08
PRK10418		254	nikD nickel transporter ATP-binding protein NikD;	85.99
KOG0054		1381	consensus Multidrug resistance-associated protein/	85.93
PRK14273		254	phosphate ABC transporter ATP-binding protein; Pro	85.9
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	85.9
PRK09984		262	phosphonate/organophosphate ester transporter subu	85.89
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	85.84
cd03239		178	ABC_SMC_head The structural maintenance of chromos	85.76

>KOG0446 consensus Vacuolar sorting protein VPS1, dynamin, and related proteins [Intracellular trafficking, secretion, and vesicular transport; General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=3.6e-103  Score=910.18  Aligned_cols=589  Identities=39%  Similarity=0.571  Sum_probs=522.0

Q ss_pred             CCCchHHHHHHHHHHHHHhCCCCCCCCCeEEEEcCCCCchHHHHHHHhCCCCccccCCCccCcceeehhcccCCc-cccc
Q 004228           21 LGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTD-EEYG   99 (767)
Q Consensus        21 ~~~~~i~lin~L~d~~~~~G~~~~i~LPqIvVvG~QSsGKSSvLEal~G~~flPr~~g~~TR~Pl~l~l~~~~~~-~~~~   99 (767)
                      ..+.++|++|++||.|..+|.+..++||+|||||+||+|||||||+|+|++|||||+|+|||||++++|.+.... ++|+
T Consensus         3 ~~~~li~~vn~lqd~~~~l~~~~~i~lP~I~vvG~QSsGKSSvLE~lvG~~flpRg~givTRrPlvlqL~~~~~~~~e~~   82 (657)
T KOG0446|consen    3 LMRLLIPLSNPLQDKLEILGSSSFIPLPQIVVVGGQSSGKSSVLESLVGFVFLPRGVGIVTRRPLILQLSIVAGGDEEEA   82 (657)
T ss_pred             hhhhccccchHHHHHHHHhcCCCcccCCceEEecCCCCcchhHHHHhhccccccccccceecccceeecccccCCcccch
Confidence            567899999999999999998888999999999999999999999999999999999999999999999998653 6999


Q ss_pred             ccc-cCCCCcccChhHHHHHHHHHHhhhhcCCc-----------------------------------------------
Q 004228          100 EFL-HLPGKRFYDFSEIRREIQAQTDKEAGGNK-----------------------------------------------  131 (767)
Q Consensus       100 ~f~-~~pg~~~~d~~~i~~~i~~~t~~~~g~n~-----------------------------------------------  131 (767)
                      +|. |.++..|+||++++++|+++|++++|.|+                                               
T Consensus        83 ~f~~h~~~~~~~D~~~vrkeI~~et~~~~g~~kgiS~~pI~L~i~s~~v~~lTLvDlPG~tkvpv~dqp~di~~qI~~mi  162 (657)
T KOG0446|consen   83 SFLTHDKKKRFTDFEEVRKEIRSETDRITGSNKGISPVPITLKIFSALVANLTLVDLPGLTKVPVADQPDDIEEEIKSMI  162 (657)
T ss_pred             hccccccccccCCHHHHHHHHHhhHHHhcCCCCCcCCCCceeeecCCCCchhhhcCCCCCcccccCCCCccHHHHHHHHH
Confidence            999 99999999999999999999999998776                                               


Q ss_pred             -------------cccCCCcccccHHHHHHHHhCcCCCceEEEeeccCCCCCcccHHHHHcCCCCCcccceEEEEeCChh
Q 004228          132 -------------VTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQE  198 (767)
Q Consensus       132 -------------V~~a~~D~ans~aL~la~~vDP~G~RTIGVlTK~Dl~d~gtd~~~iL~g~~~~LklGy~~V~nrsq~  198 (767)
                                   |+|||+|++|++|+++|+++||.|.|||||+||+|+||+||+++++|.|+.++|++||++|+||+|+
T Consensus       163 ~~yi~~~~~iILav~~an~d~ats~alkiarevDp~g~RTigvitK~DlmdkGt~~~~~L~g~~~~l~~g~v~vvnR~q~  242 (657)
T KOG0446|consen  163 EEYIEKPNRIILAVTPANSDIATSPALVVAREVDPGGSRTLEVITKFDFMDKGTNAVTRLVGRPITLKVGYVGVVNRSQS  242 (657)
T ss_pred             HHhccccchhhhhccchhhhhhcCHHHHHHHhhCCCccchhHHhhhHHhhhcCCcceeeecCCccccccceeeeeccchh
Confidence                         8899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhcccCHHHHHHHHHHhhccCCCCCCcccccChhHHHHHHHHHHHHHHHHhhHhHHHHHHHHHHHHHHHHHHcCCCCCC
Q 004228          199 DIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITES  278 (767)
Q Consensus       199 di~~~~s~~ea~~~E~~FF~~~~~~~~l~~~~Gi~~L~~~Ls~iL~~hI~~~LP~l~~~I~~~L~~~~~eL~~lG~~~~~  278 (767)
                      +|..++++.+|+..|..||.+||.|+.+..++|+++|+++|+.+|..||+++||.|+..|+.++.+.++||..||. ...
T Consensus       243 di~~~k~~~~al~~e~~~f~~~p~y~~~~~~~g~p~La~~L~~~l~~hi~~~lP~l~~~i~~~~~~~~~el~~~g~-~~~  321 (657)
T KOG0446|consen  243 IIDFKKSILEALNDEVPSFESVPSYPILLTISGVPYLALLLPGYLQSHIRDQLPELKTKINKLLEKYQDELNRIGA-VDV  321 (657)
T ss_pred             hhhhhhhHHHHHHhhhhhhhccccccccccccCcchHHHHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHHHHHhcc-cCC
Confidence            9999999999999999999999999999988999999999999999999999999999999999999999999997 333


Q ss_pred             hhhHHHHHHHHHHHHHHHHhhhccCCcccCCcccccccchHHHHHHHHHHHhhhhcCCCCCCchHHHHHHHHhhcCCCCC
Q 004228          279 KAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSA  358 (767)
Q Consensus       279 ~~~~~~~Ll~~i~~F~~~~~~~i~G~~~~~~~~~l~ggaRi~~if~~~F~~~l~~~~p~~~l~~~dI~~~I~n~~G~~~p  358 (767)
                      .......++.++..|+..|...+.|+.+...+.+++||+||+|+|++.|...+..++|+..+...+|++++.|++|++++
T Consensus       322 ~~~~~~~ll~~i~~~~~~~~~~v~g~~~~~~~~elsggari~~~F~~~f~~~i~~i~~~~~~~~~~i~~~i~~~~G~~~~  401 (657)
T KOG0446|consen  322 DLANSAALLAIIREDPRGLRTGVIGKLDLVPTKALSGGARINYPFHGGFPGVIKKLPPDRKLLGQNIEKLVSEASGIRPS  401 (657)
T ss_pred             ccchhhHHHHHHHHHHHHHHHhhcccccccchhcccchhhhhhhhhhccchhhhcCCcchhhhHHHHHHHHHhccCCCcc
Confidence            34467889999999999999999999876557899999999999999999999999999999999999999999999999


Q ss_pred             CCCCcHHHHHHHHHHHHHhhchHHHHHHHHHHHHHHHHhhhhhh-ccccchhHHHHHHHHHHHHHHHhHhhHHHHHHHHH
Q 004228          359 LFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVN-ELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHII  437 (767)
Q Consensus       359 ~fvp~~~fe~Lvr~qI~~l~~Pa~~c~~~V~~el~~i~~~~~~~-~~~rfp~L~~~i~~~v~~~l~~~~~~a~~~i~~li  437 (767)
                      +|+|+.+||.+|++||+.+++||++|++.|+++|.+++++|... +|.|||.|+.++.+++.+++++++.+++++|..+|
T Consensus       402 lf~p~~afe~lvk~~i~~l~~p~l~~v~~v~~el~~~~~~~~~~~~l~rfp~l~~~~~~~~~~~~~~~~~~t~~~v~~~i  481 (657)
T KOG0446|consen  402 LFVPESSFESLVKGQIQSLRDPSLKCVEEVHRELVRIVADSIRATELKRFPVLYSELVEIASSLIAEGLDETKKAVKNLI  481 (657)
T ss_pred             ccCChHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHhhhHHHHHhHHHHHHHHHHHHHHHHHhhhHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999876 79999999999999999999999999999999999


Q ss_pred             HHHhcccCCCCCCCccchH-HHHHHHHhhhhcCCCCCcccCCCCCCCCCCCCcchhhhhHHHHHhhhcccccCCCCCcch
Q 004228          438 EMEMDYINTSHPNFIGGSK-AVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSERSLKSRAILARQVNGIMADQGVRPTV  516 (767)
Q Consensus       438 ~~E~~yInT~hpdF~~~~~-a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~  516 (767)
                      +||.+||||.||||+++.+ ++......  +.+                                ...++. +.      
T Consensus       482 ~~e~~yinT~h~df~~~~~~al~~~~~~--~~~--------------------------------~~~~~~-~~------  520 (657)
T KOG0446|consen  482 DLEQSYLNTDHPDFRSLTDSALSSVTSP--SIA--------------------------------AMKLIS-AQ------  520 (657)
T ss_pred             HHHHHHhcCcChhhhhhHHHHHHHhhcc--ccc--------------------------------cccccc-cc------
Confidence            9999999999999999875 33222110  000                                000000 00      


Q ss_pred             hhcccCCCCCCCCCCCccccccCCCCCCCCCCCCcCCCCCCCCCchhhhhHHhhhhcCCCCccCCCCCCCchhHHHHHHH
Q 004228          517 EVEKVAPAGNTSGSSWGISSIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIAV  596 (767)
Q Consensus       517 ~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~l~~~p~~l~~~~~~s~~e~~Ei~~  596 (767)
                          ..  .......++....+.+                          ....+.+...+..+......++++..+++.
T Consensus       521 ----~~--~~~~~~~~~~~~~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  568 (657)
T KOG0446|consen  521 ----LL--KEELGECNSALKAIKN--------------------------AVGSIRLDPSDIVLSRALVLKKRECKETEE  568 (657)
T ss_pred             ----cc--ccccccccchhhhhcc--------------------------hhhhhhhcccchhhhhhhhcchhhhHHHHH
Confidence                00  0000000000000100                          000022233344444455667788899999


Q ss_pred             HHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHhc-hhhHhhhcCCCHHHHHHHHHHHHHHHHHHHHHH
Q 004228          597 TKLLLRSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYR-ENLFEEMLQEPEEVAMKRKRTRDTLRVLQQAFR  675 (767)
Q Consensus       597 ir~Lv~SYF~IVrK~i~D~VPKaImhfLVn~~k~~Lq~eLi~~LY~-~~~~~eLL~E~~~ia~kR~~l~~~l~~L~qA~~  675 (767)
                      |+.++.|||+||+|+|+|+|||+|||||||.+++.||++|+++||+ .+.+++||+|+|.++.+|++|++|+++|++|..
T Consensus       569 i~~~~~sY~~iv~~~i~d~vpk~i~~~lv~~~k~~l~~~l~~~L~~~~~~~~~ll~E~~~i~~~R~~~~~~l~~L~~a~~  648 (657)
T KOG0446|consen  569 ISSCPESYLNIVSDKLVDTVPKALNHELLNEFKDDLPNELDQRLYAGDEQLESLLKEDPRIKRRRELQQKRLLALQKALS  648 (657)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchhHHHHHHccCHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999 999999999999999999999999999999999


Q ss_pred             HHcccCcc
Q 004228          676 TLDELPLE  683 (767)
Q Consensus       676 iL~ev~~~  683 (767)
                      +|..+...
T Consensus       649 ii~~~~~~  656 (657)
T KOG0446|consen  649 ILATVAQA  656 (657)
T ss_pred             HHHHHhcc
Confidence            99887653

>PF01031 Dynamin_M: Dynamin central region; InterPro: IPR000375 Dynamin is a microtubule-associated force-producing protein of 100 Kd which is involved in the production of microtubule bundles	Back alignment and domain information

>smart00053 DYNc Dynamin, GTPase	Back alignment and domain information

>KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only]	Back alignment and domain information

>smart00302 GED Dynamin GTPase effector domain	Back alignment and domain information

>PF02212 GED: Dynamin GTPase effector domain; InterPro: IPR003130 Dynamin GTPase effector domain found in proteins related to dynamin	Back alignment and domain information

>COG0218 Predicted GTPase [General function prediction only]	Back alignment and domain information

>COG0699 Predicted GTPases (dynamin-related) [General function prediction only]	Back alignment and domain information

>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>COG0486 ThdF Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK00454 engB GTP-binding protein YsxC; Reviewed	Back alignment and domain information

>TIGR00436 era GTP-binding protein Era	Back alignment and domain information

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB	Back alignment and domain information

>TIGR03156 GTP_HflX GTP-binding protein HflX	Back alignment and domain information

>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions	Back alignment and domain information

>cd01876 YihA_EngB The YihA (EngB) subfamily	Back alignment and domain information

>PRK11058 GTPase HflX; Provisional	Back alignment and domain information

>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE	Back alignment and domain information

>PRK00089 era GTPase Era; Reviewed	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts)	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>COG1159 Era GTPase [General function prediction only]	Back alignment and domain information

>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1)	Back alignment and domain information

>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily	Back alignment and domain information

>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1084 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK04213 GTP-binding protein; Provisional	Back alignment and domain information

>PRK09866 hypothetical protein; Provisional	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd00880 Era_like Era (E	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>cd01895 EngA2 EngA2 subfamily	Back alignment and domain information

>cd04104 p47_IIGP_like p47 (47-kDa) family	Back alignment and domain information

>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase)	Back alignment and domain information

>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans	Back alignment and domain information

>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes	Back alignment and domain information

>cd01894 EngA1 EngA1 subfamily	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>PRK15494 era GTPase Era; Provisional	Back alignment and domain information

>cd01898 Obg Obg subfamily	Back alignment and domain information

>cd01868 Rab11_like Rab11-like	Back alignment and domain information

>cd00154 Rab Rab family	Back alignment and domain information

>cd01861 Rab6 Rab6 subfamily	Back alignment and domain information

>cd04171 SelB SelB subfamily	Back alignment and domain information

>PRK12298 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>KOG2486 consensus Predicted GTPase [General function prediction only]	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>cd01866 Rab2 Rab2 subfamily	Back alignment and domain information

>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2	Back alignment and domain information

>TIGR02528 EutP ethanolamine utilization protein, EutP	Back alignment and domain information

>PRK15467 ethanolamine utilization protein EutP; Provisional	Back alignment and domain information

>cd04159 Arl10_like Arl10-like subfamily	Back alignment and domain information

>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria	Back alignment and domain information

>cd00881 GTP_translation_factor GTP translation factor family	Back alignment and domain information

>cd04142 RRP22 RRP22 subfamily	Back alignment and domain information

>cd04112 Rab26 Rab26 subfamily	Back alignment and domain information

>cd01863 Rab18 Rab18 subfamily	Back alignment and domain information

>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily	Back alignment and domain information

>PRK12299 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>TIGR02729 Obg_CgtA Obg family GTPase CgtA	Back alignment and domain information

>cd04114 Rab30 Rab30 subfamily	Back alignment and domain information

>cd01865 Rab3 Rab3 subfamily	Back alignment and domain information

>TIGR00231 small_GTP small GTP-binding protein domain	Back alignment and domain information

>cd01850 CDC_Septin CDC/Septin	Back alignment and domain information

>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains	Back alignment and domain information

>cd04123 Rab21 Rab21 subfamily	Back alignment and domain information

>PRK12297 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2	Back alignment and domain information

>cd04119 RJL RJL (RabJ-Like) subfamily	Back alignment and domain information

>cd01862 Rab7 Rab7 subfamily	Back alignment and domain information

>smart00175 RAB Rab subfamily of small GTPases	Back alignment and domain information

>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily	Back alignment and domain information

>COG3596 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence	Back alignment and domain information

>cd01864 Rab19 Rab19 subfamily	Back alignment and domain information

>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily	Back alignment and domain information

>cd01860 Rab5_related Rab5-related subfamily	Back alignment and domain information

>cd04106 Rab23_lke Rab23-like subfamily	Back alignment and domain information

>cd04113 Rab4 Rab4 subfamily	Back alignment and domain information

>cd04156 ARLTS1 ARLTS1 subfamily	Back alignment and domain information

>cd04118 Rab24 Rab24 subfamily	Back alignment and domain information

>PRK09554 feoB ferrous iron transport protein B; Reviewed	Back alignment and domain information

>PRK12296 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily	Back alignment and domain information

>cd04157 Arl6 Arl6 subfamily	Back alignment and domain information

>cd04139 RalA_RalB RalA/RalB subfamily	Back alignment and domain information

>cd04165 GTPBP1_like GTPBP1-like	Back alignment and domain information

>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily	Back alignment and domain information

>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1	Back alignment and domain information

>cd01858 NGP_1 NGP-1	Back alignment and domain information

>cd00876 Ras Ras family	Back alignment and domain information

>cd04122 Rab14 Rab14 subfamily	Back alignment and domain information

>smart00173 RAS Ras subfamily of RAS small GTPases	Back alignment and domain information

>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily	Back alignment and domain information

>cd00882 Ras_like_GTPase Ras-like GTPase superfamily	Back alignment and domain information

>cd04127 Rab27A Rab27a subfamily	Back alignment and domain information

>cd04136 Rap_like Rap-like subfamily	Back alignment and domain information

>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases	Back alignment and domain information

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily	Back alignment and domain information

>cd01884 EF_Tu EF-Tu subfamily	Back alignment and domain information

>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site	Back alignment and domain information

>cd01890 LepA LepA subfamily	Back alignment and domain information

>CHL00071 tufA elongation factor Tu	Back alignment and domain information

>cd04111 Rab39 Rab39 subfamily	Back alignment and domain information

>cd04154 Arl2 Arl2 subfamily	Back alignment and domain information

>cd04169 RF3 RF3 subfamily	Back alignment and domain information

>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily	Back alignment and domain information

>CHL00189 infB translation initiation factor 2; Provisional	Back alignment and domain information

>cd01893 Miro1 Miro1 subfamily	Back alignment and domain information

>PRK05306 infB translation initiation factor IF-2; Validated	Back alignment and domain information

>cd04160 Arfrp1 Arfrp1 subfamily	Back alignment and domain information

>cd04124 RabL2 RabL2 subfamily	Back alignment and domain information

>cd00879 Sar1 Sar1 subfamily	Back alignment and domain information

>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily	Back alignment and domain information

>cd01849 YlqF_related_GTPase YlqF-related GTPases	Back alignment and domain information

>cd04101 RabL4 RabL4 (Rab-like4) subfamily	Back alignment and domain information

>cd04147 Ras_dva Ras-dva subfamily	Back alignment and domain information

>cd04125 RabA_like RabA-like subfamily	Back alignment and domain information

>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases	Back alignment and domain information

>TIGR00487 IF-2 translation initiation factor IF-2	Back alignment and domain information

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily	Back alignment and domain information

>cd01892 Miro2 Miro2 subfamily	Back alignment and domain information

>cd01889 SelB_euk SelB subfamily	Back alignment and domain information

>cd04175 Rap1 Rap1 subgroup	Back alignment and domain information

>cd04116 Rab9 Rab9 subfamily	Back alignment and domain information

>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily	Back alignment and domain information

>cd04166 CysN_ATPS CysN_ATPS subfamily	Back alignment and domain information

>cd04110 Rab35 Rab35 subfamily	Back alignment and domain information

>cd04168 TetM_like Tet(M)-like subfamily	Back alignment and domain information

>TIGR00475 selB selenocysteine-specific elongation factor SelB	Back alignment and domain information

>cd01855 YqeH YqeH	Back alignment and domain information

>COG2262 HflX GTPases [General function prediction only]	Back alignment and domain information

>cd04151 Arl1 Arl1 subfamily	Back alignment and domain information

>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2)	Back alignment and domain information

>PRK04004 translation initiation factor IF-2; Validated	Back alignment and domain information

>cd04176 Rap2 Rap2 subgroup	Back alignment and domain information

>cd00157 Rho Rho (Ras homology) family	Back alignment and domain information

>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily	Back alignment and domain information

>cd04155 Arl3 Arl3 subfamily	Back alignment and domain information

>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily	Back alignment and domain information

>PLN03118 Rab family protein; Provisional	Back alignment and domain information

>cd04178 Nucleostemin_like Nucleostemin-like	Back alignment and domain information

>PLN03110 Rab GTPase; Provisional	Back alignment and domain information

>cd04140 ARHI_like ARHI subfamily	Back alignment and domain information

>cd04109 Rab28 Rab28 subfamily	Back alignment and domain information

>cd04177 RSR1 RSR1 subgroup	Back alignment and domain information

>cd01882 BMS1 Bms1	Back alignment and domain information

>cd01886 EF-G Elongation factor G (EF-G) subfamily	Back alignment and domain information

>cd01857 HSR1_MMR1 HSR1/MMR1	Back alignment and domain information

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily	Back alignment and domain information

>PLN03127 Elongation factor Tu; Provisional	Back alignment and domain information

>cd04148 RGK RGK subfamily	Back alignment and domain information

>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily	Back alignment and domain information

>TIGR00437 feoB ferrous iron transporter FeoB	Back alignment and domain information

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily	Back alignment and domain information

>cd01870 RhoA_like RhoA-like subfamily	Back alignment and domain information

>cd04120 Rab12 Rab12 subfamily	Back alignment and domain information

>cd04144 Ras2 Ras2 subfamily	Back alignment and domain information

>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily	Back alignment and domain information

>cd04117 Rab15 Rab15 subfamily	Back alignment and domain information

>PRK00007 elongation factor G; Reviewed	Back alignment and domain information

>PLN03108 Rab family protein; Provisional	Back alignment and domain information

>cd04149 Arf6 Arf6 subfamily	Back alignment and domain information

>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms]	Back alignment and domain information

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases	Back alignment and domain information

>cd04132 Rho4_like Rho4-like subfamily	Back alignment and domain information

>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF	Back alignment and domain information

>cd04167 Snu114p Snu114p subfamily	Back alignment and domain information

>PTZ00369 Ras-like protein; Provisional	Back alignment and domain information

>cd04135 Tc10 TC10 subfamily	Back alignment and domain information

>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional	Back alignment and domain information

>cd04143 Rhes_like Rhes_like subfamily	Back alignment and domain information

>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain	Back alignment and domain information

>TIGR02034 CysN sulfate adenylyltransferase, large subunit	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>PRK09563 rbgA GTPase YlqF; Reviewed	Back alignment and domain information

>PTZ00258 GTP-binding protein; Provisional	Back alignment and domain information

>cd04102 RabL3 RabL3 (Rab-like3) subfamily	Back alignment and domain information

>PRK12735 elongation factor Tu; Reviewed	Back alignment and domain information

>PLN03126 Elongation factor Tu; Provisional	Back alignment and domain information

>PRK12317 elongation factor 1-alpha; Reviewed	Back alignment and domain information

>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor	Back alignment and domain information

>PRK12736 elongation factor Tu; Reviewed	Back alignment and domain information

>TIGR00484 EF-G translation elongation factor EF-G	Back alignment and domain information

>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional	Back alignment and domain information

>PRK00049 elongation factor Tu; Reviewed	Back alignment and domain information

>cd01885 EF2 EF2 (for archaea and eukarya)	Back alignment and domain information

>PRK12739 elongation factor G; Reviewed	Back alignment and domain information

>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily	Back alignment and domain information

>PLN00223 ADP-ribosylation factor; Provisional	Back alignment and domain information

>cd04128 Spg1 Spg1p	Back alignment and domain information

>PLN03071 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>COG1161 Predicted GTPases [General function prediction only]	Back alignment and domain information

>TIGR00485 EF-Tu translation elongation factor TU	Back alignment and domain information

>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta)	Back alignment and domain information

>PRK09602 translation-associated GTPase; Reviewed	Back alignment and domain information

>cd01900 YchF YchF subfamily	Back alignment and domain information

>TIGR00157 ribosome small subunit-dependent GTPase A	Back alignment and domain information

>KOG2203 consensus GTP-binding protein [General function prediction only]	Back alignment and domain information

>cd01856 YlqF YlqF	Back alignment and domain information

>cd04130 Wrch_1 Wrch-1 subfamily	Back alignment and domain information

>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins	Back alignment and domain information

>PRK12289 GTPase RsgA; Reviewed	Back alignment and domain information

>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma	Back alignment and domain information

>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA	Back alignment and domain information

>PRK10218 GTP-binding protein; Provisional	Back alignment and domain information

>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00490 aEF-2 translation elongation factor aEF-2	Back alignment and domain information

>PRK00741 prfC peptide chain release factor 3; Provisional	Back alignment and domain information

>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily	Back alignment and domain information

>PRK12288 GTPase RsgA; Reviewed	Back alignment and domain information

>cd01899 Ygr210 Ygr210 subfamily	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only]	Back alignment and domain information

>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH	Back alignment and domain information

>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis	Back alignment and domain information

>PRK09601 GTP-binding protein YchF; Reviewed	Back alignment and domain information

>PRK04000 translation initiation factor IF-2 subunit gamma; Validated	Back alignment and domain information

>PRK00098 GTPase RsgA; Reviewed	Back alignment and domain information

>TIGR01393 lepA GTP-binding protein LepA	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>PLN00116 translation elongation factor EF-2 subunit; Provisional	Back alignment and domain information

>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []	Back alignment and domain information

>PRK13351 elongation factor G; Reviewed	Back alignment and domain information

>PRK13796 GTPase YqeH; Provisional	Back alignment and domain information

>COG1163 DRG Predicted GTPase [General function prediction only]	Back alignment and domain information

>PTZ00416 elongation factor 2; Provisional	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd01854 YjeQ_engC YjeQ/EngC	Back alignment and domain information

>TIGR00503 prfC peptide chain release factor 3	Back alignment and domain information

>KOG0410 consensus Predicted GTP binding protein [General function prediction only]	Back alignment and domain information

>KOG0446 consensus Vacuolar sorting protein VPS1, dynamin, and related proteins [Intracellular trafficking, secretion, and vesicular transport; General function prediction only]	Back alignment and domain information

>PRK07560 elongation factor EF-2; Reviewed	Back alignment and domain information

>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2	Back alignment and domain information

>cd04158 ARD1 ARD1 subfamily	Back alignment and domain information

>cd04134 Rho3 Rho3 subfamily	Back alignment and domain information

>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>TIGR03263 guanyl_kin guanylate kinase	Back alignment and domain information

>cd01859 MJ1464 MJ1464	Back alignment and domain information

>cd04103 Centaurin_gamma Centaurin gamma	Back alignment and domain information

>PF05879 RHD3: Root hair defective 3 GTP-binding protein (RHD3); InterPro: IPR008803 This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins	Back alignment and domain information

>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems	Back alignment and domain information

>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha	Back alignment and domain information

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A	Back alignment and domain information

>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd01874 Cdc42 Cdc42 subfamily	Back alignment and domain information

>cd04150 Arf1_5_like Arf1-Arf5-like subfamily	Back alignment and domain information

>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>PRK05433 GTP-binding protein LepA; Provisional	Back alignment and domain information

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit	Back alignment and domain information

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>cd04131 Rnd Rnd subfamily	Back alignment and domain information

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)	Back alignment and domain information

>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional	Back alignment and domain information

>cd04121 Rab40 Rab40 subfamily	Back alignment and domain information

>PTZ00141 elongation factor 1- alpha; Provisional	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids	Back alignment and domain information

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds	Back alignment and domain information

>PRK00300 gmk guanylate kinase; Provisional	Back alignment and domain information

>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids	Back alignment and domain information

>COG2229 Predicted GTPase [General function prediction only]	Back alignment and domain information

>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake	Back alignment and domain information

>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms]	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity	Back alignment and domain information

>TIGR02673 FtsE cell division ATP-binding protein FtsE	Back alignment and domain information

>PF13521 AAA_28: AAA domain; PDB: 1LW7_A	Back alignment and domain information

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PTZ00133 ADP-ribosylation factor; Provisional	Back alignment and domain information

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily	Back alignment and domain information

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein	Back alignment and domain information

>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively	Back alignment and domain information

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>cd04126 Rab20 Rab20 subfamily	Back alignment and domain information

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup	Back alignment and domain information

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>cd01871 Rac1_like Rac1-like subfamily	Back alignment and domain information

>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function	Back alignment and domain information

>cd04129 Rho2 Rho2 subfamily	Back alignment and domain information

>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional	Back alignment and domain information

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane	Back alignment and domain information

>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1)	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>PRK13540 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional	Back alignment and domain information

>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively	Back alignment and domain information

>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein	Back alignment and domain information

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport	Back alignment and domain information

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1	Back alignment and domain information

>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine	Back alignment and domain information

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter	Back alignment and domain information

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group	Back alignment and domain information

>PRK11124 artP arginine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain	Back alignment and domain information

>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)	Back alignment and domain information

>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP	Back alignment and domain information

>PRK13651 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters	Back alignment and domain information

>COG0536 Obg Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor	Back alignment and domain information

>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance	Back alignment and domain information

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters	Back alignment and domain information

>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria	Back alignment and domain information

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein	Back alignment and domain information

>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient	Back alignment and domain information

>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component	Back alignment and domain information

>TIGR01978 sufC FeS assembly ATPase SufC	Back alignment and domain information

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D	Back alignment and domain information

>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK	Back alignment and domain information

>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE	Back alignment and domain information

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional	Back alignment and domain information

>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein	Back alignment and domain information

>CHL00131 ycf16 sulfate ABC transporter protein; Validated	Back alignment and domain information

>PRK13539 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D	Back alignment and domain information

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C	Back alignment and domain information

>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd01875 RhoG RhoG subfamily	Back alignment and domain information

>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit	Back alignment and domain information

>PRK13538 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK10908 cell division protein FtsE; Provisional	Back alignment and domain information

>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E	Back alignment and domain information

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB	Back alignment and domain information

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export	Back alignment and domain information

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea	Back alignment and domain information

>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1	Back alignment and domain information

>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional	Back alignment and domain information

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import	Back alignment and domain information

>COG3910 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PRK13633 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA	Back alignment and domain information

>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit	Back alignment and domain information

>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD	Back alignment and domain information

>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE	Back alignment and domain information

>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C	Back alignment and domain information

>PRK14738 gmk guanylate kinase; Provisional	Back alignment and domain information

>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed	Back alignment and domain information

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor	Back alignment and domain information

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14737 gmk guanylate kinase; Provisional	Back alignment and domain information

>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional	Back alignment and domain information

>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional	Back alignment and domain information

>COG1162 Predicted GTPases [General function prediction only]	Back alignment and domain information

>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules	Back alignment and domain information

>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional	Back alignment and domain information

>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03348 VI_IcmF type VI secretion protein IcmF	Back alignment and domain information

>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family	Back alignment and domain information

>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03290 ABCC_SUR1_N The SUR domain 1	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional	Back alignment and domain information

>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK15056 manganese/iron transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd04133 Rop_like Rop subfamily	Back alignment and domain information

>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A	Back alignment and domain information

>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>PRK10078 ribose 1,5-bisphosphokinase; Provisional	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)	Back alignment and domain information

>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd03288 ABCC_SUR2 The SUR domain 2	Back alignment and domain information

>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional	Back alignment and domain information

>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains	Back alignment and domain information

>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI	Back alignment and domain information

>PRK12740 elongation factor G; Reviewed	Back alignment and domain information

>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake	Back alignment and domain information

>PTZ00132 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only]	Back alignment and domain information

>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD	Back alignment and domain information

>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein	Back alignment and domain information

>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10851 sulfate/thiosulfate transporter subunit; Provisional	Back alignment and domain information

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional	Back alignment and domain information

>PRK14240 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PRK03695 vitamin B12-transporter ATPase; Provisional	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG2484 consensus GTPase [General function prediction only]	Back alignment and domain information

>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03299 ABC_ModC_like Archeal protein closely related to ModC	Back alignment and domain information

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14239 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors	Back alignment and domain information

>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14241 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11144 modC molybdate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PLN00023 GTP-binding protein; Provisional	Back alignment and domain information

>TIGR00235 udk uridine kinase	Back alignment and domain information

>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2	Back alignment and domain information

>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional	Back alignment and domain information

>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms	Back alignment and domain information

Homologous Structure Templates