Citrus Sinensis ID: 004243

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760------
MDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRAAVLMDDQKEVEAVEELSKAIAFKPDLQMLHLRAAFYESIGDLTSAIRDSQAALCLDPNHMETLDLYNRARDQASHQQK
cccccccccccHHHHccccccccccccccccccccccccccccHHHHcccccccccEEEEEcccEEEcHHHHHHHcccHHHHHHccccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccc
ccccccEEEccHHHccccccccccccccccccccccccccccccccccccccccccEEEEEcccEEEEEHHHHHHccHHHHHHHccccHHccccEEEcccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHccHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHcccEEEEHHHHHHHHHHHHHHHHcccEEEEHHHHHHHHccccHHHHHHHHHHHHHHccccccHEEHHHHcccccHHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEcccccHHHHHHHHHHHHHHccHcHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHcHEEEEcEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccHHHcccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccHHHHHHHHHHHHccccccccccEEEEEEEccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHEcccccHHHHHHHHHHHHHccHccc
mdccgfilecpkaalisgcdpnstydhckcfeenaksnlgpiVEKFVCLsleeddsvtfcvrdkEISFVRNKiaslsspfkamlyggfveskrktidfshdgvsveGLRAVEVYTrtsrvdlfcPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRelpsslynpkvMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIIsehkptgwmyqerslynlgrekivdlnyaseldptlsfpyKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHvrswspadcwiklydrwssvddigSLAVINQMlindpgksFLRFRQSLLLLRLNCQKAAMRCLRLArnhssseherlVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILadtnldpesSTYVIQLLEEALrcpsdglrkgqaLNNLGSIYVEcgkldqaencyinaldikhtrAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDlnmatqldplrtypyrYRAAVLMDDQKEVEAVEELSKAIAFKPDLQMLHLRAAFYESIGDLTSAIRDSQaalcldpnhmetLDLYNRARDQASHQQK
MDCCGFILECPKAALISGCDPNSTYDHCKCFEenaksnlgpIVEKFVCLSLEEDDSVTFCvrdkeisfvrnkiaslsspfkAMLYGGFVESKRKTidfshdgvsvegLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRelpsslynpKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNyaseldptlsFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLarnhssseherlVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNdlnmatqldplrtYPYRYRAAVLMDDQKEVEAVEELSKAIAFKPDLQMLHLRAAFYESIGDLTSAIRDSQAALCLDPNHMETLDLYNRARDQASHQQK
MDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKsflrfrqsllllrlNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRAAVLMDDQKEVEAVEELSKAIAFKPDLQMLHLRAAFYESIGDLTSAIRDSQAALCLDPNHMETLDLYNRARDQASHQQK
**CCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLE*****************************QLDPLRTYPYRYRAAVLMDDQKEVEAVEELSKAIAFKPDLQMLHLRAAFYESIGDLTSAIRDSQAALCLDPNHMETLDL*************
***CGFILECPKAALISGCDPNSTYDH************************EEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRAAVLMDDQKEVEAVEELSKAIAFKPDLQMLHLRAAFYESIGDLTSAIRDSQAALCLDPNHMETLDLYNRA*********
MDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQY*************REMAKNDLNMATQLDPLRTYPYRYRAAVLMDDQKEVEAVEELSKAIAFKPDLQMLHLRAAFYESIGDLTSAIRDSQAALCLDPNHMETLDLYNRA*********
*DCCGFILECPKAALISGCDPNSTYDHCKCFE********************EDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRAAVLMDDQKEVEAVEELSKAIAFKPDLQMLHLRAAFYESIGDLTSAIRDSQAALCLDPNHMETLDLYNRARD*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLxxxxxxxxxxxxxxxxxxxxxASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRAAVLMDDQKEVEAVEELSKAIAFKPDLQMLHLRAAFYESIGDLTSAIRDSQAALCLDPNHMETLDLYNRARDQASHQQK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query766 2.2.26 [Sep-21-2011]
O65020951 Ethylene-overproduction p yes no 0.986 0.794 0.685 0.0
Q9LV01925 ETO1-like protein 2 OS=Ar no no 0.994 0.823 0.607 0.0
Q9ZQX6888 ETO1-like protein 1 OS=Ar no no 0.915 0.789 0.556 0.0
Q9M8Y0 977 Probable UDP-N-acetylgluc no no 0.210 0.164 0.275 7e-06
O18158 1151 UDP-N-acetylglucosamine-- no no 0.272 0.181 0.259 4e-05
>sp|O65020|ETO1_ARATH Ethylene-overproduction protein 1 OS=Arabidopsis thaliana GN=ETO1 PE=1 SV=2 Back     alignment and function desciption
 Score = 1094 bits (2830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/759 (68%), Positives = 636/759 (83%), Gaps = 3/759 (0%)

Query: 1   MDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFC 60
           MDCCG  LECPKA L+SG DP S YD C C   +  S    + E     S E D  ++FC
Sbjct: 191 MDCCGRNLECPKATLVSGYDPESVYDPCVC---SGASRSEMMNEDECSTSQEVDYDMSFC 247

Query: 61  VRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRV 120
           + D+E+  VR KIASLS PFKAMLYGGF E KR TI+F+ +G+SVEG+RA E+++RT+R+
Sbjct: 248 IGDEEVRCVRYKIASLSRPFKAMLYGGFREMKRATINFTQNGISVEGMRAAEIFSRTNRL 307

Query: 121 DLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASC 180
           D F P +VLELL  ANRFCC+E+KSACD+HLA LV  +++A++LI+YGLEE A LLVA+C
Sbjct: 308 DNFPPNVVLELLKLANRFCCDELKSACDSHLAHLVNSLDEAMLLIEYGLEEAAYLLVAAC 367

Query: 181 LQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVM 240
           LQV LRELPSS++NP V+KIFCS+E  ERLA++GHASF LY+FLSQ+AME D  SNTTVM
Sbjct: 368 LQVFLRELPSSMHNPNVIKIFCSAEGRERLASLGHASFTLYFFLSQIAMEDDMKSNTTVM 427

Query: 241 LLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYK 300
           LLERL EC+ + W++ LA HQLG VM ER+EYKDA  +F AA +AGH+YSL G+AR K+K
Sbjct: 428 LLERLVECAVDSWEKQLAYHQLGVVMLERKEYKDAQRWFNAAVEAGHLYSLVGVARTKFK 487

Query: 301 VGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAV 360
              +YSAYK+INS+IS+HK TGWM+QERSLY  G+EK++DL+ A+E DPTL+FPYK+RAV
Sbjct: 488 RDHRYSAYKIINSLISDHKATGWMHQERSLYCSGKEKLLDLDTATEFDPTLTFPYKFRAV 547

Query: 361 AKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMM 420
           A +EE Q  AAI+E+++I+ FK S DCLE+RAW+ I  +DYE AL+D  ALL LE N+MM
Sbjct: 548 ALVEENQFGAAIAELNKILGFKASPDCLEMRAWISIGMEDYEGALKDIRALLTLEPNFMM 607

Query: 421 FHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLR 480
           F+ ++ GDH+V+LL    + WS ADCW++LYDRWSSVDDIGSLAV++ ML NDPGKS LR
Sbjct: 608 FNWKIHGDHMVELLRPLAQQWSQADCWMQLYDRWSSVDDIGSLAVVHHMLANDPGKSLLR 667

Query: 481 FRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISI 540
           FRQSLLLLRLNCQKAAMR LRLARNHS SEHERLVYEGWILYDTGHREEAL++AE+SISI
Sbjct: 668 FRQSLLLLRLNCQKAAMRSLRLARNHSKSEHERLVYEGWILYDTGHREEALAKAEESISI 727

Query: 541 ERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGK 600
           +R+FEAFFLKAY LAD+ LDP+SS YVIQLL+EAL+CPSDGLRKGQALNNLGS+YV+C K
Sbjct: 728 QRSFEAFFLKAYALADSTLDPDSSNYVIQLLQEALKCPSDGLRKGQALNNLGSVYVDCEK 787

Query: 601 LDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEY 660
           LD A +CY NAL IKHTRAHQGLARVY+LKN+ KAAYDEMTKL+EKAQ +ASA+EKRSEY
Sbjct: 788 LDLAADCYTNALTIKHTRAHQGLARVYHLKNQRKAAYDEMTKLIEKAQNNASAYEKRSEY 847

Query: 661 SDREMAKNDLNMATQLDPLRTYPYRYRAAVLMDDQKEVEAVEELSKAIAFKPDLQMLHLR 720
            DREMA++DL +ATQLDPLRTYPYRYRAAVLMDD KE EA++ELS+AI+FKPDLQ+LHLR
Sbjct: 848 CDREMAQSDLCLATQLDPLRTYPYRYRAAVLMDDHKESEAIDELSRAISFKPDLQLLHLR 907

Query: 721 AAFYESIGDLTSAIRDSQAALCLDPNHMETLDLYNRARD 759
           AAFY+S+G+  SAI+D +AALC+DP H +TL+LY++AR+
Sbjct: 908 AAFYDSMGEGASAIKDCEAALCIDPGHADTLELYHKARE 946
Essential regulator of the ethylene pathway, which acts by regulating the stability of 1-aminocyclopropane-1-carboxylate synthase (ACS) enzymes. May act as a substrate-specific adapter that connects ACS enzymes, such as ACS5, to ubiquitin ligase complexes, leading to proteasomal degradation of ACS enzymes.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LV01|ETOL2_ARATH ETO1-like protein 2 OS=Arabidopsis thaliana GN=EOL2 PE=1 SV=2 Back     alignment and function description
>sp|Q9ZQX6|ETOL1_ARATH ETO1-like protein 1 OS=Arabidopsis thaliana GN=EOL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 Back     alignment and function description
>sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query766
224105907 896 predicted protein [Populus trichocarpa] 0.972 0.831 0.760 0.0
225434510 927 PREDICTED: ethylene-overproduction prote 1.0 0.826 0.749 0.0
255560353 911 Ethylene-overproduction protein, putativ 0.997 0.838 0.732 0.0
356566016 902 PREDICTED: ethylene-overproduction prote 0.980 0.832 0.707 0.0
356553104 955 PREDICTED: ethylene-overproduction prote 0.988 0.792 0.697 0.0
356541801 895 PREDICTED: ethylene-overproduction prote 0.983 0.841 0.705 0.0
356500888 937 PREDICTED: ethylene-overproduction prote 0.985 0.805 0.703 0.0
225439486 951 PREDICTED: ethylene-overproduction prote 1.0 0.805 0.694 0.0
3068704 958 unknown [Arabidopsis thaliana] 0.986 0.789 0.685 0.0
297819878 947 ethylene-overproduction protein 1 [Arabi 0.985 0.797 0.680 0.0
>gi|224105907|ref|XP_002313975.1| predicted protein [Populus trichocarpa] gi|222850383|gb|EEE87930.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1205 bits (3118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/761 (76%), Positives = 663/761 (87%), Gaps = 16/761 (2%)

Query: 2   DCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCV 61
           DC G+ILECP AAL+SGCDPNS YDHC+C ++N                LE D  V+FC+
Sbjct: 149 DCSGYILECPMAALVSGCDPNSIYDHCQCGQDN----------------LEADSDVSFCI 192

Query: 62  RDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVD 121
            D+ +  VR KIASLSSPFKAMLYG FVES+R  IDFS  G+SV+G+RAV+VY+RT RVD
Sbjct: 193 GDELVHCVRFKIASLSSPFKAMLYGSFVESRRDKIDFSKIGISVKGMRAVQVYSRTGRVD 252

Query: 122 LFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCL 181
           LFCP IVLELLSFANRFCCEE+K ACDAHLASLV   EDALILID+GLEERA LLVASCL
Sbjct: 253 LFCPEIVLELLSFANRFCCEELKCACDAHLASLVCGTEDALILIDHGLEERANLLVASCL 312

Query: 182 QVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVML 241
           QV LRELP+SLYN KVM +FC+SEA ERLA +GHASFLLYYFLSQVAME++  SN  VML
Sbjct: 313 QVFLRELPNSLYNHKVMSVFCNSEARERLAMLGHASFLLYYFLSQVAMEENVASNAAVML 372

Query: 242 LERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKV 301
           LE L E +TE+WQ+ LALHQLGCVM ER+EYK A +YFEAA +AGH+YSLAG+AR KYK 
Sbjct: 373 LEGLEEFATEKWQKALALHQLGCVMLERKEYKGAQFYFEAAVEAGHVYSLAGVARTKYKQ 432

Query: 302 GQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVA 361
           GQQYSA++L+NS+I +HKP GWMYQERSLY +G+EKI+D+N A+ELDPTLSFPYK+RAV 
Sbjct: 433 GQQYSAFRLMNSLIFKHKPVGWMYQERSLYGVGQEKIMDMNTATELDPTLSFPYKFRAVM 492

Query: 362 KMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMF 421
           K+EE QIRAAI+EID+II FKLS DCLELRAW FIA +D+ESALRD  ALL LE  YMMF
Sbjct: 493 KVEEKQIRAAITEIDKIIGFKLSPDCLELRAWFFIALEDFESALRDIRALLTLEPKYMMF 552

Query: 422 HGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRF 481
           HGRVSGDHLV+LL+H +R W+ ADCW++LY+RWSSVDDIGSLAV++QML NDP KS L F
Sbjct: 553 HGRVSGDHLVELLSHRIRLWNLADCWMQLYERWSSVDDIGSLAVLHQMLSNDPAKSLLWF 612

Query: 482 RQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIE 541
           RQSLLLLRLNCQKAAMRCLRLARNH+SS HERL+YEGW+L+D+GHREEALSRAEKSISI+
Sbjct: 613 RQSLLLLRLNCQKAAMRCLRLARNHTSSVHERLIYEGWLLFDSGHREEALSRAEKSISIQ 672

Query: 542 RTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKL 601
           R+FEAFFL AY LADTNLDPESS+ VIQLLEEALRCPSDGLRKGQALNNLGSIYV+CGKL
Sbjct: 673 RSFEAFFLMAYTLADTNLDPESSSTVIQLLEEALRCPSDGLRKGQALNNLGSIYVDCGKL 732

Query: 602 DQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYS 661
           DQA +CY+NAL+IKHTRAHQGLARVY+LKN+ KAA+DEMTKL+EKA  SASA+EKRSEY 
Sbjct: 733 DQAADCYMNALNIKHTRAHQGLARVYHLKNQRKAAFDEMTKLIEKAHSSASAYEKRSEYC 792

Query: 662 DREMAKNDLNMATQLDPLRTYPYRYRAAVLMDDQKEVEAVEELSKAIAFKPDLQMLHLRA 721
           DRE AK+DLNMATQLDPLRTYPYRYRAAVLMDDQKE EA+EEL+KAIAFKP+LQMLHLRA
Sbjct: 793 DREKAKDDLNMATQLDPLRTYPYRYRAAVLMDDQKETEALEELTKAIAFKPELQMLHLRA 852

Query: 722 AFYESIGDLTSAIRDSQAALCLDPNHMETLDLYNRARDQAS 762
           AFYES+GD TSA +D +AALCLD NH +TL+LYNR +DQA+
Sbjct: 853 AFYESMGDKTSARQDCEAALCLDQNHTDTLNLYNRTQDQAT 893

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225434510|ref|XP_002278414.1| PREDICTED: ethylene-overproduction protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255560353|ref|XP_002521192.1| Ethylene-overproduction protein, putative [Ricinus communis] gi|223539606|gb|EEF41192.1| Ethylene-overproduction protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356566016|ref|XP_003551231.1| PREDICTED: ethylene-overproduction protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356553104|ref|XP_003544898.1| PREDICTED: ethylene-overproduction protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356541801|ref|XP_003539361.1| PREDICTED: ethylene-overproduction protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356500888|ref|XP_003519262.1| PREDICTED: ethylene-overproduction protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|225439486|ref|XP_002269998.1| PREDICTED: ethylene-overproduction protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|3068704|gb|AAC14404.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297819878|ref|XP_002877822.1| ethylene-overproduction protein 1 [Arabidopsis lyrata subsp. lyrata] gi|297323660|gb|EFH54081.1| ethylene-overproduction protein 1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query766
TAIR|locus:2074343959 ETO1 "ETHYLENE OVERPRODUCER 1" 0.986 0.788 0.667 7.3e-281
TAIR|locus:2132402888 EOL1 "ETO1-like 1" [Arabidopsi 0.921 0.795 0.536 1.1e-199
WB|WBGene00003858 1151 ogt-1 [Caenorhabditis elegans 0.271 0.180 0.261 2.8e-06
UNIPROTKB|O18158 1151 ogt-1 "UDP-N-acetylglucosamine 0.271 0.180 0.261 2.8e-06
GENEDB_PFALCIPARUM|PF14_0324564 PF14_0324 "hypothetical protei 0.305 0.414 0.246 6e-06
UNIPROTKB|Q8ILC1564 PF14_0324 "STI1-like protein" 0.305 0.414 0.246 6e-06
UNIPROTKB|Q5ZK91833 CDC27 "Uncharacterized protein 0.202 0.186 0.271 0.00011
UNIPROTKB|G5EA36823 CDC27 "Cell division cycle 27, 0.202 0.188 0.271 0.00017
UNIPROTKB|P30260824 CDC27 "Cell division cycle pro 0.202 0.188 0.271 0.00017
RGD|1304921824 Cdc27 "cell division cycle 27" 0.202 0.188 0.271 0.00017
TAIR|locus:2074343 ETO1 "ETHYLENE OVERPRODUCER 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2699 (955.2 bits), Expect = 7.3e-281, P = 7.3e-281
 Identities = 507/759 (66%), Positives = 623/759 (82%)

Query:     1 MDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFC 60
             MDCCG  LECPKA L+SG DP S YD C C   +  S    + E     S E D  ++FC
Sbjct:   199 MDCCGRNLECPKATLVSGYDPESVYDPCVC---SGASRSEMMNEDECSTSQEVDYDMSFC 255

Query:    61 VRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRV 120
             + D+E+  VR KIASLS PFKAMLYGGF E KR TI+F+ +G+SVEG+RA E+++RT+R+
Sbjct:   256 IGDEEVRCVRYKIASLSRPFKAMLYGGFREMKRATINFTQNGISVEGMRAAEIFSRTNRL 315

Query:   121 DLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASC 180
             D F P +VLELL  ANRFCC+E+KSACD+HLA LV  +++A++LI+YGLEE A LLVA+C
Sbjct:   316 DNFPPNVVLELLKLANRFCCDELKSACDSHLAHLVNSLDEAMLLIEYGLEEAAYLLVAAC 375

Query:   181 LQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVM 240
             LQV LRELPSS++NP V+KIFCS+E  ERLA++GHASF LY+FLSQ+AME D  SNTTVM
Sbjct:   376 LQVFLRELPSSMHNPNVIKIFCSAEGRERLASLGHASFTLYFFLSQIAMEDDMKSNTTVM 435

Query:   241 LLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYK 300
             LLERL EC+ + W++ LA HQLG VM ER+EYKDA  +F AA +AGH+YSL G+AR K+K
Sbjct:   436 LLERLVECAVDSWEKQLAYHQLGVVMLERKEYKDAQRWFNAAVEAGHLYSLVGVARTKFK 495

Query:   301 VGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAV 360
                +YSAYK+INS+IS+HK TGWM+QERSLY  G+EK++DL+ A+E DPTL+FPYK+RAV
Sbjct:   496 RDHRYSAYKIINSLISDHKATGWMHQERSLYCSGKEKLLDLDTATEFDPTLTFPYKFRAV 555

Query:   361 AKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMM 420
             A +EE Q  AAI+E+++I+ FK S DCLE+RAW+ I  +DYE AL+D  ALL LE N+MM
Sbjct:   556 ALVEENQFGAAIAELNKILGFKASPDCLEMRAWISIGMEDYEGALKDIRALLTLEPNFMM 615

Query:   421 FHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKXXXX 480
             F+ ++ GDH+V+LL    + WS ADCW++LYDRWSSVDDIGSLAV++ ML NDPGK    
Sbjct:   616 FNWKIHGDHMVELLRPLAQQWSQADCWMQLYDRWSSVDDIGSLAVVHHMLANDPGKSLLR 675

Query:   481 XXXXXXXXXXNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISI 540
                       NCQKAAMR LRLARNHS SEHERLVYEGWILYDTGHREEAL++AE+SISI
Sbjct:   676 FRQSLLLLRLNCQKAAMRSLRLARNHSKSEHERLVYEGWILYDTGHREEALAKAEESISI 735

Query:   541 ERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGK 600
             +R+FEAFFLKAY LAD+ LDP+SS YVIQLL+EAL+CPSDGLRKGQALNNLGS+YV+C K
Sbjct:   736 QRSFEAFFLKAYALADSTLDPDSSNYVIQLLQEALKCPSDGLRKGQALNNLGSVYVDCEK 795

Query:   601 LDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEY 660
             LD A +CY NAL IKHTRAHQGLARVY+LKN+ KAAYDEMTKL+EKAQ +ASA+EKRSEY
Sbjct:   796 LDLAADCYTNALTIKHTRAHQGLARVYHLKNQRKAAYDEMTKLIEKAQNNASAYEKRSEY 855

Query:   661 SDREMAKNDLNMATQLDPLRTYPYRYRAAVLMDDQKEVEAVEELSKAIAFKPDLQMLHLR 720
              DREMA++DL +ATQLDPLRTYPYRYRAAVLMDD KE EA++ELS+AI+FKPDLQ+LHLR
Sbjct:   856 CDREMAQSDLCLATQLDPLRTYPYRYRAAVLMDDHKESEAIDELSRAISFKPDLQLLHLR 915

Query:   721 AAFYESIGDLTSAIRDSQAALCLDPNHMETLDLYNRARD 759
             AAFY+S+G+  SAI+D +AALC+DP H +TL+LY++AR+
Sbjct:   916 AAFYDSMGEGASAIKDCEAALCIDPGHADTLELYHKARE 954
GO:0005634 "nucleus" evidence=ISM
GO:0009693 "ethylene biosynthetic process" evidence=IMP
GO:0010182 "sugar mediated signaling pathway" evidence=RCA;TAS
GO:0005515 "protein binding" evidence=IPI
GO:0010364 "regulation of ethylene biosynthetic process" evidence=IDA
GO:0030674 "protein binding, bridging" evidence=IPI
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=IPI
GO:0017145 "stem cell division" evidence=IMP
GO:2000069 "regulation of post-embryonic root development" evidence=IMP
GO:0006487 "protein N-linked glycosylation" evidence=RCA
GO:0009755 "hormone-mediated signaling pathway" evidence=RCA
GO:0048825 "cotyledon development" evidence=RCA
GO:0016036 "cellular response to phosphate starvation" evidence=IMP
TAIR|locus:2132402 EOL1 "ETO1-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00003858 ogt-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O18158 ogt-1 "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF14_0324 PF14_0324 "hypothetical protein, conserved" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8ILC1 PF14_0324 "STI1-like protein" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZK91 CDC27 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G5EA36 CDC27 "Cell division cycle 27, isoform CRA_c" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P30260 CDC27 "Cell division cycle protein 27 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1304921 Cdc27 "cell division cycle 27" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O65020ETO1_ARATHNo assigned EC number0.68510.98690.7949yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.IX.2956.1
hypothetical protein (819 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query766
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 3e-08
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-04
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 1e-04
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 5e-04
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 0.001
pfam1341469 pfam13414, TPR_11, TPR repeat 0.001
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.002
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.003
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.003
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.003
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information 
 Score = 51.9 bits (125), Expect = 3e-08
 Identities = 30/98 (30%), Positives = 43/98 (43%), Gaps = 3/98 (3%)

Query: 57  VTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTR 116
           VT  V  K+    +  +A+ S  FKA+    F ES +  I    D VS E  RA+  +  
Sbjct: 2   VTLVVGGKKFHAHKAVLAAHSPYFKALFSSDFKESDKSEIYL--DDVSPEDFRALLNFLY 59

Query: 117 TSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASL 154
           T ++DL     V ELL  A+      +   C+  L  L
Sbjct: 60  TGKLDL-PEENVEELLELADYLQIPGLVELCEEFLLKL 96

Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures. Length = 97
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 766
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 100.0
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.97
KOG0547606 consensus Translocase of outer mitochondrial membr 99.97
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.97
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.96
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.96
PHA02790480 Kelch-like protein; Provisional 99.96
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.96
PHA02713557 hypothetical protein; Provisional 99.96
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.95
KOG0547606 consensus Translocase of outer mitochondrial membr 99.95
KOG4350620 consensus Uncharacterized conserved protein, conta 99.95
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.95
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.94
PHA03098534 kelch-like protein; Provisional 99.94
KOG1126638 consensus DNA-binding cell division cycle control 99.93
PRK14574 822 hmsH outer membrane protein; Provisional 99.93
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.93
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.93
KOG2003 840 consensus TPR repeat-containing protein [General f 99.92
KOG2076895 consensus RNA polymerase III transcription factor 99.91
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.91
KOG1126638 consensus DNA-binding cell division cycle control 99.91
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.91
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
PRK14574 822 hmsH outer membrane protein; Provisional 99.9
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.9
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.89
PRK11788389 tetratricopeptide repeat protein; Provisional 99.89
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.89
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.88
KOG2003840 consensus TPR repeat-containing protein [General f 99.88
PLN03077 857 Protein ECB2; Provisional 99.88
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.88
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.88
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.88
PLN03077 857 Protein ECB2; Provisional 99.87
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.85
KOG2076 895 consensus RNA polymerase III transcription factor 99.85
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.84
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.84
KOG4591280 consensus Uncharacterized conserved protein, conta 99.84
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.84
KOG2075521 consensus Topoisomerase TOP1-interacting protein B 99.83
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.83
PLN03218 1060 maturation of RBCL 1; Provisional 99.83
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.82
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.82
PLN03218 1060 maturation of RBCL 1; Provisional 99.82
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.79
KOG1129478 consensus TPR repeat-containing protein [General f 99.79
PRK11189296 lipoprotein NlpI; Provisional 99.79
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.79
PRK11189296 lipoprotein NlpI; Provisional 99.79
PRK12370553 invasion protein regulator; Provisional 99.78
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.78
PRK12370553 invasion protein regulator; Provisional 99.78
KOG1125579 consensus TPR repeat-containing protein [General f 99.77
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.77
KOG4682488 consensus Uncharacterized conserved protein, conta 99.77
KOG1129478 consensus TPR repeat-containing protein [General f 99.76
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.76
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.76
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.74
KOG1125579 consensus TPR repeat-containing protein [General f 99.74
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.73
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.73
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.72
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.72
KOG07831267 consensus Uncharacterized conserved protein, conta 99.72
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.71
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.69
PLN02789320 farnesyltranstransferase 99.69
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.68
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.67
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.66
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.66
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.66
PLN02789320 farnesyltranstransferase 99.66
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.65
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.64
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.63
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.63
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.54
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.54
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.54
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.53
PRK15359144 type III secretion system chaperone protein SscB; 99.5
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.49
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.48
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.48
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.44
PRK15359144 type III secretion system chaperone protein SscB; 99.44
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.44
PRK10370198 formate-dependent nitrite reductase complex subuni 99.43
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.42
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.42
KOG0553 304 consensus TPR repeat-containing protein [General f 99.41
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.4
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.39
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.37
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.37
PRK10370198 formate-dependent nitrite reductase complex subuni 99.33
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.32
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.31
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.3
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.3
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.29
KOG1128777 consensus Uncharacterized conserved protein, conta 99.27
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.26
PRK04841 903 transcriptional regulator MalT; Provisional 99.26
KOG0553304 consensus TPR repeat-containing protein [General f 99.26
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.25
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.25
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.23
PRK04841903 transcriptional regulator MalT; Provisional 99.21
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.2
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.17
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.16
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.15
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.14
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.13
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.08
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.08
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.07
KOG0511516 consensus Ankyrin repeat protein [General function 99.05
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.03
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.99
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.98
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.98
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.95
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.94
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.93
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.93
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.92
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.86
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.86
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.85
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.82
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.8
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.77
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.77
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.76
KOG4648536 consensus Uncharacterized conserved protein, conta 98.75
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.75
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.75
PRK10803263 tol-pal system protein YbgF; Provisional 98.73
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.73
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.7
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.69
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.69
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.67
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.67
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.67
PRK11906458 transcriptional regulator; Provisional 98.67
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.66
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.65
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.65
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.65
KOG4234271 consensus TPR repeat-containing protein [General f 98.64
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.64
PRK15331165 chaperone protein SicA; Provisional 98.63
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.63
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.63
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.63
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.63
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.6
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.59
KOG07831267 consensus Uncharacterized conserved protein, conta 98.59
PRK11906458 transcriptional regulator; Provisional 98.59
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.59
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.59
COG4700251 Uncharacterized protein conserved in bacteria cont 98.57
KOG4234271 consensus TPR repeat-containing protein [General f 98.54
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.54
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.54
PF1337173 TPR_9: Tetratricopeptide repeat 98.53
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.53
PRK15331165 chaperone protein SicA; Provisional 98.53
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.51
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.51
PRK10803263 tol-pal system protein YbgF; Provisional 98.5
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.48
PF13512142 TPR_18: Tetratricopeptide repeat 98.47
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.46
PF12688120 TPR_5: Tetratrico peptide repeat 98.44
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.43
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.42
PF12688120 TPR_5: Tetratrico peptide repeat 98.41
KOG2838401 consensus Uncharacterized conserved protein, conta 98.4
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.38
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.38
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.37
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.35
PF1337173 TPR_9: Tetratricopeptide repeat 98.32
KOG4555175 consensus TPR repeat-containing protein [Function 98.32
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.31
KOG2716230 consensus Polymerase delta-interacting protein PDI 98.31
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.31
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.27
COG4700251 Uncharacterized protein conserved in bacteria cont 98.26
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.25
PF13512142 TPR_18: Tetratricopeptide repeat 98.25
KOG2471696 consensus TPR repeat-containing protein [General f 98.23
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.23
KOG2471 696 consensus TPR repeat-containing protein [General f 98.19
KOG4555175 consensus TPR repeat-containing protein [Function 98.16
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.13
COG3898531 Uncharacterized membrane-bound protein [Function u 98.12
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 98.11
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.11
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.1
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.09
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.08
KOG1987297 consensus Speckle-type POZ protein SPOP and relate 98.06
KOG2300 629 consensus Uncharacterized conserved protein [Funct 98.02
KOG1586288 consensus Protein required for fusion of vesicles 98.01
KOG3473112 consensus RNA polymerase II transcription elongati 98.0
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.0
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.97
KOG2838401 consensus Uncharacterized conserved protein, conta 97.95
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.93
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.92
PF1343134 TPR_17: Tetratricopeptide repeat 97.84
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.79
PF1342844 TPR_14: Tetratricopeptide repeat 97.77
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.77
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.75
PF1342844 TPR_14: Tetratricopeptide repeat 97.75
KOG1585308 consensus Protein required for fusion of vesicles 97.74
PF1343134 TPR_17: Tetratricopeptide repeat 97.7
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.69
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 97.67
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.66
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.59
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.59
KOG1585308 consensus Protein required for fusion of vesicles 97.58
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.57
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.53
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.53
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.52
KOG1586288 consensus Protein required for fusion of vesicles 97.5
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.5
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.48
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.46
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.45
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.41
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.41
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.41
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.41
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.41
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 97.39
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.38
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.37
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.31
KOG1550552 consensus Extracellular protein SEL-1 and related 97.29
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.29
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.25
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 97.25
KOG1258577 consensus mRNA processing protein [RNA processing 97.24
KOG2610 491 consensus Uncharacterized conserved protein [Funct 97.24
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.19
KOG3364149 consensus Membrane protein involved in organellar 97.15
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.15
PF11822317 DUF3342: Domain of unknown function (DUF3342); Int 97.15
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 97.08
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.06
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.04
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.03
KOG1258 577 consensus mRNA processing protein [RNA processing 97.03
KOG1550552 consensus Extracellular protein SEL-1 and related 97.02
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.0
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.99
KOG0530318 consensus Protein farnesyltransferase, alpha subun 96.96
KOG1778319 consensus CREB binding protein/P300 and related TA 96.89
KOG2714465 consensus SETA binding protein SB1 and related pro 96.85
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.85
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 96.82
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.81
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.79
KOG1724162 consensus SCF ubiquitin ligase, Skp1 component [Po 96.73
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.73
PF07707103 BACK: BTB And C-terminal Kelch; InterPro: IPR01170 96.71
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.7
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 96.62
KOG2041 1189 consensus WD40 repeat protein [General function pr 96.61
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.56
PRK10941269 hypothetical protein; Provisional 96.53
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.51
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.5
KOG0530318 consensus Protein farnesyltransferase, alpha subun 96.44
KOG4507 886 consensus Uncharacterized conserved protein, conta 96.42
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.41
KOG0511516 consensus Ankyrin repeat protein [General function 96.41
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 96.34
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.26
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.24
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.19
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.14
KOG1665302 consensus AFH1-interacting protein FIP2, contains 96.13
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.12
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.08
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.08
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.9
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.9
smart00875101 BACK BTB And C-terminal Kelch. The BACK domain is 95.84
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.77
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.64
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.58
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 95.45
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.39
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.38
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.32
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.29
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.23
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.22
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.18
KOG20411189 consensus WD40 repeat protein [General function pr 94.96
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.91
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.81
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 94.79
KOG3783546 consensus Uncharacterized conserved protein [Funct 94.73
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 94.69
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.62
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.6
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 94.6
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.4
COG4976 287 Predicted methyltransferase (contains TPR repeat) 94.38
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.27
COG5201158 SKP1 SCF ubiquitin ligase, SKP1 component [Posttra 94.23
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 94.17
PRK10941269 hypothetical protein; Provisional 94.08
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 93.94
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 93.93
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 93.8
COG4976287 Predicted methyltransferase (contains TPR repeat) 93.71
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 93.67
KOG2715210 consensus Uncharacterized conserved protein, conta 93.66
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 93.39
KOG3783546 consensus Uncharacterized conserved protein [Funct 93.33
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 93.33
PF0146678 Skp1: Skp1 family, dimerisation domain; InterPro: 93.02
KOG15381081 consensus Uncharacterized conserved protein WDR10, 92.69
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 92.47
KOG3364149 consensus Membrane protein involved in organellar 92.04
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.02
COG4649221 Uncharacterized protein conserved in bacteria [Fun 91.82
COG2912269 Uncharacterized conserved protein [Function unknow 91.64
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 91.45
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.38
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 91.33
KOG1310 758 consensus WD40 repeat protein [General function pr 91.31
COG5191 435 Uncharacterized conserved protein, contains HAT (H 91.23
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.9
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 90.17
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 90.12
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 89.89
KOG3840438 consensus Uncharaterized conserved protein, contai 89.88
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 89.43
KOG1310758 consensus WD40 repeat protein [General function pr 88.93
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 88.8
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 88.32
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 88.29
KOG2422 665 consensus Uncharacterized conserved protein [Funct 88.18
PF1286294 Apc5: Anaphase-promoting complex subunit 5 88.07
COG4941415 Predicted RNA polymerase sigma factor containing a 88.01
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 87.97
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 87.77
KOG2422665 consensus Uncharacterized conserved protein [Funct 87.63
COG5191435 Uncharacterized conserved protein, contains HAT (H 87.34
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 86.96
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 86.74
PF1286294 Apc5: Anaphase-promoting complex subunit 5 86.24
KOG4814 872 consensus Uncharacterized conserved protein [Funct 86.06
COG3629280 DnrI DNA-binding transcriptional activator of the 85.79
COG3629280 DnrI DNA-binding transcriptional activator of the 85.71
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 85.11
KOG0529 421 consensus Protein geranylgeranyltransferase type I 84.87
KOG4014248 consensus Uncharacterized conserved protein (conta 84.85
KOG0529 421 consensus Protein geranylgeranyltransferase type I 84.18
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 83.67
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 83.25
COG2912269 Uncharacterized conserved protein [Function unknow 83.07
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 82.22
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 82.21
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 81.65
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 81.42
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 81.19
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 80.96
KOG1463411 consensus 26S proteasome regulatory complex, subun 80.04
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=3.4e-46  Score=370.86  Aligned_cols=459  Identities=16%  Similarity=0.155  Sum_probs=348.9

Q ss_pred             ccchhhHHHHHHHHhhcchhhHHHHHHHHHhhhHHhhcccHHHHHHHHHHHHhcCccccHhH--HHHHHHHhccHHHH--
Q 004243          232 DRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAG--LARAKYKVGQQYSA--  307 (766)
Q Consensus       232 ~~~~~~~~~~l~~~~~~~~~~~~~a~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~--l~~~~~~~~~a~~~--  307 (766)
                      ...+.....+++++......+.    ....++...++.|+|.+|++....+...+|.+....  +...+.+......+  
T Consensus        28 ~~~s~~s~~v~qq~~~t~~~~~----~~l~lah~~yq~gd~~~a~~h~nmv~~~d~t~~~~llll~ai~~q~~r~d~s~a  103 (966)
T KOG4626|consen   28 SVSSSGSSSVLQQFNKTHEGSD----DRLELAHRLYQGGDYKQAEKHCNMVGQEDPTNTERLLLLSAIFFQGSRLDKSSA  103 (966)
T ss_pred             CcccccchHHHHHhccCCccch----hHHHHHHHHHhccCHHHHHHHHhHhhccCCCcccceeeehhhhhcccchhhhhh
Confidence            3344444455665555443332    355688888999999999999999999988876551  12222222221111  


Q ss_pred             HH-HHhhhccCCCchhHHHHHHHHhccCcH--HHHHHHHHHhcCCCCchHHHHHHHHHHHcCCHHHHHHHHHHHHccCCC
Q 004243          308 YK-LINSIISEHKPTGWMYQERSLYNLGRE--KIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLS  384 (766)
Q Consensus       308 ~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~--A~~~~~~al~~~p~~~~~~~~~a~~~~~~g~~~~A~~~~~~al~~~~~  384 (766)
                      .. .+.+..+ ...+++...|+.+-..|+.  |+..|+.+++++|++..+|.++|.++...|+.+.|..+|..+++++|.
T Consensus       104 ~~~~a~r~~~-q~ae~ysn~aN~~kerg~~~~al~~y~~aiel~p~fida~inla~al~~~~~~~~a~~~~~~alqlnP~  182 (966)
T KOG4626|consen  104 GSLLAIRKNP-QGAEAYSNLANILKERGQLQDALALYRAAIELKPKFIDAYINLAAALVTQGDLELAVQCFFEALQLNPD  182 (966)
T ss_pred             hhhhhhhccc-hHHHHHHHHHHHHHHhchHHHHHHHHHHHHhcCchhhHHHhhHHHHHHhcCCCcccHHHHHHHHhcCcc
Confidence            11 1111111 2235555666666666664  777777777777777777777777777777777777777777777775


Q ss_pred             HHHHHH-HHHHHHhhhhHHHHHHHHHHHHhccCCcccccccchhhhHHhHHHHHHhhhchHhhHHHhhhhhcccCccccH
Q 004243          385 VDCLEL-RAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSL  463 (766)
Q Consensus       385 ~~~~~~-~a~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~a~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~l  463 (766)
                      ..+... +|.++-..|+..+|...|.++++..|....      +|..+|.+....|....|                  |
T Consensus       183 l~ca~s~lgnLlka~Grl~ea~~cYlkAi~~qp~fAi------awsnLg~~f~~~Gei~~a------------------i  238 (966)
T KOG4626|consen  183 LYCARSDLGNLLKAEGRLEEAKACYLKAIETQPCFAI------AWSNLGCVFNAQGEIWLA------------------I  238 (966)
T ss_pred             hhhhhcchhHHHHhhcccchhHHHHHHHHhhCCceee------eehhcchHHhhcchHHHH------------------H
Confidence            554444 677777777777777777777777776553      666667666666665555                  4


Q ss_pred             HHHHHHHHcCCCChhHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCchhhHHHHHHHHHHCCCHHHHHHHHHHHHccccc
Q 004243          464 AVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERT  543 (766)
Q Consensus       464 ~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~  543 (766)
                      ..|+++++++|+..++|+++|.+|...+.++.|+..|.+|+...|+++.++.++|.+|+.+|..+-|+..|+++++++|+
T Consensus       239 q~y~eAvkldP~f~dAYiNLGnV~ke~~~~d~Avs~Y~rAl~lrpn~A~a~gNla~iYyeqG~ldlAI~~Ykral~~~P~  318 (966)
T KOG4626|consen  239 QHYEEAVKLDPNFLDAYINLGNVYKEARIFDRAVSCYLRALNLRPNHAVAHGNLACIYYEQGLLDLAIDTYKRALELQPN  318 (966)
T ss_pred             HHHHHhhcCCCcchHHHhhHHHHHHHHhcchHHHHHHHHHHhcCCcchhhccceEEEEeccccHHHHHHHHHHHHhcCCC
Confidence            44567777777777777777777777777777777777777777777777777777777777777777777777777777


Q ss_pred             hHHHHHHHHHHHhcCCCCCChHHHHHHHHHHHhchhhccccchhHHhhHHHHHHhCCHHHHHHHHHHHHcc--CChHHHH
Q 004243          544 FEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDI--KHTRAHQ  621 (766)
Q Consensus       544 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~A~~~~~~~l~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~--~~~~~~~  621 (766)
                      +                                        ++++.++|.++...|+..+|..+|.+++.+  +++++.+
T Consensus       319 F----------------------------------------~~Ay~NlanALkd~G~V~ea~~cYnkaL~l~p~hadam~  358 (966)
T KOG4626|consen  319 F----------------------------------------PDAYNNLANALKDKGSVTEAVDCYNKALRLCPNHADAMN  358 (966)
T ss_pred             c----------------------------------------hHHHhHHHHHHHhccchHHHHHHHHHHHHhCCccHHHHH
Confidence            6                                        678899999999999999999999999999  6889999


Q ss_pred             HHHHHHHHhccHHHHHHHHHHHHHhccCCHHHHHHHh----hhcCHHHHHHHHHHHHhcCCCCchhHHHHHHHHHhCCCH
Q 004243          622 GLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRS----EYSDREMAKNDLNMATQLDPLRTYPYRYRAAVLMDDQKE  697 (766)
Q Consensus       622 ~la~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~~~----~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~  697 (766)
                      +||.+|..+|.+++|...|.++++..|....+..+++    ..|++++|+.+|+.++.+.|..+.++.++|+.|..+|+.
T Consensus       359 NLgni~~E~~~~e~A~~ly~~al~v~p~~aaa~nNLa~i~kqqgnl~~Ai~~YkealrI~P~fAda~~NmGnt~ke~g~v  438 (966)
T KOG4626|consen  359 NLGNIYREQGKIEEATRLYLKALEVFPEFAAAHNNLASIYKQQGNLDDAIMCYKEALRIKPTFADALSNMGNTYKEMGDV  438 (966)
T ss_pred             HHHHHHHHhccchHHHHHHHHHHhhChhhhhhhhhHHHHHHhcccHHHHHHHHHHHHhcCchHHHHHHhcchHHHHhhhH
Confidence            9999999999999999999999999999999999998    679999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhcCCChHHHH-HHHHHHHHcCCHHHHHHHHHHHHccCCCChhHHHHHHHHHH
Q 004243          698 VEAVEELSKAIAFKPDLQMLH-LRAAFYESIGDLTSAIRDSQAALCLDPNHMETLDLYNRARD  759 (766)
Q Consensus       698 ~~A~~~~~~al~~~p~~~~~~-~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~  759 (766)
                      ..|+.+|.+|+.++|.....+ ++|.+|...|+..+|+..|+.+|+++|+.++++..+....+
T Consensus       439 ~~A~q~y~rAI~~nPt~AeAhsNLasi~kDsGni~~AI~sY~~aLklkPDfpdA~cNllh~lq  501 (966)
T KOG4626|consen  439 SAAIQCYTRAIQINPTFAEAHSNLASIYKDSGNIPEAIQSYRTALKLKPDFPDAYCNLLHCLQ  501 (966)
T ss_pred             HHHHHHHHHHHhcCcHHHHHHhhHHHHhhccCCcHHHHHHHHHHHccCCCCchhhhHHHHHHH
Confidence            999999999999999996555 99999999999999999999999999999999887765443

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4350 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG4591 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2075 consensus Topoisomerase TOP1-interacting protein BTBD1 [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4682 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2716 consensus Polymerase delta-interacting protein PDIP1 and related proteins, contain BTB/POZ domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1987 consensus Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3473 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin C [Transcription] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1778 consensus CREB binding protein/P300 and related TAZ Zn-finger proteins [Transcription] Back     alignment and domain information
>KOG2714 consensus SETA binding protein SB1 and related proteins, contain BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1724 consensus SCF ubiquitin ligase, Skp1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO) Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>smart00875 BACK BTB And C-terminal Kelch Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG5201 SKP1 SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2715 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF01466 Skp1: Skp1 family, dimerisation domain; InterPro: IPR016072 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3840 consensus Uncharaterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query766
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-22
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-15
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-15
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-10
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-08
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-05
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-22
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-13
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-10
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-20
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-19
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-16
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-15
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-15
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-12
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-18
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-18
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-15
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-18
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-17
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-18
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-16
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-04
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-18
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-16
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 5e-17
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-08
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 6e-05
4eqf_A365 PEX5-related protein; accessory protein, tetratric 9e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-16
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 1e-09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-06
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 6e-16
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-07
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-06
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 6e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-15
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-13
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-11
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-04
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-15
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-12
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-15
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-13
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 5e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 8e-15
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-06
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 9e-14
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 6e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-13
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-13
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-11
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-07
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-12
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-12
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 6e-12
4g1t_A472 Interferon-induced protein with tetratricopeptide 5e-11
4g1t_A 472 Interferon-induced protein with tetratricopeptide 2e-09
4g1t_A 472 Interferon-induced protein with tetratricopeptide 4e-07
4g1t_A472 Interferon-induced protein with tetratricopeptide 6e-06
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-11
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 6e-07
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-09
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-09
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-08
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 8e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-09
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-05
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 4e-09
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-05
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-08
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 5e-04
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 1e-07
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-07
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-05
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-04
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 1e-07
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-07
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-04
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-07
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 8e-04
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 2e-07
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-07
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-04
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 7e-04
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 5e-07
3k9i_A117 BH0479 protein; putative protein binding protein, 6e-07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 8e-07
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 1e-06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-04
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 4e-06
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 5e-06
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 6e-05
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 6e-06
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 2e-04
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 6e-06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 8e-06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 5e-05
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 8e-04
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 9e-06
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-05
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 6e-05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 3e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-05
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-04
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 3e-05
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 4e-05
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-04
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 8e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 9e-05
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 1e-04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-04
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 2e-04
2vpk_A116 Myoneurin; transcription regulation, transcription 3e-04
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-04
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 4e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 7e-04
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 9e-04
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
 Score =  101 bits (254), Expect = 1e-22
 Identities = 70/489 (14%), Positives = 145/489 (29%), Gaps = 61/489 (12%)

Query: 329 SLYNLGR--EKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFK-LSV 385
             +      E I    YA ELDP     Y   +   +  G +   I    + +  K    
Sbjct: 34  HFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHS 93

Query: 386 DCLELRAWLFIAADDYESALRDTLALLAL----ESNYMMFHGRVSGDHLVKLLNHHVRSW 441
             L  RA    +  ++  A+ D   L        ++      R      +K+LN ++   
Sbjct: 94  KALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNENLSKD 153

Query: 442 SP-----------ADCWIKLYDRWSSVDDIGSLAVINQMLIN---------DPGKSFLRF 481
                           +  ++D    V  + + +  +                       
Sbjct: 154 EGRGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSDALQRLYSATDEGYLV 213

Query: 482 RQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIE 541
              LL    +   + +    +      +    L Y G   +   +  +A    ++SI++ 
Sbjct: 214 ANDLLTKSTDMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNNLLDAQVLLQESINLH 273

Query: 542 RTFEAFFLKAYILADTNLDPESSTYVIQLLEEALR-CPSDGLRKGQALNNLGSIYVECGK 600
            T  ++   A  LAD     E      +  ++A+   P           + G +Y     
Sbjct: 274 PTPNSYIFLALTLADKENSQEF----FKFFQKAVDLNPEY----PPTYYHRGQMYFILQD 325

Query: 601 LDQAENCYINALDIK--HTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRS 658
              A+  +  A  +   +   +  LA + Y + +   +     +   K           +
Sbjct: 326 YKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFA 385

Query: 659 E-YSDR---EMAKNDLNMATQLDP----------------LRTYPYRYRAAVLMDDQKEV 698
           E  +DR   + A    ++A +L+                         +    +D++K  
Sbjct: 386 EILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFN 445

Query: 699 EAVEELSKAIAFKPDLQMLHL-RAAFYESIGDLTSAIRDSQAALCLDPNHMETLDLYNRA 757
            A++ L+KA    P  +   +  A     +  +  AI   + +  L     E   L    
Sbjct: 446 AAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEK--LQATT 503

Query: 758 RDQASHQQK 766
             +A+  QK
Sbjct: 504 FAEAAKIQK 512
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query766
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
4g1t_A472 Interferon-induced protein with tetratricopeptide 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.97
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.97
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.97
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.97
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.96
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 99.96
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.96
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.96
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.95
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.95
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.95
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.95
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.95
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.94
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.94
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.93
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.93
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.93
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.93
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.93
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.93
3u4t_A272 TPR repeat-containing protein; structural genomics 99.92
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.92
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.92
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.92
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.91
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.91
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.91
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.91
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.91
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.9
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.9
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.9
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.9
3u4t_A272 TPR repeat-containing protein; structural genomics 99.9
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.9
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.9
2vpk_A116 Myoneurin; transcription regulation, transcription 99.9
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.9
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.9
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.89
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.88
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.88
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.88
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.88
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.88
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.88
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.87
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.87
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.87
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.87
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.86
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.86
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.86
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.86
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.85
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.85
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.85
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.85
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.85
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.84
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.84
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.84
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.84
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.84
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.84
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.84
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.83
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.82
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.81
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.8
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.8
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.8
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.8
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.8
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.79
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.79
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.79
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.76
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.76
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.76
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.76
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.75
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.75
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.74
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.74
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.73
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.73
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.73
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.73
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.73
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.72
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.72
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.71
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.7
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.7
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.69
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.68
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.68
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.68
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.67
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.66
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.66
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.65
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.65
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.64
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.64
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.63
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.62
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 99.62
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.61
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.61
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.61
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.6
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.59
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.58
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.58
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.57
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.56
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.56
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.56
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.54
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.53
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.53
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.53
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.53
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.52
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.52
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.52
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.5
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.5
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.47
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.47
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.46
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.46
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.45
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.45
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.43
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.43
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.43
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.42
4ajy_C97 Transcription elongation factor B polypeptide 1; E 99.41
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.41
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.4
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.39
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.38
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.37
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.37
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.36
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.35
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.35
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.34
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.34
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.34
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.33
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.33
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.33
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.32
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.31
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.31
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 99.3
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.3
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.29
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.29
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.28
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.28
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.28
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.28
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.27
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.27
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.25
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.24
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.24
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.23
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.23
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.22
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.22
3k9i_A117 BH0479 protein; putative protein binding protein, 99.22
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.21
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.21
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.21
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 99.19
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.19
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.18
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.18
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.18
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.17
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.16
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.15
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.15
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.15
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.15
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.14
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.14
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.12
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.11
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.11
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.1
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.1
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.05
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.04
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.02
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.02
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.01
3k9i_A117 BH0479 protein; putative protein binding protein, 98.97
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.95
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.91
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.86
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.85
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.8
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.8
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 98.8
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.76
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.76
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.75
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.72
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.72
2fnj_C96 Transcription elongation factor B polypeptide 1; b 98.71
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.7
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 98.7
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.69
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.68
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 98.65
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.61
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.61
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.6
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.57
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.54
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.53
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.47
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.42
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.37
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.34
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 98.31
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.29
2eqx_A105 Kelch repeat and BTB domain-containing protein 4; 98.14
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.09
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.07
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.06
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.06
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.85
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 97.84
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.83
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.81
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.79
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.63
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.26
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.03
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.0
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.92
3kvt_A115 Potassium channel protein SHAW; tetramerization do 96.86
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.62
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 96.6
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.44
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 96.41
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 96.37
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 96.17
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 95.83
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.54
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.12
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 95.02
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.69
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 94.5
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.29
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.0
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 93.91
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 92.78
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 92.67
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 92.6
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 92.1
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 91.58
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 91.45
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 90.64
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 89.77
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 89.35
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 88.96
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 88.74
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 87.01
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 86.51
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 86.08
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 85.12
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 84.75
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 80.84
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 80.47
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 80.46
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 80.35
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 80.06
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=100.00  E-value=1.6e-38  Score=338.29  Aligned_cols=374  Identities=17%  Similarity=0.150  Sum_probs=347.6

Q ss_pred             HHHHHHhccCcH--HHHHHHHHHhcCCCCchHHHHHHHHHHHcCCHHHHHHHHHHHHccCC-CHHHHHHHHHHHHhhhhH
Q 004243          325 YQERSLYNLGRE--KIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKL-SVDCLELRAWLFIAADDY  401 (766)
Q Consensus       325 ~~~~~~~~~~~~--A~~~~~~al~~~p~~~~~~~~~a~~~~~~g~~~~A~~~~~~al~~~~-~~~~~~~~a~~~~~~g~~  401 (766)
                      .++..++..|+.  |+..++++++.+|+++.++..+|.++...|++++|...++++++.+| ++..+..+|.++...|++
T Consensus         4 ~~a~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~a~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~~   83 (388)
T 1w3b_A            4 ELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQL   83 (388)
T ss_dssp             THHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCH
T ss_pred             hHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCchHHHHHHHHHHHHCCCH
Confidence            356667778875  99999999999999999999999999999999999999999999999 455566699999999999


Q ss_pred             HHHHHHHHHHHhccCCcccccccchhhhHHhHHHHHHhhhchHhhHHHhhhhhcccCccccHHHHHHHHHcCCCChhHHH
Q 004243          402 ESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRF  481 (766)
Q Consensus       402 ~~A~~~~~~al~~~p~~~~~~~~~~a~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~l~~~~~al~~~p~~~~~~~  481 (766)
                      ++|+..|+++++.+|++..      ++..++.++...|++++|.                  ..+.++++.+|+...++.
T Consensus        84 ~~A~~~~~~al~~~p~~~~------~~~~l~~~~~~~g~~~~A~------------------~~~~~al~~~p~~~~~~~  139 (388)
T 1w3b_A           84 QEAIEHYRHALRLKPDFID------GYINLAAALVAAGDMEGAV------------------QAYVSALQYNPDLYCVRS  139 (388)
T ss_dssp             HHHHHHHHHHHHHCTTCHH------HHHHHHHHHHHHSCSSHHH------------------HHHHHHHHHCTTCTHHHH
T ss_pred             HHHHHHHHHHHHcCcchHH------HHHHHHHHHHHcCCHHHHH------------------HHHHHHHHhCCCcHHHHH
Confidence            9999999999999999984      8889999999999999984                  556899999999999999


Q ss_pred             HHHHHHHhcCCHHHHHHHHHHHHhcCCCchhhHHHHHHHHHHCCCHHHHHHHHHHHHccccchHHHHHHHHHHHhcCCCC
Q 004243          482 RQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDP  561 (766)
Q Consensus       482 ~la~~~~~~g~~~~A~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~~l~~~~~~~  561 (766)
                      .+|.++...|++++|+..|+++++.+|+++.++..+|.++...|++++|+..|+++++++|++                 
T Consensus       140 ~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~-----------------  202 (388)
T 1w3b_A          140 DLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNF-----------------  202 (388)
T ss_dssp             HHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTC-----------------
T ss_pred             HHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCc-----------------
Confidence            999999999999999999999999999999999999999999999999999999999999987                 


Q ss_pred             CChHHHHHHHHHHHhchhhccccchhHHhhHHHHHHhCCHHHHHHHHHHHHccC--ChHHHHHHHHHHHHhccHHHHHHH
Q 004243          562 ESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIK--HTRAHQGLARVYYLKNELKAAYDE  639 (766)
Q Consensus       562 ~~~~~~~~~~~~A~~~~~~~l~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~--~~~~~~~la~~~~~~g~~~~A~~~  639 (766)
                                             ..++..+|.++...|++++|+..|++++..+  ++.++.++|.++...|++++|+..
T Consensus       203 -----------------------~~~~~~lg~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~  259 (388)
T 1w3b_A          203 -----------------------LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDT  259 (388)
T ss_dssp             -----------------------HHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             -----------------------HHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCcCCHHHHHHHHHHHHHcCCHHHHHHH
Confidence                                   5668889999999999999999999999984  567899999999999999999999


Q ss_pred             HHHHHHhccCCHHHHHHHh----hhcCHHHHHHHHHHHHhcCCCCchhHHHHHHHHHhCCCHHHHHHHHHHHHhcCCCh-
Q 004243          640 MTKLLEKAQYSASAFEKRS----EYSDREMAKNDLNMATQLDPLRTYPYRYRAAVLMDDQKEVEAVEELSKAIAFKPDL-  714 (766)
Q Consensus       640 ~~~~l~~~p~~~~~~~~~~----~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~-  714 (766)
                      |+++++..|+++.++..+|    ..|++++|+..|+++++.+|.++.++..+|.++...|++++|+..|+++++.+|++ 
T Consensus       260 ~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~  339 (388)
T 1w3b_A          260 YRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFA  339 (388)
T ss_dssp             HHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCH
T ss_pred             HHHHHhhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCcccHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcH
Confidence            9999999999999999888    56999999999999999999999999999999999999999999999999999998 


Q ss_pred             HHHHHHHHHHHHcCCHHHHHHHHHHHHccCCCChhHHHHHHHHHHhhh
Q 004243          715 QMLHLRAAFYESIGDLTSAIRDSQAALCLDPNHMETLDLYNRARDQAS  762 (766)
Q Consensus       715 ~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~  762 (766)
                      ..+..+|.++...|++++|+..|+++++++|++++++..++.+...++
T Consensus       340 ~~~~~l~~~~~~~g~~~~A~~~~~~a~~~~p~~~~a~~~lg~~~~~~~  387 (388)
T 1w3b_A          340 AAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQ  387 (388)
T ss_dssp             HHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHhHHHHHHHcc
Confidence            556689999999999999999999999999999999999988766543
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 766
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-16
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-10
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-09
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 4e-06
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 7e-06
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-04
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 7e-04
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 5e-06
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 4e-05
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 1e-04
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.002
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-04
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 0.002
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 79.3 bits (194), Expect = 2e-16
 Identities = 61/390 (15%), Positives = 119/390 (30%), Gaps = 26/390 (6%)

Query: 359 AVAKMEEGQIRAAISEIDRII-VFKLSVDCLELRAWLFIAADDYESALRDTLALLALESN 417
           A  + + G   AA     ++      +   L L + +       + +   +   +     
Sbjct: 6   AHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPL 65

Query: 418 Y----------MMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVIN 467
                          G++            ++               ++ D  G++    
Sbjct: 66  LAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYV 125

Query: 468 QMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHR 527
             L  +P    +R     LL  L   + A  C   A     +        G +    G  
Sbjct: 126 SALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEI 185

Query: 528 EEALSRAEKSISIERTF-EAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQ 586
             A+   EK+++++  F +A+     +L +  +   +       +   LR  S       
Sbjct: 186 WLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRA-------VAAYLRALSLSPNHAV 238

Query: 587 ALNNLGSIYVECGKLDQAENCYINALDIK--HTRAHQGLARVYYLKNELKAAYDEMTKLL 644
              NL  +Y E G +D A + Y  A++++     A+  LA     K  +  A D     L
Sbjct: 239 VHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTAL 298

Query: 645 EKAQYSASAFEKRS----EYSDREMAKNDLNMATQLDPLRTYPYRYRAAVLMDDQKEVEA 700
                 A +    +    E  + E A      A ++ P     +   A+VL    K  EA
Sbjct: 299 RLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEA 358

Query: 701 VEELSKAIAFKPDLQMLHL-RAAFYESIGD 729
           +    +AI   P     +       + + D
Sbjct: 359 LMHYKEAIRISPTFADAYSNMGNTLKEMQD 388
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query766
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.93
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.92
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.91
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.9
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.86
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.85
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.84
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.8
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.79
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.76
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.74
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.69
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.52
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.5
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.49
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.48
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.48
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.45
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.43
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.43
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.43
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.4
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.4
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.39
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.38
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.37
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.32
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.31
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.29
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.29
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.28
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.26
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.19
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.19
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.18
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.18
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.17
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.16
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.11
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.09
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.91
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.84
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.84
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.67
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.65
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.59
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.5
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.46
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 98.28
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 98.04
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.85
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.84
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.8
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 97.73
d3kvta_103 akv3.1 voltage-gated potassium channel {California 97.51
d1t1da_100 Shaker potassium channel {California sea hare (Apl 97.33
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.71
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.59
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 95.66
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 95.25
d1fs1b155 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 94.5
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 93.65
d1nexa170 Centromere DNA-binding protein complex Cbf3 subuni 93.0
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 90.27
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 80.86
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.1e-34  Score=305.51  Aligned_cols=375  Identities=17%  Similarity=0.150  Sum_probs=333.1

Q ss_pred             HHHHHHHHhccCcH--HHHHHHHHHhcCCCCchHHHHHHHHHHHcCCHHHHHHHHHHHHccCC-CHHHHHHHHHHHHhhh
Q 004243          323 WMYQERSLYNLGRE--KIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKL-SVDCLELRAWLFIAAD  399 (766)
Q Consensus       323 ~~~~~~~~~~~~~~--A~~~~~~al~~~p~~~~~~~~~a~~~~~~g~~~~A~~~~~~al~~~~-~~~~~~~~a~~~~~~g  399 (766)
                      ++.+|..++..|++  |+..|+++++.+|+++.++..+|.++...|++++|+..|+++++.+| ++..+..+|.++...|
T Consensus         2 ll~la~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g   81 (388)
T d1w3ba_           2 PMELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERG   81 (388)
T ss_dssp             CCTHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHT
T ss_pred             hHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhc
Confidence            34577888888886  99999999999999999999999999999999999999999999999 4555666999999999


Q ss_pred             hHHHHHHHHHHHHhccCCcccccccchhhhHHhHHHHHHhhhchHhhHHHhhhhhcccCccccHHHHHHHHHcCCCChhH
Q 004243          400 DYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFL  479 (766)
Q Consensus       400 ~~~~A~~~~~~al~~~p~~~~~~~~~~a~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~l~~~~~al~~~p~~~~~  479 (766)
                      ++++|+..+..+...+|....      .................+.                  ..........+.....
T Consensus        82 ~~~~A~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~------------------~~~~~~~~~~~~~~~~  137 (388)
T d1w3ba_          82 QLQEAIEHYRHALRLKPDFID------GYINLAAALVAAGDMEGAV------------------QAYVSALQYNPDLYCV  137 (388)
T ss_dssp             CHHHHHHHHHHHHHHCTTCHH------HHHHHHHHHHHHSCSSHHH------------------HHHHHHHHHCTTCTHH
T ss_pred             ccccccccccccccccccccc------ccccccccccccccccccc------------------cccccccccccccccc
Confidence            999999999999999998874      4444444444444444432                  2335566667778888


Q ss_pred             HHHHHHHHHhcCCHHHHHHHHHHHHhcCCCchhhHHHHHHHHHHCCCHHHHHHHHHHHHccccchHHHHHHHHHHHhcCC
Q 004243          480 RFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNL  559 (766)
Q Consensus       480 ~~~la~~~~~~g~~~~A~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~~l~~~~~  559 (766)
                      ....+......+....+...+.+.+...|+++.++..+|..+...|++++|...++++++.+|++               
T Consensus       138 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~---------------  202 (388)
T d1w3ba_         138 RSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNF---------------  202 (388)
T ss_dssp             HHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTC---------------
T ss_pred             cccccccccccchhhhhHHHHHHhhccCcchhHHHHhhcccccccCcHHHHHHHHHHHHHhCccc---------------
Confidence            88899999999999999999999999999999999999999999999999999999999999987               


Q ss_pred             CCCChHHHHHHHHHHHhchhhccccchhHHhhHHHHHHhCCHHHHHHHHHHHHcc--CChHHHHHHHHHHHHhccHHHHH
Q 004243          560 DPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDI--KHTRAHQGLARVYYLKNELKAAY  637 (766)
Q Consensus       560 ~~~~~~~~~~~~~~A~~~~~~~l~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~--~~~~~~~~la~~~~~~g~~~~A~  637 (766)
                                               ..++..+|.++...|++++|+..|+++...  ..+..+..+|.++...|++++|+
T Consensus       203 -------------------------~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~  257 (388)
T d1w3ba_         203 -------------------------LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAI  257 (388)
T ss_dssp             -------------------------HHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHH
T ss_pred             -------------------------HHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHH
Confidence                                     566788889999999999999999999887  45678899999999999999999


Q ss_pred             HHHHHHHHhccCCHHHHHHHh----hhcCHHHHHHHHHHHHhcCCCCchhHHHHHHHHHhCCCHHHHHHHHHHHHhcCCC
Q 004243          638 DEMTKLLEKAQYSASAFEKRS----EYSDREMAKNDLNMATQLDPLRTYPYRYRAAVLMDDQKEVEAVEELSKAIAFKPD  713 (766)
Q Consensus       638 ~~~~~~l~~~p~~~~~~~~~~----~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~  713 (766)
                      ..|+++++.+|+++.++..+|    ..|++++|+..+++++...|.++..+..+|.++...|++++|++.|+++++++|+
T Consensus       258 ~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~  337 (388)
T d1w3ba_         258 DTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPE  337 (388)
T ss_dssp             HHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTT
T ss_pred             HHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCC
Confidence            999999999999999998888    5699999999999999999999999999999999999999999999999999999


Q ss_pred             hH-HHHHHHHHHHHcCCHHHHHHHHHHHHccCCCChhHHHHHHHHHHhh
Q 004243          714 LQ-MLHLRAAFYESIGDLTSAIRDSQAALCLDPNHMETLDLYNRARDQA  761 (766)
Q Consensus       714 ~~-~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~  761 (766)
                      +. .++.+|.++...|++++|+..|+++++++|++++++..++.+...+
T Consensus       338 ~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~  386 (388)
T d1w3ba_         338 FAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEM  386 (388)
T ss_dssp             CHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHT
T ss_pred             CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHc
Confidence            84 5568999999999999999999999999999999999999887654
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure