Citrus Sinensis ID: 004343

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760
MGDQKSNSEDSTGTSAFVQTDEDVGLLRMQNEKVGLVGISDDHTHDRAELSHEDSTNVLSCSRDIREMRNNGNGVTDAVQSTYPEKVNDNLPSLGVGDSSDAISESKGPHRTMRAAIPKLSMIRGQISDGNPSNPGFNAGFSGFAKKADGISSLVHNVGISSSFAQNMDAHSSTVQNESEFFYPAQNMHDWTLNKNVDFIPGFGGNMGATFQIVDSNTGFPGLQFQVYQNNPVQTVEDGFFPERKRLRLPGQQLPAYQDSPVQTVGKRLFPERIGLQLPDLNIPDTKGSAAQGQVMPVARGGGLAQASDVPTGSSHMRYPTQFPPITHPIQRMTRFIKPSTHKSNSGPSQAASSLTPVPLMPVPPQAKTATSLSPLPGTVAFIQPAFQSTTLPSQVQTAHPPSSLAKEIPLLHVSKDLNFPDNKGSAAQVVQGQVLRVARESGPAQGFNVPVGLSQMIYATRFPPIACPTQCSTRLVTHQSISESAQAAPSVNQATQIYPVQPQVQAAASFTHLSRTAAFLQPASQSTTVPTLAETVHPPPPMGKEKPPPRASKGKSKINVPTRPPGQGISDARASGLVQTSNAASVGPGQKRCAIRAPSIASPGQRRATIHSSVLASAQTGSPLTRRSQTAPVPPQAPTAASFPSFPRTADFLRTLSQSRYPLPHPLQTAHPYSQMAREIRLRLPQDSNRFPQPIGYKCDLCNRDLSFASEGQILQPGVRPSTAVLPCGHHFHDYCLQQITPADQTDNPPCIHCDMHET
ccccccccccccccccEEEccccccEEEEEccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccHHHHHHccccHHHcccHHHHccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccEEccccccHHHHHHccccccccccccccccccccc
cccccccccccccccEEEEcccHHHHHHcccccEEEEEEcccccccHHHHccccccccccccccHHHHccccccccHHHHcccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccHHHHccccHHHHHHHcccHHHcccccccccccccccccccccccccccccHccccccccccccccccEEEEEccccccccccEEEEEccccccccccccHHHHHHcccccccccccccccccccccccHHHcccccccccccccccccccccEEEEEccccccEcccccccccccccccccccccccHccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccHHHHHHccccccccccccccccccccHHHccccccccEEcccccccEEEcccccHHHHHHHHHHcccccccccccccccHccc
mgdqksnsedstgtsafvqtdedvglLRMQNEKVglvgisddhthdraelshedstnvlsCSRDIREmrnngngvtdavqstypekvndnlpslgvgdssdaiseskgphrtmraaipklsmirgqisdgnpsnpgfnagfsgfakkadgISSLVHNvgisssfaqnmdahsstvqneseffypaqnmhdwtlnknvdfipgfggnmgatfqivdsntgfpglqfqvyqnnpvqtvedgffperkrlrlpgqqlpayqdspvqtvgkrlfperiglqlpdlnipdtkgsaaqgqvmpvarggglaqasdvptgsshmryptqfppithpiqrmtrfikpsthksnsgpsqaassltpvplmpvppqaktatslsplpgtvafiqpafqsttlpsqvqtahppsslakeipllhvskdlnfpdnkgsaaQVVQGQVLRVAresgpaqgfnvpvglsqmiyatrfppiacptqcstrlvthqsisesaqaapsvnqatqiypvqpqvqaAASFTHLSRtaaflqpasqsttvptlaetvhppppmgkekpppraskgkskinvptrppgqgisdarasglvqtsnaasvgpgqkrcairapsiaspgqrraTIHSSVlasaqtgspltrrsqtapvppqaptaasfpsfprtADFLRTLsqsryplphplqtahpysQMAREIRLrlpqdsnrfpqpigykcdlcnrdlsfasegqilqpgvrpstavlpcghhfhdyclqqitpadqtdnppcihcdmhet
mgdqksnsedstgtsafvqtdedvGLLRMQNEKVGLVGISDDHTHdraelshedstnvlsCSRDIREMRNNGNGVTDAVQSTYPEKVNDNLPSLGVGDSsdaiseskgphrtMRAAIPKLSMIRGQISDGNPSNPGFNAGFSGFAKKADGISSLVHNVGISSSFAQNMDAHSSTVQNESEFFYPAQNMHDWTLNKNVDFIPGFGGNMGATFQIVDSNTGFPGLQFQVYQNNPVQTVEDGFFPERKRLRlpgqqlpayqdspvqTVGKRLFPERIGLQLPDLNIPDTKGSAAQGQVMPVARGGGLAQASDVPTGSSHMRYPTQFPPITHPIQRMTRFIKPSTHKSNSGPSQAASSLTPVPLMPVPPQAKTATSLSPLPGTVAFIQPAFQSTTLPSQVQTAHPPSSLAKEIPLLHVSKDLNFPDNKGSAAQVVQGQVLRVARESGPAQGFNVPVGLSQMIYATRFPPIACPTQCSTRLVTHQSISESAQAAPSVNQATQIYPVQPQVQAAASFTHLSRTAAFLQPASQSTTVPTLAEtvhppppmgkekpppraskgkskinvptrppGQGISDARASGLVQTSnaasvgpgqkRCAIRAPSIASPGQRRATIHSSVLASAQTGSPLTRRSQTAPVPPQaptaasfpsfPRTADFLRTLSQSRYPLPHPLQTAHPYSQMAREIRLRLPQDSNRFPQPIGYKCDLCNRDLSFASEGQILQPGVRPSTAVLPCGHHFHDYCLQQITPADQTDNPPCIHCDMHET
MGDQKSNSEDSTGTSAFVQTDEDVGLLRMQNEKVGLVGISDDHTHDRAELSHEDSTNVLSCSRDIREMRNNGNGVTDAVQSTYPEKVNDNLPSLGVGDSSDAISESKGPHRTMRAAIPKLSMIRGQISDGNPSNPGFNAGFSGFAKKADGISSLVHNVGISSSFAQNMDAHSSTVQNESEFFYPAQNMHDWTLNKNVDFIPGFGGNMGATFQIVDSNTGFPGLQFQVYQNNPVQTVEDGFFPERKRLRLPGQQLPAYQDSPVQTVGKRLFPERIGLQLPDLNIPDTKGSAAQGQVMPVARGGGLAQASDVPTGSSHMRYPTQFPPITHPIQRMTRFIKPSTHKSNSGPSQAASSLTPVPLMPVPPQAKTATSLSPLPGTVAFIQPAFQSTTLPSQVQTAHPPSSLAKEIPLLHVSKDLNFPDNKGSAAQVVQGQVLRVARESGPAQGFNVPVGLSQMIYATRFPPIACPTQCSTRLVTHQSISESAQAAPSVNQATQIYPVQPQVQAAASFTHLSRTAAFLQPASQSTTVPTLAETVHppppmgkekpppRASKGKSKINVPTRPPGQGISDARASGLVQTSNAASVGPGQKRCAIRAPSIASPGQRRATIHSSVLASAQTGSPLTRRSqtapvppqaptaaSFPSFPRTADFLRTLSQSRYPLPHPLQTAHPYSQMAREIRLRLPQDSNRFPQPIGYKCDLCNRDLSFASEGQILQPGVRPSTAVLPCGHHFHDYCLQQITPADQTDNPPCIHCDMHET
*************************LL******VGLV**********************************************************************************************************F****DGISSLVHNVGI*******************EFFYPAQNMHDWTLNKNVDFIPGFGGNMGATFQIVDSNTGFPGLQFQVYQNNPVQTVEDGFFPE********************TVGKRLFPERIGLQL*****************************************************************************************************VAFI**********************************************VVQGQVLRVARE*GPAQGFNVPVGLSQMIYATRFPPIACPTQCSTRLVTH******************IYP**********FTHL*********************************************************************************************************************************************************************************FPQPIGYKCDLCNRDLSFASEGQILQPGVRPSTAVLPCGHHFHDYCLQQITPA****************
****************FVQTDEDVGLLRMQNEKVGLVGISDDHTHDRAELSHEDSTN************************TYPEKVNDNLPSLGVGD*****************AI*************************GFAKKADGISSLVHNVGISSSFAQNMDAHSSTVQNESEFFYPAQNMHDWTLNKNVDFIPGFGGNMGATFQIVDSNTGFPGLQFQVYQNNPVQTVEDGFFPERKRLRLPGQQ************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************PSTAVLPCGHHFHDYCLQQITPADQTDNPPCIHCDMH**
**************SAFVQTDEDVGLLRMQNEKVGLVGISDDHTHDR**********VLSCSRDIREMRNNGNGVTDAVQSTYPEKVNDNLPSLGVGDSS**********RTMRAAIPKLSMIRGQISDGNPSNPGFNAGFSGFAKKADGISSLVHNVGISSSFAQ*********QNESEFFYPAQNMHDWTLNKNVDFIPGFGGNMGATFQIVDSNTGFPGLQFQVYQNNPVQTVEDGFFPERKRLRLPGQQLPAYQDSPVQTVGKRLFPERIGLQLPDLNIPDTKGSAAQGQVMPVARGGGLAQASDVPTGSSHMRYPTQFPPITHPIQRMTRFIKP***************LTPVPLMPVPPQAKTATSLSPLPGTVAFIQPAFQST*************SLAKEIPLLHVSKDLNFPDNKGSAAQVVQGQVLRVARESGPAQGFNVPVGLSQMIYATRFPPIACPTQCS********************QATQIYPVQPQVQAAASFTHLSRTAAFLQPASQSTTVPTLAETVH*********************NVPTRPPGQGISDARASGLVQT***********RCAIRAPS**********IHSSVL**************************SFPSFPRTADFLRTLSQSRYPLPHPLQTAHPYSQMAREIRLRLPQDSNRFPQPIGYKCDLCNRDLSFASEGQILQPGVRPSTAVLPCGHHFHDYCLQQITPADQTDNPPCIHCDMHET
**************SAFVQTDEDVGLLRMQNEKVGLVGISDDHTHDRAELSHEDSTNVLSCSRDIREMRNN*NGVTDAVQST*PEKVNDNLPSL*V*DS**A*SESKGPHRTMRAAIPKLSMIR*********************KKADGISSLVHNVGISSSFAQNMDAHSSTVQNESEFFYPAQNMHDWTLNKNVDFIPGFGGNMGATFQIVDSNTGFPGLQFQVYQNNPVQTVEDGFFPERKRLRLPGQQLPAYQDSPVQTVGKRLFPERIGLQLPDLNIPDTKGSAAQGQVMPVARGGGLAQASDVPTGSSHMRYPTQFPPITHPIQRMTRFIKPS******************PL*PV*************************************************************************************NVPVGLSQ***********************************************************************************************************************************************************************************************************************H*YSQMAREIRLRLPQDSNRFPQPIGYKCDLCNRDLSFASEGQILQPGVRPSTAVLPCGHHFHDYCLQQITPADQTDNPPCIHCDMH**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDQKSNSEDSTGTSAFVQTDEDVGLLRMQNEKVGLVGISDDHTHDRAELSHEDSTNVLSCSRDIREMRNNGNGVTDAVQSTYPEKVNDNLPSLGVGDSSDAISESKGPHRTMRAAIPKLSMIRGQISDGNPSNPGFNAGFSGFAKKADGISSLVHNVGISSSFAQNMDAHSSTVQNESEFFYPAQNMHDWTLNKNVDFIPGFGGNMGATFQIVDSNTGFPGLQFQVYQNNPVQTVEDGFFPERKRLRLPGQQLPAYQDSPVQTVGKRLFPERIGLQLPDLNIPDTKGSAAQGQVMPVARGGGLAQASDVPTGSSHMRYPTQFPPITHPIQRMTRFIKPSTHKSNSGPSQAASSLTPVPLMPVPPQAKTATSLSPLPGTVAFIQPAFQSTTLPSQVQTAHPPSSLAKEIPLLHVSKDLNFPDNKGSAAQVVQGQVLRVARESGPAQGFNVPVGLSQMIYATRFPPIACPTQCSTRLVTHQSISESAQAAPSVNQATQIYPVQPQVQAAASFTHLSRTAAFLQPASQSTTVPTLAETVHPPPPMGKEKPPPRASKGKSKINVPTRPPGQGISDARASGLVQTSNAASVGPGQKRCAIRAPSIASPGQRRATIHSSVLASAQTGSPLTRRSQTAPVPPQAPTAASFPSFPRTADFLRTLSQSRYPLPHPLQTAHPYSQMAREIRLRLPQDSNRFPQPIGYKCDLCNRDLSFASEGQILQPGVRPSTAVLPCGHHFHDYCLQQITPADQTDNPPCIHCDMHET
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query760
356557205696 PREDICTED: uncharacterized protein LOC10 0.086 0.094 0.666 9e-19
356547480698 PREDICTED: uncharacterized protein LOC10 0.086 0.094 0.666 2e-18
298204770744 unnamed protein product [Vitis vinifera] 0.219 0.224 0.365 3e-18
255543377751 conserved hypothetical protein [Ricinus 0.203 0.206 0.416 1e-17
359483141109 PREDICTED: uncharacterized protein LOC10 0.084 0.587 0.609 5e-16
224053038787 predicted protein [Populus trichocarpa] -0.02 -0.02 0.507 9e-13
326497625462 predicted protein [Hordeum vulgare subsp 0.209 0.344 0.319 5e-06
356502555508 PREDICTED: uncharacterized protein LOC10 0.077 0.116 0.451 1e-05
356497916422 PREDICTED: uncharacterized protein LOC10 0.077 0.139 0.451 2e-05
224088342472 predicted protein [Populus trichocarpa] 0.076 0.122 0.433 4e-05
>gi|356557205|ref|XP_003546908.1| PREDICTED: uncharacterized protein LOC100805304 [Glycine max] Back     alignment and taxonomy information
 Score =  102 bits (254), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 44/66 (66%), Positives = 52/66 (78%)

Query: 694 QPIGYKCDLCNRDLSFASEGQILQPGVRPSTAVLPCGHHFHDYCLQQITPADQTDNPPCI 753
           +PIGYKC LC RDLS+A EG I QP V P+TAVLPCGH FH+YCL++ITP DQ+  PPCI
Sbjct: 631 EPIGYKCLLCKRDLSYAPEGPISQPPVPPATAVLPCGHTFHEYCLERITPDDQSKYPPCI 690

Query: 754 HCDMHE 759
            C + E
Sbjct: 691 PCALLE 696

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356547480|ref|XP_003542140.1| PREDICTED: uncharacterized protein LOC100816300 [Glycine max] Back     alignment and taxonomy information
>gi|298204770|emb|CBI25268.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255543377|ref|XP_002512751.1| conserved hypothetical protein [Ricinus communis] gi|223547762|gb|EEF49254.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|359483141|ref|XP_003632909.1| PREDICTED: uncharacterized protein LOC100853391 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224053038|ref|XP_002297676.1| predicted protein [Populus trichocarpa] gi|222844934|gb|EEE82481.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|326497625|dbj|BAK05902.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326526167|dbj|BAJ93260.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326531296|dbj|BAK04999.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|356502555|ref|XP_003520084.1| PREDICTED: uncharacterized protein LOC100789831 [Glycine max] Back     alignment and taxonomy information
>gi|356497916|ref|XP_003517802.1| PREDICTED: uncharacterized protein LOC100779481 [Glycine max] Back     alignment and taxonomy information
>gi|224088342|ref|XP_002308417.1| predicted protein [Populus trichocarpa] gi|222854393|gb|EEE91940.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

No hits with e-value below 0.001 by BLAST

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query760
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-04
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information 
 Score = 44.5 bits (105), Expect = 2e-04
 Identities = 67/375 (17%), Positives = 104/375 (27%), Gaps = 21/375 (5%)

Query: 329  PIQRMTRFIKPSTHKSNSGPSQAASSLTP-VPLMPVPPQAKTATSLSPLPGTVAFIQPAF 387
            P +   R  +P+       P     S  P  P+         A      P T A   P  
Sbjct: 2570 PPRPAPRPSEPAVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPPP 2629

Query: 388  QSTTLPSQVQTAHPPSSLAKEIPLLHVSKDLNFPDNKGSAAQVVQGQVLRVARESGPAQG 447
              +   ++     PP+    E P    +        +            R A+ S P Q 
Sbjct: 2630 SPSPAANEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLG-------RAAQASSPPQR 2682

Query: 448  FNVPVGLSQMIYATRF----PPIACPTQCSTRLVTHQSISESAQAAPSVNQATQIYPVQP 503
                     +   T      PP   P      LV+   +     AA   + A    P  P
Sbjct: 2683 PRRRAARPTVGSLTSLADPPPPPPTPEPAPHALVSATPLPPGPAAARQASPALPAAPAPP 2742

Query: 504  QVQAAASFTHLSRTAAFLQPASQSTTVPTLAETVHPPPPMGKEKPPPRASKGKSKINVPT 563
             V A  +        A  +P + +              P  +   P  AS  +S+ ++P+
Sbjct: 2743 AVPAGPATPGGPARPA--RPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPS 2800

Query: 564  RP---PGQGISDARASGLVQTSNAASVGPGQKRCAIRAPSIASPGQRRATIHSSVLASAQ 620
                        A A+ L   ++ A   P        AP         +     +  S  
Sbjct: 2801 PWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSL---PLGGSVA 2857

Query: 621  TGSPLTRRSQTAPVPPQAPTAASFPSFPRTADFLRTLSQSRYPLPHPLQTAHPYSQMARE 680
             G  + RR  +   P   P A + P   R A    + S   + LP       P  Q    
Sbjct: 2858 PGGDVRRRPPSRS-PAAKPAAPARPPVRRLARPAVSRSTESFALPPDQPERPPQPQAPPP 2916

Query: 681  IRLRLPQDSNRFPQP 695
             + +        PQP
Sbjct: 2917 PQPQPQPPPPPQPQP 2931

Length = 3151

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 760
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.65
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.56
PHA02929238 N1R/p28-like protein; Provisional 98.12
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.08
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.03
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 98.01
PF1463444 zf-RING_5: zinc-RING finger domain 98.0
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.97
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 97.85
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.83
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 97.8
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.74
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.6
smart0050463 Ubox Modified RING finger domain. Modified RING fi 97.55
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 97.51
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.32
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.29
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 97.29
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.28
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.28
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 97.06
PHA02926242 zinc finger-like protein; Provisional 97.01
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 96.98
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 96.93
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 96.83
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 96.8
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.78
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 96.42
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 96.38
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 96.35
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 96.04
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 96.03
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.87
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 95.86
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 95.77
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 95.34
PF04641260 Rtf2: Rtf2 RING-finger 95.31
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 94.96
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 94.92
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 94.89
KOG149384 consensus Anaphase-promoting complex (APC), subuni 94.85
COG5222 427 Uncharacterized conserved protein, contains RING Z 94.82
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 94.2
KOG0825 1134 consensus PHD Zn-finger protein [General function 93.31
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 93.05
COG5152259 Uncharacterized conserved protein, contains RING a 92.69
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 92.04
KOG1940276 consensus Zn-finger protein [General function pred 91.89
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 89.97
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 89.01
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 88.83
KOG1829580 consensus Uncharacterized conserved protein, conta 88.13
KOG3039303 consensus Uncharacterized conserved protein [Funct 87.64
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 87.62
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 87.3
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 86.87
KOG1002 791 consensus Nucleotide excision repair protein RAD16 86.73
COG52191525 Uncharacterized conserved protein, contains RING Z 86.4
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 84.69
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 82.39
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 81.31
KOG0297 391 consensus TNF receptor-associated factor [Signal t 81.1
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information 
Probab=98.65  E-value=5e-09  Score=77.35  Aligned_cols=43  Identities=30%  Similarity=0.794  Sum_probs=34.9

Q ss_pred             ccccccccccCCCcCCccCCCCCCceEEecCCccchHhhhhhcCCCCCCCCCCCCCCC
Q 004343          699 KCDLCNRDLSFASEGQILQPGVRPSTAVLPCGHHFHDYCLQQITPADQTDNPPCIHCD  756 (760)
Q Consensus       699 tCGICsKdLSERSsGRIsrsndLPVVAVLSCGHVFHAECLEA~TpeSqk~DPpCPLCr  756 (760)
                      .|+||...+....           .+.+|+|||+||.+||+.|...    ...||+|+
T Consensus         2 ~C~IC~~~~~~~~-----------~~~~l~C~H~fh~~Ci~~~~~~----~~~CP~CR   44 (44)
T PF13639_consen    2 ECPICLEEFEDGE-----------KVVKLPCGHVFHRSCIKEWLKR----NNSCPVCR   44 (44)
T ss_dssp             CETTTTCBHHTTS-----------CEEEETTSEEEEHHHHHHHHHH----SSB-TTTH
T ss_pred             CCcCCChhhcCCC-----------eEEEccCCCeeCHHHHHHHHHh----CCcCCccC
Confidence            6999999997632           4679999999999999999944    35999995

...
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query760
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.84
2ect_A78 Ring finger protein 126; metal binding protein, st 98.78
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.76
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.75
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.74
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.73
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.71
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.69
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.63
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.62
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.6
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.6
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.53
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.49
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.49
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.49
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.48
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.46
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.45
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.44
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.43
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.43
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.4
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.4
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.35
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.35
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.31
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.31
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.3
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.29
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.29
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.26
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.25
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.25
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.25
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.25
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.24
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.23
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.21
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.15
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.06
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.0
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.0
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.93
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.92
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.9
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.87
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.79
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 97.78
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 97.71
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.71
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.7
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 97.61
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.59
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 97.54
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 97.54
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.49
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 97.45
3hcs_A 170 TNF receptor-associated factor 6; cross-brace, bet 97.22
2ea5_A68 Cell growth regulator with ring finger domain prot 97.21
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.11
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.04
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 96.96
2f42_A179 STIP1 homology and U-box containing protein 1; cha 96.91
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 96.83
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 96.81
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 96.62
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 96.22
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 95.18
3nw0_A238 Non-structural maintenance of chromosomes element 94.63
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 94.41
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 92.03
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
Probab=98.84  E-value=1.5e-09  Score=89.58  Aligned_cols=61  Identities=23%  Similarity=0.419  Sum_probs=42.9

Q ss_pred             CcccccccccccCCCc-C---CccCCCCCCceEEecCCccchHhhhhhcCCCCC-CCCCCCCCCCC
Q 004343          697 GYKCDLCNRDLSFASE-G---QILQPGVRPSTAVLPCGHHFHDYCLQQITPADQ-TDNPPCIHCDM  757 (760)
Q Consensus       697 gqtCGICsKdLSERSs-G---RIsrsndLPVVAVLSCGHVFHAECLEA~TpeSq-k~DPpCPLCr~  757 (760)
                      ...|.||...|..... .   .........++.+|+|||+||.+||+.|..... .....||+|+.
T Consensus        25 ~~~C~ICl~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~H~Fh~~Ci~~wl~~~~~~~~~~CP~CR~   90 (114)
T 1v87_A           25 EEDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKT   90 (114)
T ss_dssp             SCEETTTTEETTSCCSTTTTCCCSSSCSSCCEEESSSCCEECHHHHHHHHHHTCCSSCCBCTTTCC
T ss_pred             CCcCccCChhhcCcccccccccccccCcccceecCCCCCcccHHHHHHHHHcccCCCCCcCCCCCC
Confidence            3589999999976531 0   011122335677999999999999999984322 35678999985
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query760
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.85
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.69
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.58
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.53
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.49
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.37
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.36
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.17
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.1
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.04
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 97.87
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.84
d2c2la280 STIP1 homology and U box-containing protein 1, STU 97.81
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 97.63
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.58
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.05
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.05
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 85.62
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Deltex protein 2 RING-H2 domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=98.85  E-value=4.8e-10  Score=92.12  Aligned_cols=61  Identities=23%  Similarity=0.419  Sum_probs=44.2

Q ss_pred             CcccccccccccCCCc-C---CccCCCCCCceEEecCCccchHhhhhhcCCCCC-CCCCCCCCCCC
Q 004343          697 GYKCDLCNRDLSFASE-G---QILQPGVRPSTAVLPCGHHFHDYCLQQITPADQ-TDNPPCIHCDM  757 (760)
Q Consensus       697 gqtCGICsKdLSERSs-G---RIsrsndLPVVAVLSCGHVFHAECLEA~TpeSq-k~DPpCPLCr~  757 (760)
                      ...|.||...|...+. .   ......+..++.+++|||+||.+||+.|..... .....||+|+.
T Consensus        25 ~~~C~IC~e~l~~~~~~~~~~~~~~~~~~~~~~~~~CgH~FH~~Ci~~Wl~~~~~~~~~~CP~CR~   90 (114)
T d1v87a_          25 EEDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKT   90 (114)
T ss_dssp             SCEETTTTEETTSCCSTTTTCCCSSSCSSCCEEESSSCCEECHHHHHHHHHHTCCSSCCBCTTTCC
T ss_pred             cccccchhheecccccccccccccccccccceEECCCCChhhHHHHHHHHHhcCcCCCCccccccc
Confidence            4579999999977541 1   112334566788999999999999999985332 23457999985
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure