Citrus Sinensis ID: 004343
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 760 | ||||||
| 356557205 | 696 | PREDICTED: uncharacterized protein LOC10 | 0.086 | 0.094 | 0.666 | 9e-19 | |
| 356547480 | 698 | PREDICTED: uncharacterized protein LOC10 | 0.086 | 0.094 | 0.666 | 2e-18 | |
| 298204770 | 744 | unnamed protein product [Vitis vinifera] | 0.219 | 0.224 | 0.365 | 3e-18 | |
| 255543377 | 751 | conserved hypothetical protein [Ricinus | 0.203 | 0.206 | 0.416 | 1e-17 | |
| 359483141 | 109 | PREDICTED: uncharacterized protein LOC10 | 0.084 | 0.587 | 0.609 | 5e-16 | |
| 224053038 | 787 | predicted protein [Populus trichocarpa] | -0.02 | -0.02 | 0.507 | 9e-13 | |
| 326497625 | 462 | predicted protein [Hordeum vulgare subsp | 0.209 | 0.344 | 0.319 | 5e-06 | |
| 356502555 | 508 | PREDICTED: uncharacterized protein LOC10 | 0.077 | 0.116 | 0.451 | 1e-05 | |
| 356497916 | 422 | PREDICTED: uncharacterized protein LOC10 | 0.077 | 0.139 | 0.451 | 2e-05 | |
| 224088342 | 472 | predicted protein [Populus trichocarpa] | 0.076 | 0.122 | 0.433 | 4e-05 |
| >gi|356557205|ref|XP_003546908.1| PREDICTED: uncharacterized protein LOC100805304 [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 102 bits (254), Expect = 9e-19, Method: Compositional matrix adjust.
Identities = 44/66 (66%), Positives = 52/66 (78%)
Query: 694 QPIGYKCDLCNRDLSFASEGQILQPGVRPSTAVLPCGHHFHDYCLQQITPADQTDNPPCI 753
+PIGYKC LC RDLS+A EG I QP V P+TAVLPCGH FH+YCL++ITP DQ+ PPCI
Sbjct: 631 EPIGYKCLLCKRDLSYAPEGPISQPPVPPATAVLPCGHTFHEYCLERITPDDQSKYPPCI 690
Query: 754 HCDMHE 759
C + E
Sbjct: 691 PCALLE 696
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356547480|ref|XP_003542140.1| PREDICTED: uncharacterized protein LOC100816300 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|298204770|emb|CBI25268.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255543377|ref|XP_002512751.1| conserved hypothetical protein [Ricinus communis] gi|223547762|gb|EEF49254.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359483141|ref|XP_003632909.1| PREDICTED: uncharacterized protein LOC100853391 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224053038|ref|XP_002297676.1| predicted protein [Populus trichocarpa] gi|222844934|gb|EEE82481.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|326497625|dbj|BAK05902.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326526167|dbj|BAJ93260.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326531296|dbj|BAK04999.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|356502555|ref|XP_003520084.1| PREDICTED: uncharacterized protein LOC100789831 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356497916|ref|XP_003517802.1| PREDICTED: uncharacterized protein LOC100779481 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224088342|ref|XP_002308417.1| predicted protein [Populus trichocarpa] gi|222854393|gb|EEE91940.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
No hits with e-value below 0.001 by BLAST
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 760 | |||
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-04 |
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
Score = 44.5 bits (105), Expect = 2e-04
Identities = 67/375 (17%), Positives = 104/375 (27%), Gaps = 21/375 (5%)
Query: 329 PIQRMTRFIKPSTHKSNSGPSQAASSLTP-VPLMPVPPQAKTATSLSPLPGTVAFIQPAF 387
P + R +P+ P S P P+ A P T A P
Sbjct: 2570 PPRPAPRPSEPAVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPPP 2629
Query: 388 QSTTLPSQVQTAHPPSSLAKEIPLLHVSKDLNFPDNKGSAAQVVQGQVLRVARESGPAQG 447
+ ++ PP+ E P + + R A+ S P Q
Sbjct: 2630 SPSPAANEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLG-------RAAQASSPPQR 2682
Query: 448 FNVPVGLSQMIYATRF----PPIACPTQCSTRLVTHQSISESAQAAPSVNQATQIYPVQP 503
+ T PP P LV+ + AA + A P P
Sbjct: 2683 PRRRAARPTVGSLTSLADPPPPPPTPEPAPHALVSATPLPPGPAAARQASPALPAAPAPP 2742
Query: 504 QVQAAASFTHLSRTAAFLQPASQSTTVPTLAETVHPPPPMGKEKPPPRASKGKSKINVPT 563
V A + A +P + + P + P AS +S+ ++P+
Sbjct: 2743 AVPAGPATPGGPARPA--RPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPS 2800
Query: 564 RP---PGQGISDARASGLVQTSNAASVGPGQKRCAIRAPSIASPGQRRATIHSSVLASAQ 620
A A+ L ++ A P AP + + S
Sbjct: 2801 PWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSL---PLGGSVA 2857
Query: 621 TGSPLTRRSQTAPVPPQAPTAASFPSFPRTADFLRTLSQSRYPLPHPLQTAHPYSQMARE 680
G + RR + P P A + P R A + S + LP P Q
Sbjct: 2858 PGGDVRRRPPSRS-PAAKPAAPARPPVRRLARPAVSRSTESFALPPDQPERPPQPQAPPP 2916
Query: 681 IRLRLPQDSNRFPQP 695
+ + PQP
Sbjct: 2917 PQPQPQPPPPPQPQP 2931
|
Length = 3151 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 760 | |||
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.65 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.56 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.12 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.08 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.03 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.01 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.0 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 97.97 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 97.85 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 97.83 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.8 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 97.74 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 97.6 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 97.55 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.51 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 97.32 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 97.29 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 97.29 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 97.28 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 97.28 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.06 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 97.01 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 96.98 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 96.93 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.83 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 96.8 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 96.78 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 96.42 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.38 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 96.35 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 96.04 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 96.03 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 95.87 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.86 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 95.77 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 95.34 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 95.31 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.96 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 94.92 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 94.89 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 94.85 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 94.82 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.2 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 93.31 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 93.05 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 92.69 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.04 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 91.89 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 89.97 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 89.01 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.83 | |
| KOG1829 | 580 | consensus Uncharacterized conserved protein, conta | 88.13 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 87.64 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 87.62 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 87.3 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 86.87 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 86.73 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 86.4 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.69 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 82.39 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 81.31 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 81.1 |
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
Probab=98.65 E-value=5e-09 Score=77.35 Aligned_cols=43 Identities=30% Similarity=0.794 Sum_probs=34.9
Q ss_pred ccccccccccCCCcCCccCCCCCCceEEecCCccchHhhhhhcCCCCCCCCCCCCCCC
Q 004343 699 KCDLCNRDLSFASEGQILQPGVRPSTAVLPCGHHFHDYCLQQITPADQTDNPPCIHCD 756 (760)
Q Consensus 699 tCGICsKdLSERSsGRIsrsndLPVVAVLSCGHVFHAECLEA~TpeSqk~DPpCPLCr 756 (760)
.|+||...+.... .+.+|+|||+||.+||+.|... ...||+|+
T Consensus 2 ~C~IC~~~~~~~~-----------~~~~l~C~H~fh~~Ci~~~~~~----~~~CP~CR 44 (44)
T PF13639_consen 2 ECPICLEEFEDGE-----------KVVKLPCGHVFHRSCIKEWLKR----NNSCPVCR 44 (44)
T ss_dssp CETTTTCBHHTTS-----------CEEEETTSEEEEHHHHHHHHHH----SSB-TTTH
T ss_pred CCcCCChhhcCCC-----------eEEEccCCCeeCHHHHHHHHHh----CCcCCccC
Confidence 6999999997632 4679999999999999999944 35999995
|
... |
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 760 | |||
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.84 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.78 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.76 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.75 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.74 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.73 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.71 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.69 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.63 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.62 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.6 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 98.6 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.53 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.49 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.49 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.49 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.48 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 98.46 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 98.45 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 98.44 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.43 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.43 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.4 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.4 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.35 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 98.35 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 98.31 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.31 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.3 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.29 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.29 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.26 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.25 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.25 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.25 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.25 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.24 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.23 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.21 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.15 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.06 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.0 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.0 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 97.93 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 97.92 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 97.9 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 97.87 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 97.79 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 97.78 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 97.71 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 97.71 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 97.7 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 97.61 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 97.59 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 97.54 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 97.54 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 97.49 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 97.45 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 97.22 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 97.21 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 97.11 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 97.04 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 96.96 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 96.91 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 96.83 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 96.81 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 96.62 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 96.22 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 95.18 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 94.63 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 94.41 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 92.03 |
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
Probab=98.84 E-value=1.5e-09 Score=89.58 Aligned_cols=61 Identities=23% Similarity=0.419 Sum_probs=42.9
Q ss_pred CcccccccccccCCCc-C---CccCCCCCCceEEecCCccchHhhhhhcCCCCC-CCCCCCCCCCC
Q 004343 697 GYKCDLCNRDLSFASE-G---QILQPGVRPSTAVLPCGHHFHDYCLQQITPADQ-TDNPPCIHCDM 757 (760)
Q Consensus 697 gqtCGICsKdLSERSs-G---RIsrsndLPVVAVLSCGHVFHAECLEA~TpeSq-k~DPpCPLCr~ 757 (760)
...|.||...|..... . .........++.+|+|||+||.+||+.|..... .....||+|+.
T Consensus 25 ~~~C~ICl~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~H~Fh~~Ci~~wl~~~~~~~~~~CP~CR~ 90 (114)
T 1v87_A 25 EEDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKT 90 (114)
T ss_dssp SCEETTTTEETTSCCSTTTTCCCSSSCSSCCEEESSSCCEECHHHHHHHHHHTCCSSCCBCTTTCC
T ss_pred CCcCccCChhhcCcccccccccccccCcccceecCCCCCcccHHHHHHHHHcccCCCCCcCCCCCC
Confidence 3589999999976531 0 011122335677999999999999999984322 35678999985
|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 760 | |||
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.85 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.69 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.58 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.53 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.49 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.37 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.36 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.17 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.1 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.04 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 97.87 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 97.84 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 97.81 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 97.63 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 97.58 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 97.05 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.05 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 85.62 |
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: Deltex protein 2 RING-H2 domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.85 E-value=4.8e-10 Score=92.12 Aligned_cols=61 Identities=23% Similarity=0.419 Sum_probs=44.2
Q ss_pred CcccccccccccCCCc-C---CccCCCCCCceEEecCCccchHhhhhhcCCCCC-CCCCCCCCCCC
Q 004343 697 GYKCDLCNRDLSFASE-G---QILQPGVRPSTAVLPCGHHFHDYCLQQITPADQ-TDNPPCIHCDM 757 (760)
Q Consensus 697 gqtCGICsKdLSERSs-G---RIsrsndLPVVAVLSCGHVFHAECLEA~TpeSq-k~DPpCPLCr~ 757 (760)
...|.||...|...+. . ......+..++.+++|||+||.+||+.|..... .....||+|+.
T Consensus 25 ~~~C~IC~e~l~~~~~~~~~~~~~~~~~~~~~~~~~CgH~FH~~Ci~~Wl~~~~~~~~~~CP~CR~ 90 (114)
T d1v87a_ 25 EEDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKT 90 (114)
T ss_dssp SCEETTTTEETTSCCSTTTTCCCSSSCSSCCEEESSSCCEECHHHHHHHHHHTCCSSCCBCTTTCC
T ss_pred cccccchhheecccccccccccccccccccceEECCCCChhhHHHHHHHHHhcCcCCCCccccccc
Confidence 4579999999977541 1 112334566788999999999999999985332 23457999985
|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|