Citrus Sinensis ID: 004346


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760
MLKRKDSQKDDKTSGISQQVNFEKVKDDISGVEEMDSNSLSTEDEEEKSMQMEIDNLFESAMRGHWDHIVQAYESNPMSQEAKITKSEDTALHLAAASGHSDVVCRLVETMGENESNILKIQNNRGNTALHLAAALGNVEMCRCMASKDPKLVGARNKDSETPLFLAALNGKKAAFLCLHFLSHDKDSSLGRKSNGDTILHAAISGDYFSLAFHIIRCYPDLVNCVNENGLSPLHILAGKPNAFRSSSCLGLFDLMLYDCVSVDELREEKYDYSKNYGSHGTAKFPENYRTCINFFRFIWTSLRILSGLLTKPKDELDEEDPQQNVISREKEDKEDHFCPPNCTTFVLFSKLMMKALLIVLGIGIWRISRIKEKKVRHKWAYLVMKELVQCASLYKYDDNGQNPENSRLDNKHGEPFLVPGARPVPENTETSQKNIVLSTPEKKNTQQSRRKETPLLIATKTGVLEIVEKILDAFPVAIQDEDANGKNVVLLAVEHRQTHIYELLLKKKMIMENAFRKLDNQGNSALHYAAMFENHRPSSLIPGAALQMQWEIKWYKYVKESMPQNFFVRYNNNGQTPKELFTETHKKLVKEGSKWLIKTSEACSVVAALIATVAFAASATVPGGLNEDNGKPILLEEIAFRIFAISSLVSLCFSVTALIVCLAILTSRYQEKDFAMALPRKLLIGLTSLHVSVVSVWISFCAGHYLVIRDMLRSMALPMYAATCLPMAYFALIQLPLYVDLMLAIFKKVPQPSYKVFSL
cccccccccccHHHHHHHcccHHHHHHHHcccHHHHHccccccHHHHHHcccccHHHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHHHcccccccHHcccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccHHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHcccccccHHccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
ccHHHccccccHHHHHHHHccHHHHHHHHccccccHHHHHHHHHccccccccccHHHHHHHHcccHHHHHHHHHHccHHHHHHcccccccHHHHHHHcccHHHHHHHHHHcccccccHHHHcccccccHHHHHHHcccHHHHHHHHHHcccHccccccccccHHHHHHHcccccHHHHHHHccccccHccccccccccHHHHHHHccHHHHHHHHHHHccHHccccccccccHHHHHHccccccccccccHHHHHHHHHccEHcHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEccccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHcccccccccccccccccccccccccccccccccccHHHHHHccccccHHHccccccccccHHHHHHHcccHHHHHHHHHHccHHHHccccccccEEHHHHHccHHHHHHHHHHcccHHHHHHHHHccccccHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHEHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcc
mlkrkdsqkddktsgisqqvnfekvkddisgveemdsnslstedeEEKSMQMEIDNLFESAMRGHWDHIVQAyesnpmsqeakitksEDTALHLAAASGHSDVVCRLVETMGENESNILKIQNNRGNTALHLAAALGNVEMCRCMaskdpklvgarnkdsetPLFLAALNGKKAAFLCLHFlshdkdsslgrksngdtiLHAAISGDYFSLAFHIIRcypdlvncvnenglsplhilagkpnafrsssclglfdlmlydcvsvdelreekydysknygshgtakfpenyRTCINFFRFIWTSLRILSglltkpkdeldeedpqqnvisrekedkedhfcppncttFVLFSKLMMKALLIVLGIGIWRISRIKEKKVRHKWAYLVMKELVQCASlykyddngqnpensrldnkhgepflvpgarpvpentetsqknivlstpekkntqqsrrketplliaTKTGVLEIVEKILDAFpvaiqdedangkNVVLLAVEHRQTHIYELLLKKKMIMENAFRKLDNQGNSALHYAAMFenhrpsslipgaALQMQWEIKWYKYVKESMPQNFFVrynnngqtpkeLFTETHKKLVKEGSKWLIKTSEACSVVAALIATVAFAasatvpgglnedngkpilLEEIAFRIFAISSLVSLCFSVTALIVCLAILTSRYQEKDFAMALPRKLLIGLTSLHVSVVSVWISFCAGHYLVIRDMLRSMalpmyaatCLPMAYFALIQLPLYVDLMLAIFkkvpqpsykvfsl
mlkrkdsqkddktsgisqqvnfekvkddisgveemdsnslstedeeeKSMQMEIDNLFESAMRGHWDHIVQAYESNPMSQEAKITKSEDTALHLAAASGHSDVVCRLVETMGENESNILKIQNNRGNTALHLAAALGNVEMCRCMASKDPKLVGARNKDSETPLFLAALNGKKAAFLCLHFLSHDKDSSLGRKSNGDTILHAAISGDYFSLAFHIIRCYPDLVNCVNENGLSPLHILAGKPNAFRSSSCLGLFDLMLYDCVSVDELREEKYDYSknygshgtakfpenYRTCINFFRFIWTSLRILSGLltkpkdeldeedpQQNVISrekedkedhfcppNCTTFVLFSKLMMKALLIVLGIGIWRISRIKEKKVRHKWAYLVMKELVQCASLYKYDDNGQNPENSRLDNKHGEPFLVPgarpvpentetsqknivlstpekkntqqsrrketplliatktgVLEIVEKILDAFPVAIQDEDANGKNVVLLAVEHRQTHIYELLLKKKMIMENAFRKLDNQGNSALHYAAMFENHRPSSLIPGAALQMQWEIKWYKYVKESMPQNFFVRYNNNGQTPKELFTETHKKLVKEGSKWLIKTSEACSVVAALIATVAFAasatvpgglneDNGKPILLEEIAFRIFAISSLVSLCFSVTALIVCLAILTSRYQEKDFAMALPRKLLIGLTSLHVSVVSVWISFCAGHYLVIRDMLRSMALPMYAATCLPMAYFALIQLPLYVDLMLAIFKkvpqpsykvfsl
MLKRKDSQKDDKTSGISQQVNFEKVKDDISGVEEMDSNSLSTEDEEEKSMQMEIDNLFESAMRGHWDHIVQAYESNPMSQEAKITKSEDTALHLAAASGHSDVVCRLVETMGENESNILKIQNNRGNTALHLAAALGNVEMCRCMASKDPKLVGARNKDSETPLFLAALNGKKAAFLCLHFLSHDKDSSLGRKSNGDTILHAAISGDYFSLAFHIIRCYPDLVNCVNENGLSPLHILAGKPNAFRSSSCLGLFDLMLYDCVSVDELREEKYDYSKNYGSHGTAKFPENYRTCINFFRFIWTSLRILSGLLTKPKDELDEEDPQQNVISREKEDKEDHFCPPNCTTFVLFSKLMMKALLIVLGIGIWRISRIKEKKVRHKWAYLVMKELVQCASLYKYDDNGQNPENSRLDNKHGEPFLVPGARPVPENTETSQKNIVLSTPEKKNTQQSRRKETPLLIATKTGVLEIVEKILDAFPVAIQDEDANGKNVVLLAVEHRQTHIYELLLKKKMIMENAFRKLDNQGNSALHYAAMFENHRPSSLIPGAALQMQWEIKWYKYVKESMPQNFFVRYNNNGQTPKELFTETHKKLVKEGSKWLIKTSEACSvvaaliatvafaasatvPGGLNEDNGKPILLEEIAFRIFAISSLVSLCFSVTALIVCLAILTSRYQEKDFAMALPRKLLIGLTSLHVSVVSVWISFCAGHYLVIRDMLRSMALPMYAATCLPMAYFALIQLPLYVDLMLAIFKKVPQPSYKVFSL
*********************************************************FESAMRGHWDHIVQAY*******************HLAAASGHSDVVCRLVETMGENESNILKIQNNRGNTALHLAAALGNVEMCRCMASKD*KLV********TPLFLAALNGKKAAFLCLHFLSHD**********GDTILHAAISGDYFSLAFHIIRCYPDLVNCVNENGLSPLHILAGKPNAFRSSSCLGLFDLMLYDCVSVDELREEKYDYSKNYGSHGTAKFPENYRTCINFFRFIWTSLRILSGLLT*************************HFCPPNCTTFVLFSKLMMKALLIVLGIGIWRISRIKEKKVRHKWAYLVMKELVQCASLYKYD*********************************************************LLIATKTGVLEIVEKILDAFPVAIQDEDANGKNVVLLAVEHRQTHIYELLLKKKMIMENAFRKLDNQGNSALHYAAMFENHRPSSLIPGAALQMQWEIKWYKYVKESMPQNFFVRYNNNGQTPKELFTETHKKLVKEGSKWLIKTSEACSVVAALIATVAFAASATVPGGLNEDNGKPILLEEIAFRIFAISSLVSLCFSVTALIVCLAILTSRYQEKDFAMALPRKLLIGLTSLHVSVVSVWISFCAGHYLVIRDMLRSMALPMYAATCLPMAYFALIQLPLYVDLMLAIFKKVP*********
MLKRK**QKDDKTSGISQQVNFEKVKDDISGVE******************MEIDNLFESAMRGHWDHIVQAYESNPMSQEAKITKSEDTALHLAAASGHSDVVCRLVETMGENESNILKIQNNRGNTALHLAAALGNVEMCRCMASKDPKLVGARNKDSETPLFLAALNGKKAAFLCLHFLSHDKDSSLGRKSNGDTILHAAISGDYFSLAFHIIRCYPDLVNCVNENGLSPLHILAGKPNAFRSSSCLGLFDLMLYDCVSVDELREEKYDYSKNYGSHGTAKFPENYRTCINFFRFIWTSLRILSGLLTKPKDELDEEDPQQNVISREKEDKEDHFCPPNCTTFVLFSKLMMKALLIVLGIGIWRISRIKEKKVRHKWAYLVMKELVQCASLYKYDDNGQNPENSRLDNKHGEPFLVPGARPVPENTETSQKNIVLSTPE*****QSRRKETPLLIATKTGVLEIVEKILDAFPVAIQDEDANGKNVVLLAVEHRQTHIYELLLKKKMIMENAFRKLDNQGNSALHYAAMFENHRPSSLIPGAALQMQWEIKWYKYVKESMPQNFFVRYNNNGQTPKELF*************WLIKTSEACSVVAALIATVAFAASATVPGGLNEDNGKPILLEEIAFRIFAISSLVSLCFSVTALIVCLAILTSRYQEKDFAMALPRKLLIGLTSLHVSVVSVWISFCAGHYLVIRDMLRSMALPMYAATCLPMAYFALIQLPLYVDLMLAIFKKVPQPSYKVFSL
***************ISQQVNFEKVKDDISG*******************QMEIDNLFESAMRGHWDHIVQAYESNPMSQEAKITKSEDTALHLAAASGHSDVVCRLVETMGENESNILKIQNNRGNTALHLAAALGNVEMCRCMASKDPKLVGARNKDSETPLFLAALNGKKAAFLCLHFLSHDKDSSLGRKSNGDTILHAAISGDYFSLAFHIIRCYPDLVNCVNENGLSPLHILAGKPNAFRSSSCLGLFDLMLYDCVSVDELREEKYDYSKNYGSHGTAKFPENYRTCINFFRFIWTSLRILSGLLTKPKDE********************HFCPPNCTTFVLFSKLMMKALLIVLGIGIWRISRIKEKKVRHKWAYLVMKELVQCASLYKYDDNGQNPENSRLDNKHGEPFLVPGARPVPENTETSQKNIVLS************KETPLLIATKTGVLEIVEKILDAFPVAIQDEDANGKNVVLLAVEHRQTHIYELLLKKKMIMENAFRKLDNQGNSALHYAAMFENHRPSSLIPGAALQMQWEIKWYKYVKESMPQNFFVRYNNNGQTPKELFTETHKKLVKEGSKWLIKTSEACSVVAALIATVAFAASATVPGGLNEDNGKPILLEEIAFRIFAISSLVSLCFSVTALIVCLAILTSRYQEKDFAMALPRKLLIGLTSLHVSVVSVWISFCAGHYLVIRDMLRSMALPMYAATCLPMAYFALIQLPLYVDLMLAIFKKVPQ********
*****DSQKDDKTSGISQQVNFEKVKDDISGVEEMDSNSLSTEDEEEKSMQMEIDNLFESAMRGHWDHIVQAYESNPMSQEAKITKSEDTALHLAAASGHSDVVCRLVETMGENESNILKIQNNRGNTALHLAAALGNVEMCRCMASKDPKLVGARNKDSETPLFLAALNGKKAAFLCLHFLSHDKDSSLGRKSNGDTILHAAISGDYFSLAFHIIRCYPDLVNCVNENGLSPLHILAGKPNAFRSSSCLGLFDLMLYDCVSVDELREEKYDYSKNYGSHGTAKFPENYRTCINFFRFIWTSLRILSGLLTKPK********QQNVISR*KEDKEDHFCPPNCTTFVLFSKLMMKALLIVLGIGIWRISRIKEKKVRHKWAYLVMKELVQCASLYKYDDNG*********************RP*P**T*T*Q*NIVLSTPEK*NTQQSRRKETPLLIATKTGVLEIVEKILDAFPVAIQDEDANGKNVVLLAVEHRQTHIYELLLKKKMIMENAFRKLDNQGNSALHYAAMFENHRPSSLIPGAALQMQWEIKWYKYVKESMPQNFFVRYNNNGQTPKELFTETHKKLVKEGSKWLIKTSEACSVVAALIATVAFAASATVPGGLNEDNGKPILLEEIAFRIFAISSLVSLCFSVTALIVCLAILTSRYQEKDFAMALPRKLLIGLTSLHVSVVSVWISFCAGHYLVIRDMLRSMALPMYAATCLPMAYFALIQLPLYVDLMLAIFKKVPQPSYKVFSL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKRKDSQKDDKTSGISQQVNFEKVKDDISGVEEMDSNSLSTEDEEEKSMQMEIDNLFESAMRGHWDHIVQAYESNPMSQEAKITKSEDTALHLAAASGHSDVVCRLVETMGENESNILKIQNNRGNTALHLAAALGNVEMCRCMASKDPKLVGARNKDSETPLFLAALNGKKAAFLCLHFLSHDKDSSLGRKSNGDTILHAAISGDYFSLAFHIIRCYPDLVNCVNENGLSPLHILAGKPNAFRSSSCLGLFDLMLYDCVSVDELREEKYDYSKNYGSHGTAKFPENYRTCINFFRFIWTSLRILSGLLTKPKDELDEEDPQQNVISREKEDKEDHFCPPNCTTFVLFSKLMMKALLIVLGIGIWRISRIKEKKVRHKWAYLVMKELVQCASLYKYDDNGQNPENSRLDNKHGEPFLVPGARPVPENTETSQKNIVLSTPEKKNTQQSRRKETPLLIATKTGVLEIVEKILDAFPVAIQDEDANGKNVVLLAVEHRQTHIYELLLKKKMIMENAFRKLDNQGNSALHYAAMFENHRPSSLIPGAALQMQWEIKWYKYVKESMPQNFFVRYNNNGQTPKELFTETHKKLVKEGSKWLIKTSEACSVVAALIATVAFAASATVPGGLNEDNGKPILLEEIAFRIFAISSLVSLCFSVTALIVCLAILTSRYQEKDFAMALPRKLLIGLTSLHVSVVSVWISFCAGHYLVIRDMLRSMALPMYAATCLPMAYFALIQLPLYVDLMLAIFKKVPQPSYKVFSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query760 2.2.26 [Sep-21-2011]
Q01484 3957 Ankyrin-2 OS=Homo sapiens yes no 0.190 0.036 0.303 3e-10
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus yes no 0.190 0.037 0.303 4e-10
Q9C7A2590 Ankyrin repeat-containing no no 0.332 0.428 0.260 4e-09
Q12955 4377 Ankyrin-3 OS=Homo sapiens no no 0.189 0.032 0.307 1e-07
G5E8K5 1961 Ankyrin-3 OS=Mus musculus yes no 0.189 0.073 0.314 2e-07
P0C6S7 1260 Ankyrin repeat and steril no no 0.184 0.111 0.324 4e-07
Q7Z6G8 1248 Ankyrin repeat and steril no no 0.184 0.112 0.324 4e-07
Q8BIZ1 1259 Ankyrin repeat and steril no no 0.184 0.111 0.324 5e-07
A5PMU4 1280 Ankyrin repeat and steril no no 0.209 0.124 0.301 9e-07
Q4UMH61179 Putative ankyrin repeat p yes no 0.214 0.138 0.272 3e-06
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function desciption
 Score = 67.8 bits (164), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 88/188 (46%), Gaps = 43/188 (22%)

Query: 84  ITKSEDTALHLAAASGHSDVVCRLVETMGENESNILKIQNNRGNTALHLAAALGNVEMCR 143
           IT+S  T +H+AA  GH ++V  L++     +     + N RG TALH+AA  G VE+ R
Sbjct: 427 ITESGLTPIHVAAFMGHLNIVLLLLQNGASPD-----VTNIRGETALHMAARAGQVEVVR 481

Query: 144 CMASKDPKLVGARNKDSETPLFLAALNGKKAAF-LCLHFLSHDKDSSLGRKSNGDTILHA 202
           C+  ++  LV AR ++ +TPL +A+  GK     L L  ++H   ++    +NG T LH 
Sbjct: 482 CLL-RNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAAT----TNGYTPLHI 536

Query: 203 AI-------------SGDYFSLA-------FHIIRCYPDL------------VNCVNENG 230
           +              +G   SLA        H+   Y  L             +   +NG
Sbjct: 537 SAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNG 596

Query: 231 LSPLHILA 238
           L+PLH+ A
Sbjct: 597 LTPLHVAA 604




Attaches integral membrane proteins to cytoskeletal elements. Also binds to cytoskeletal proteins. Required for coordinate assembly of Na/Ca exchanger, Na/K ATPase and InsP3 receptor at sarcoplasmic reticulum sites in cardiomyocytes. Required for the coordinated expression of the Na/K ATPase, Na/Ca exchanger and beta-2-spectrin (SPTBN1) in the inner segment of rod photoreceptors. Required for expression and targeting of SPTBN1 in neonatal cardiomyocytes and for the regulation of neonatal cardiomyocyte contraction rate.
Homo sapiens (taxid: 9606)
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 Back     alignment and function description
>sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 Back     alignment and function description
>sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 Back     alignment and function description
>sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 Back     alignment and function description
>sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query760
255554112786 ankyrin repeat-containing protein, putat 0.923 0.893 0.515 0.0
359479721749 PREDICTED: uncharacterized protein LOC10 0.922 0.935 0.485 0.0
147855983 1513 hypothetical protein VITISV_044165 [Viti 0.947 0.475 0.457 0.0
357447499693 Serine/threonine protein phosphatase 6 r 0.9 0.987 0.486 0.0
359495447733 PREDICTED: uncharacterized protein LOC10 0.876 0.908 0.463 0.0
359476634 969 PREDICTED: uncharacterized protein LOC10 0.897 0.703 0.464 1e-180
359479727663 PREDICTED: ankyrin repeat-containing pro 0.847 0.971 0.467 1e-175
357447493676 Serine/threonine protein phosphatase 6 r 0.872 0.980 0.462 1e-174
356546544725 PREDICTED: uncharacterized protein LOC10 0.893 0.936 0.444 1e-168
147841950714 hypothetical protein VITISV_026950 [Viti 0.868 0.924 0.443 1e-165
>gi|255554112|ref|XP_002518096.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223542692|gb|EEF44229.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/785 (51%), Positives = 529/785 (67%), Gaps = 83/785 (10%)

Query: 52  MEIDNLFESAMRGHWDHIVQAYESNPMSQEAKITKSEDTALHLAAASGHSDVVCRLVETM 111
           ME + +FESAM G WD +V+AY+ NP  ++ +IT+S +TA+H+A + G ++VV +LVE  
Sbjct: 1   MEANGIFESAMNGRWDQVVEAYKKNPSLEDGRITRSRNTAVHIAVSDGRTEVVSKLVEIF 60

Query: 112 GENESNILKIQNNRGNTALHLAAALGNVEMCRCMASKDPKLVGARNKDSETPLFLAALNG 171
           G+N S +L I+N +GNT LHLAA LG+ +MC C+A++D  L+  RN + ETPLFL+AL+G
Sbjct: 61  GDNASRVLHIKNEKGNTPLHLAAKLGDAKMCYCLAARDRSLIRTRNSEGETPLFLSALHG 120

Query: 172 KKAAFLCLHFL---SH-DKDSSLGRKSNGDTILHAAISGDYFSLAFHIIRCYPDLVNCVN 227
           KK AFLCLHFL   +H + D SL RKSNGDTILH+AISG+YFSLAF II  YP+LV  VN
Sbjct: 121 KKNAFLCLHFLYREAHKENDYSLCRKSNGDTILHSAISGEYFSLAFQIIHNYPNLVTSVN 180

Query: 228 ENGLSPLHILAGKPNAFRSSSCLGLFDLMLYDCVSVDELREEKYD---YSKNYGSHGTAK 284
           E+GLSPLHILA KPNAFRS   L  F  ++Y C+ V E+++E ++   +  N G+    K
Sbjct: 181 ESGLSPLHILASKPNAFRSGCHLPPFSRLIYCCLIVHEIQQETHNPEVWLSNSGNETGPK 240

Query: 285 FPENYRTCINFFRFIWTSLRILS------------GLLTKPK---DELDEEDPQQNVIS- 328
           +P+NY+TC++FF  I    +IL+              L + K   D+L +E+  Q +   
Sbjct: 241 YPQNYQTCMSFFSAIKRFFQILTRTEEESICHQVRQFLLRVKGENDKLKDEENAQEISGL 300

Query: 329 ------REKEDKEDHFCPPNCTTFVLFSKLMMKALLIVLGIGIWRISRIKEKKVRHKWAY 382
                 +EKE+K   F PPN  T +   K M  ALL++LG G  RI  ++ KK RH WA 
Sbjct: 301 SYDRNLQEKEEKR-RFYPPNYETSIQLFKFMANALLVILGFGSSRIKNVRAKKERHIWAT 359

Query: 383 LVMKELVQCASLYKYDDNGQNPENS----------------------------------- 407
            ++ ELVQ AS Y Y+++G+NP NS                                   
Sbjct: 360 QLLNELVQRASSYTYENDGRNPRNSWPKRDGDPSEFLAAPHISEVDKLTQSKEHIGLSCP 419

Query: 408 ------RLDNKHGEPFLVPGARPVPENTE----------TSQKNIVLSTPEKKNTQQSRR 451
                 R +N HG    +  A  V E+ +          TSQKN+VL   EKK TQ+ R+
Sbjct: 420 TTNQEIRREN-HGRAAKLGVAEVVNESLDAYPTAVQELNTSQKNLVLLAFEKKETQKFRK 478

Query: 452 KETPLLIATKTGVLEIVEKILDAFPVAIQDEDANGKNVVLLAVEHRQTHIYELLLKKKMI 511
           KETP+L+A K G+ EIV+KILD +P+AIQD D++ KN VLLAVEHRQT +Y LLLK+ M+
Sbjct: 479 KETPILVAAKVGITEIVDKILDTYPLAIQDLDSDEKNAVLLAVEHRQTDVYNLLLKRAMV 538

Query: 512 MENAFRKLDNQGNSALHYAAMFENHRPSSLIPGAALQMQWEIKWYKYVKESMPQNFFVRY 571
            E+ FR+LD  GNSALH AA   ++RP  L+PGAALQMQWEIKWYK+VK SMP +FFV++
Sbjct: 539 KESVFRQLDKHGNSALHLAAKLGDYRPK-LVPGAALQMQWEIKWYKFVKNSMPPHFFVKH 597

Query: 572 NNNGQTPKELFTETHKKLVKEGSKWLIKTSEACSVVAALIATVAFAASATVPGGLNEDNG 631
           N+ GQTPKE+F  THK+LV +GS+WL KTSE+CSVVAAL+ATVAFA SAT+PGG+N +NG
Sbjct: 598 NSQGQTPKEIFIVTHKELVAKGSEWLTKTSESCSVVAALVATVAFATSATIPGGVNPENG 657

Query: 632 KPILLEEIAFRIFAISSLVSLCFSVTALIVCLAILTSRYQEKDFAMALPRKLLIGLTSLH 691
            PIL  E AF +FAI+SLV+LCFSVTA+I  L ILTSRYQE DFAM LPRKL +GLTSL 
Sbjct: 658 APILENEPAFEVFAIASLVALCFSVTAVIFFLTILTSRYQENDFAMDLPRKLFLGLTSLF 717

Query: 692 VSVVSVWISFCAGHYLVIRDMLRSMALPMYAATCLPMAYFALIQLPLYVDLMLAIFKKVP 751
            S+ S+ +SFCAGH+ V+++ LR+ A P+YAATCLP+++FAL QLPLY DL  AI    P
Sbjct: 718 TSIASILLSFCAGHFFVLKESLRTAAYPLYAATCLPISFFALSQLPLYFDLGRAILLDEP 777

Query: 752 QPSYK 756
           Q SYK
Sbjct: 778 QRSYK 782




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359479721|ref|XP_002272096.2| PREDICTED: uncharacterized protein LOC100255529 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147855983|emb|CAN82817.1| hypothetical protein VITISV_044165 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357447499|ref|XP_003594025.1| Serine/threonine protein phosphatase 6 regulatory ankyrin repeat subunit A [Medicago truncatula] gi|355483073|gb|AES64276.1| Serine/threonine protein phosphatase 6 regulatory ankyrin repeat subunit A [Medicago truncatula] Back     alignment and taxonomy information
>gi|359495447|ref|XP_002274376.2| PREDICTED: uncharacterized protein LOC100254555 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359476634|ref|XP_002273692.2| PREDICTED: uncharacterized protein LOC100246246 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359479727|ref|XP_002274066.2| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357447493|ref|XP_003594022.1| Serine/threonine protein phosphatase 6 regulatory ankyrin repeat subunit C [Medicago truncatula] gi|355483070|gb|AES64273.1| Serine/threonine protein phosphatase 6 regulatory ankyrin repeat subunit C [Medicago truncatula] Back     alignment and taxonomy information
>gi|356546544|ref|XP_003541685.1| PREDICTED: uncharacterized protein LOC100798360 [Glycine max] Back     alignment and taxonomy information
>gi|147841950|emb|CAN67508.1| hypothetical protein VITISV_026950 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query760
TAIR|locus:2080240574 AT3G54070 "AT3G54070" [Arabido 0.413 0.547 0.270 8.5e-41
TAIR|locus:2175413669 AT5G04700 "AT5G04700" [Arabido 0.394 0.448 0.314 3.6e-40
TAIR|locus:2175448603 AT5G04730 "AT5G04730" [Arabido 0.390 0.492 0.287 3.5e-35
TAIR|locus:2180228625 AT5G04690 "AT5G04690" [Arabido 0.388 0.472 0.285 1.6e-33
TAIR|locus:2165174347 AT5G35810 "AT5G35810" [Arabido 0.378 0.829 0.321 3.3e-33
TAIR|locus:2046628601 AT2G24600 "AT2G24600" [Arabido 0.182 0.231 0.315 7.6e-14
TAIR|locus:2020833616 AT1G03670 "AT1G03670" [Arabido 0.171 0.211 0.313 3.1e-13
TAIR|locus:2012873578 AT1G10340 "AT1G10340" [Arabido 0.239 0.314 0.294 3.5e-13
ZFIN|ZDB-GENE-030728-7 1614 trpn1 "transient receptor pote 0.228 0.107 0.282 2e-12
TAIR|locus:2170081535 AT5G50140 "AT5G50140" [Arabido 0.238 0.338 0.305 5.4e-12
TAIR|locus:2080240 AT3G54070 "AT3G54070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 334 (122.6 bits), Expect = 8.5e-41, Sum P(2) = 8.5e-41
 Identities = 88/325 (27%), Positives = 161/325 (49%)

Query:   432 SQKNIVLSTPEKKNTQQSRRKETPLLIATKTGVLEIVEKILDAFPVAIQDEDANGKNVVL 491
             ++K   +S   + N  Q       L  A + G +EI+  ++ +    +   D N + +  
Sbjct:   235 ARKTSAISHKSQLNLFQQVASSWLLFDAAELGNVEILVILIRSHLDLLWIVDNNNRTLFH 294

Query:   492 LAVEHRQTHIYELLLKKKMIMENAFRKLDNQG-NSALHYAAMFENHRPSSLIPGAALQMQ 550
             +A  +R  +I+ L+ +   I +      + Q  ++ LH  A         +  GAAL MQ
Sbjct:   295 VAALYRHENIFSLIYELGGIKDLIASYKEKQSKDTLLHLVARLPPMNRQQVGSGAALHMQ 354

Query:   551 WEIKWYKYVKESMPQNFFVRYNNNGQTPKELFTETHKKLVKEGSKWLIKTSEACSXXXXX 610
              E+ W+K VKE +P+++    N  G+   ++FTE H+ L KEG +W+ +T+ AC      
Sbjct:   355 KELLWFKAVKEIVPRSYIETKNTKGELAHDIFTEQHENLRKEGERWMKETATACMLGATL 414

Query:   611 XXXXXXXXXXXXPGGLNEDNGK-------PILLEEIAFRIFAISSLVSLCFSVTALIVCL 663
                         PGG N+D+G        P   + + F IF +S  V+L  S+ ++++ L
Sbjct:   415 IATVVFAAAITIPGG-NDDSGDKANTLGFPNFRKRLLFDIFTLSDSVALFSSMMSIVIFL 473

Query:   664 AILTSRYQEKDFAMALPRKLLIGLTSLHVSVVSVWISFCAGHYLVIRDMLRSMALPMYAA 723
             +I TSRY E+DF   LP KL+ GL++L +S++S+ ++F     ++IR    S++L + + 
Sbjct:   474 SIFTSRYAEEDFRYDLPTKLMFGLSALFISIISMILAFTFS-MILIRVEKASLSLVLISC 532

Query:   724 TC-LPMAYFALIQLPLYVDLMLAIF 747
                L    FA +   L+ + + +++
Sbjct:   533 LASLTALTFAYLYFHLWFNTLRSVY 557


GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2175413 AT5G04700 "AT5G04700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175448 AT5G04730 "AT5G04730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180228 AT5G04690 "AT5G04690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165174 AT5G35810 "AT5G35810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046628 AT2G24600 "AT2G24600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020833 AT1G03670 "AT1G03670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012873 AT1G10340 "AT1G10340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030728-7 trpn1 "transient receptor potential cation channel, subfamily N, member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2170081 AT5G50140 "AT5G50140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query760
pfam13962114 pfam13962, PGG, Domain of unknown function 1e-27
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-18
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-14
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-10
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-07
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-07
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-04
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 5e-04
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 0.002
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information
 Score =  107 bits (270), Expect = 1e-27
 Identities = 46/121 (38%), Positives = 68/121 (56%), Gaps = 13/121 (10%)

Query: 594 SKWLIKTSEACSVVAALIATVAFAASATVPGGLNEDN-----GKPILLEEI-AFRIFAIS 647
           S+WL KT  +  VVA LIATV FAA  T PGG  +D+     G PIL  +   F+ F +S
Sbjct: 1   SEWLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVS 60

Query: 648 SLVSLCFSVTALIVCLAILTSRYQEKDFAMALPRKLLIGLTSLHVSVVSVWISFCAGHYL 707
           + ++   S+ A+I+ L I+ S  +          +LL  LT L +S++S+ ++F AG Y 
Sbjct: 61  NTIAFVASLVAVILLLYIVPSFSRRL-------PRLLALLTLLWLSLLSLMVAFAAGSYR 113

Query: 708 V 708
           V
Sbjct: 114 V 114


The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 760
PHA02876682 ankyrin repeat protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02792631 ankyrin-like protein; Provisional 99.97
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PHA02792631 ankyrin-like protein; Provisional 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.94
PHA02859209 ankyrin repeat protein; Provisional 99.94
TIGR00870743 trp transient-receptor-potential calcium channel p 99.93
PHA02795437 ankyrin-like protein; Provisional 99.93
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.92
PF13962113 PGG: Domain of unknown function 99.92
PHA02795437 ankyrin-like protein; Provisional 99.92
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.92
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.91
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.91
PLN03192823 Voltage-dependent potassium channel; Provisional 99.89
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.89
PLN03192823 Voltage-dependent potassium channel; Provisional 99.89
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.89
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.87
KOG0514452 consensus Ankyrin repeat protein [General function 99.85
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.85
PHA02743166 Viral ankyrin protein; Provisional 99.84
KOG0514452 consensus Ankyrin repeat protein [General function 99.83
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.83
PHA02741169 hypothetical protein; Provisional 99.83
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.82
PHA02743166 Viral ankyrin protein; Provisional 99.81
PHA02736154 Viral ankyrin protein; Provisional 99.81
PHA02884300 ankyrin repeat protein; Provisional 99.79
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.79
PHA02741169 hypothetical protein; Provisional 99.79
PHA02884300 ankyrin repeat protein; Provisional 99.77
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.77
PHA02736154 Viral ankyrin protein; Provisional 99.76
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.75
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.72
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.68
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.64
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.63
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.59
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.58
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.54
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.45
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.43
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.43
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.4
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.39
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.38
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.36
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.35
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.3
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.29
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.26
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.24
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.22
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.89
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.7
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.69
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.66
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.63
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.59
PF1360630 Ank_3: Ankyrin repeat 98.56
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.55
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.54
KOG0522560 consensus Ankyrin repeat protein [General function 98.52
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.49
KOG0522560 consensus Ankyrin repeat protein [General function 98.49
PF1360630 Ank_3: Ankyrin repeat 98.47
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.46
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.43
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.4
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.26
KOG3609822 consensus Receptor-activated Ca2+-permeable cation 98.14
KOG0520975 consensus Uncharacterized conserved protein, conta 97.98
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.97
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.88
KOG0511516 consensus Ankyrin repeat protein [General function 97.77
KOG2384223 consensus Major histocompatibility complex protein 97.76
KOG0511516 consensus Ankyrin repeat protein [General function 97.74
KOG2384223 consensus Major histocompatibility complex protein 97.57
KOG0520975 consensus Uncharacterized conserved protein, conta 97.36
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.97
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.88
KOG2505591 consensus Ankyrin repeat protein [General function 95.64
KOG2505591 consensus Ankyrin repeat protein [General function 94.22
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 88.58
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 88.46
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 81.04
PF06570206 DUF1129: Protein of unknown function (DUF1129); In 80.91
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.3e-42  Score=401.55  Aligned_cols=380  Identities=14%  Similarity=0.099  Sum_probs=301.2

Q ss_pred             hhhhhccchHHHHHHHHcCCHHHHHHHHHcCCCCcccccCCCCCcHHHHHH-----------------------------
Q 004346           46 EEKSMQMEIDNLFESAMRGHWDHIVQAYESNPMSQEAKITKSEDTALHLAA-----------------------------   96 (760)
Q Consensus        46 ~~~~~~~~~~~L~~Aa~~g~~~~v~~lL~~~~~~~~~~~d~~g~t~Lh~A~-----------------------------   96 (760)
                      .......+.||||.|+..|+.+.|+.+++++|. .....|..|.||||+|+                             
T Consensus        34 ~~~~~~~~~t~LH~A~~~g~~e~V~~ll~~~~~-~~~~~~~~~~tpLh~a~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~  112 (682)
T PHA02876         34 QCENESIPFTAIHQALQLRQIDIVEEIIQQNPE-LIYITDHKCHSTLHTICIIPNVMDIVISLTLDCDIILDIKYASIIL  112 (682)
T ss_pred             hcccccccchHHHHHHHHHhhhHHHHHHHhCcc-cchhhchhhccccccccCCCCccccccccccchhhcccccHHHHHH
Confidence            333455678999999999999999999999776 34566889999999766                             


Q ss_pred             -----------------------------------------HcCCHHHHHHHHHhhCcCCccccccccCCCChHHHHHHH
Q 004346           97 -----------------------------------------ASGHSDVVCRLVETMGENESNILKIQNNRGNTALHLAAA  135 (760)
Q Consensus        97 -----------------------------------------~~g~~~~v~~Ll~~~~~~~~~~~~~~d~~g~TpLh~Aa~  135 (760)
                                                               ..|+.+++++|++.|++     ++.+|..|+||||+||.
T Consensus       113 ~~~~~~~~~~~il~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~~i~k~Ll~~Gad-----vn~~d~~G~TpLh~Aa~  187 (682)
T PHA02876        113 NKHKLDEACIHILKEAISGNDIHYDKINESIEYMKLIKERIQQDELLIAEMLLEGGAD-----VNAKDIYCITPIHYAAE  187 (682)
T ss_pred             HHHHHHHHHHHHHHHHhcCCcccHHhhccchhhhHHHHHHHHCCcHHHHHHHHhCCCC-----CCCCCCCCCCHHHHHHH
Confidence                                                     45778899999999988     88999999999999999


Q ss_pred             cCCHHHHHHHHhcCCCccCCCCCCCCcHHHHHHHcCChHHHHHHHhcCCCCCCcccCCCCCChHHHHHHHcCCHHHHHHH
Q 004346          136 LGNVEMCRCMASKDPKLVGARNKDSETPLFLAALNGKKAAFLCLHFLSHDKDSSLGRKSNGDTILHAAISGDYFSLAFHI  215 (760)
Q Consensus       136 ~g~~~~v~~Ll~~~~~~~~~~~~~g~tpL~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~~~g~t~Lh~A~~~~~~~iv~~L  215 (760)
                      .|+.++|++|+++|++ ++..+.+|.||||+|+..|+.+++++|++.+..   +    ..+.++|+.|+..++.+++++|
T Consensus       188 ~G~~~iv~~LL~~Gad-~n~~~~~g~t~L~~A~~~~~~~ivk~Ll~~~~~---~----~~~~~~L~~ai~~~~~~~~~~L  259 (682)
T PHA02876        188 RGNAKMVNLLLSYGAD-VNIIALDDLSVLECAVDSKNIDTIKAIIDNRSN---I----NKNDLSLLKAIRNEDLETSLLL  259 (682)
T ss_pred             CCCHHHHHHHHHCCCC-cCccCCCCCCHHHHHHHcCCHHHHHHHHhcCCC---C----CCCcHHHHHHHHcCCHHHHHHH
Confidence            9999999999999998 899999999999999999999999999887655   2    2356889999999999999999


Q ss_pred             HHhCCCCccccccCCCcHHHHHhcCCCCCCccchhHHHHHHHhcccCchhhhhhhcccccCCCCCCCCCCCchhHhHHhH
Q 004346          216 IRCYPDLVNCVNENGLSPLHILAGKPNAFRSSSCLGLFDLMLYDCVSVDELREEKYDYSKNYGSHGTAKFPENYRTCINF  295 (760)
Q Consensus       216 l~~~~~~~~~~d~~g~tpL~~A~~~~~~~~s~~~l~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  295 (760)
                      ++.+.+ ++..|..|.||||+|+..++      ...+++.|+..|++++..+..                          
T Consensus       260 l~~g~~-vn~~d~~g~TpLh~Aa~~~~------~~~iv~lLl~~gadin~~d~~--------------------------  306 (682)
T PHA02876        260 YDAGFS-VNSIDDCKNTPLHHASQAPS------LSRLVPKLLERGADVNAKNIK--------------------------  306 (682)
T ss_pred             HHCCCC-CCCCCCCCCCHHHHHHhCCC------HHHHHHHHHHCCCCCCCcCCC--------------------------
Confidence            999988 88999999999999999876      246889999999887653211                          


Q ss_pred             HHHHHHHHHHhhccCCCCCCCCCcCCCcccchhhccccccCCCCCCCCchhHHHHHHHHHHHHHHhccchhhHHHHHHHH
Q 004346          296 FRFIWTSLRILSGLLTKPKDELDEEDPQQNVISREKEDKEDHFCPPNCTTFVLFSKLMMKALLIVLGIGIWRISRIKEKK  375 (760)
Q Consensus       296 ~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  375 (760)
                                                          |.||++.                ++.     .|           
T Consensus       307 ------------------------------------g~TpLh~----------------Aa~-----~g-----------  318 (682)
T PHA02876        307 ------------------------------------GETPLYL----------------MAK-----NG-----------  318 (682)
T ss_pred             ------------------------------------CCCHHHH----------------HHH-----hC-----------
Confidence                                                1122211                000     00           


Q ss_pred             HHhHHHHHHHHHHHhcc-ccccccCCCCCCCCcccCCCCCCCCCCCCCCCCCCCccccccccccCCccchhcccccCCCc
Q 004346          376 VRHKWAYLVMKELVQCA-SLYKYDDNGQNPENSRLDNKHGEPFLVPGARPVPENTETSQKNIVLSTPEKKNTQQSRRKET  454 (760)
Q Consensus       376 ~~~~~~~~il~~Ll~~~-~~~~~d~~G~tpl~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~d~~g~t  454 (760)
                          ...++++.|+..+ +.+..|..|.||+|.++....         ...+...+.+.        +...+.+|..|.|
T Consensus       319 ----~~~~~v~~Ll~~gadin~~d~~g~TpLh~A~~~~~---------~~~iv~lLl~~--------gadin~~d~~G~T  377 (682)
T PHA02876        319 ----YDTENIRTLIMLGADVNAADRLYITPLHQASTLDR---------NKDIVITLLEL--------GANVNARDYCDKT  377 (682)
T ss_pred             ----CCHHHHHHHHHcCCCCCCcccCCCcHHHHHHHhCC---------cHHHHHHHHHc--------CCCCccCCCCCCC
Confidence                0136788888888 667789999999998864221         12233333333        3344688999999


Q ss_pred             HHHHHHhcChHHHHHHHHHhCCccccccccCCCchHHHHHHcCc-HHHHHHHHhccchhhhhhccccCCCCchhhHHhhc
Q 004346          455 PLLIATKTGVLEIVEKILDAFPVAIQDEDANGKNVVLLAVEHRQ-THIYELLLKKKMIMENAFRKLDNQGNSALHYAAMF  533 (760)
Q Consensus       455 pLh~Aa~~g~~eiv~~LL~~~~~~i~~~d~~G~T~Lh~A~~~~~-~~iv~~Ll~~~a~~~~~in~~D~~G~T~LhlAa~~  533 (760)
                      |||+|+..|+.++++.|++ .|++++..+..|.||||+|+..++ ..++++|++.|+    ++|.+|.+|+||||+|+..
T Consensus       378 pLh~Aa~~~~~~iv~~Ll~-~gad~~~~~~~g~T~Lh~A~~~~~~~~~vk~Ll~~ga----din~~d~~G~TpLh~Aa~~  452 (682)
T PHA02876        378 PIHYAAVRNNVVIINTLLD-YGADIEALSQKIGTALHFALCGTNPYMSVKTLIDRGA----NVNSKNKDLSTPLHYACKK  452 (682)
T ss_pred             HHHHHHHcCCHHHHHHHHH-CCCCccccCCCCCchHHHHHHcCCHHHHHHHHHhCCC----CCCcCCCCCChHHHHHHHh
Confidence            9999999999999999997 589999999999999999998765 567999999999    9999999999999999987


Q ss_pred             CC-CCCCCCCchhHHHHHHHHHHHHHHHhcCCccchhccccCCCCccchhhhh
Q 004346          534 EN-HRPSSLIPGAALQMQWEIKWYKYVKESMPQNFFVRYNNNGQTPKELFTET  585 (760)
Q Consensus       534 g~-~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~g~tp~~i~~~~  585 (760)
                      +. .+++++                 +.+  .....+.+|..|.||+.++.+.
T Consensus       453 ~~~~~iv~l-----------------Ll~--~Gad~n~~d~~g~tpl~~a~~~  486 (682)
T PHA02876        453 NCKLDVIEM-----------------LLD--NGADVNAINIQNQYPLLIALEY  486 (682)
T ss_pred             CCcHHHHHH-----------------HHH--CCCCCCCCCCCCCCHHHHHHHh
Confidence            63 444421                 111  1233568899999999987653



>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06570 DUF1129: Protein of unknown function (DUF1129); InterPro: IPR009214 There are currently no experimental data for members of this group or their homologues Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query760
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 7e-07
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 5e-06
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 8e-07
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-06
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 4e-06
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 9e-06
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 2e-05
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 3e-05
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 3e-05
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 3e-05
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 1e-04
2xee_A157 Structural Determinants For Improved Thermal Stabil 4e-05
2xeh_A157 Structural Determinants For Improved Thermal Stabil 4e-05
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 5e-05
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 6e-05
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 4e-04
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 8e-05
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-04
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-04
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 1e-04
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 2e-04
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 2e-04
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 4e-04
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 4e-04
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 4e-04
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 5e-04
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 5e-04
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 5e-04
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 7e-04
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 8e-04
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure

Iteration: 1

Score = 52.8 bits (125), Expect = 7e-07, Method: Composition-based stats. Identities = 40/114 (35%), Positives = 58/114 (50%), Gaps = 9/114 (7%) Query: 90 TALHLAAASGHSDVVCRLVETMGENESNILKIQNNRGNTALHLAAALGNVEMCRCMASKD 149 T LHLAA +GH +VV L+E + + ++ G T LHLAA G++E+ + + Sbjct: 4 TPLHLAARNGHLEVVKLLLEAGAD-----VNAKDKNGRTPLHLAARNGHLEVVKLLLEAG 58 Query: 150 PKLVGARNKDSETPLFLAALNGKKAAFLCLHFLSHDKDSSLGRKSNGDTILHAA 203 V A++K+ TPL LAA NG L D ++ + NG T LH A Sbjct: 59 AD-VNAKDKNGRTPLHLAARNGHLEVVKLLLEAGADVNA---KDKNGRTPLHLA 108
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query760
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-20
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-20
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-18
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-18
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-18
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-18
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-13
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-18
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-17
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-16
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-04
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-18
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-06
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-04
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-13
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-07
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-04
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-04
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-18
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-16
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-14
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-04
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-04
3v30_A172 DNA-binding protein rfxank; structural genomics co 7e-18
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-14
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 7e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-16
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-13
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-18
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-14
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-05
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-04
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-17
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-17
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-14
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-17
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-17
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-13
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-10
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-16
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-12
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-04
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-17
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-16
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-12
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-17
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-17
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-16
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-16
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-12
2rfa_A232 Transient receptor potential cation channel subfa 8e-17
2rfa_A232 Transient receptor potential cation channel subfa 4e-15
2rfa_A232 Transient receptor potential cation channel subfa 7e-14
2rfa_A232 Transient receptor potential cation channel subfa 1e-05
2rfa_A232 Transient receptor potential cation channel subfa 8e-04
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-15
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-13
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-09
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-09
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-16
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-14
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-14
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-07
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-16
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-15
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-09
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-16
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-15
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-16
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-05
2etb_A256 Transient receptor potential cation channel subfam 8e-16
2etb_A256 Transient receptor potential cation channel subfam 5e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-15
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-14
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 8e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-06
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-14
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-04
2pnn_A273 Transient receptor potential cation channel subfa 2e-15
2pnn_A273 Transient receptor potential cation channel subfa 4e-13
2pnn_A273 Transient receptor potential cation channel subfa 3e-11
2pnn_A273 Transient receptor potential cation channel subfa 2e-10
2pnn_A273 Transient receptor potential cation channel subfa 9e-05
2pnn_A273 Transient receptor potential cation channel subfa 1e-04
2pnn_A273 Transient receptor potential cation channel subfa 5e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-15
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-15
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-12
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 7e-12
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-07
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-15
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-10
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-15
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-05
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-14
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-13
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-04
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-14
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-14
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-07
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-14
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-13
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-14
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-13
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-08
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 9e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-13
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-12
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-12
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-11
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-13
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-13
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-10
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-13
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-13
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-08
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-05
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-13
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-07
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-13
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-13
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-06
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-13
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-12
3jxi_A260 Vanilloid receptor-related osmotically activated p 9e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-13
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-04
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-12
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-12
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-12
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-08
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 7e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 7e-07
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
 Score = 90.7 bits (226), Expect = 1e-20
 Identities = 41/156 (26%), Positives = 66/156 (42%), Gaps = 13/156 (8%)

Query: 90  TALHLAAASGHSDVVCRLVETMGENESNILKIQNNRGNTALHLAAALGNVEMCRCMASK- 148
           T LHLA  +   ++   L+        +  ++++ RGNT LHLA   G +     +    
Sbjct: 47  TPLHLAVITNQPEIAEALLG----AGCDP-ELRDFRGNTPLHLACEQGCLASVGVLTQSC 101

Query: 149 ----DPKLVGARNKDSETPLFLAALNGKKAAFLCLHFLSHDKDSSLGRKSNGDTILHAAI 204
                  ++ A N +  T L LA+++G       L  +S   D +     NG T LH A+
Sbjct: 102 TTPHLHSILKATNYNGHTCLHLASIHGYLGIVELL--VSLGADVNAQEPCNGRTALHLAV 159

Query: 205 SGDYFSLAFHIIRCYPDLVNCVNENGLSPLHILAGK 240
                 L   +++C  D VN V   G SP  +  G+
Sbjct: 160 DLQNPDLVSLLLKCGAD-VNRVTYQGYSPYQLTWGR 194


>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query760
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2rfa_A232 Transient receptor potential cation channel subfa 99.98
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.98
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.94
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.94
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.92
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.92
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.89
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.89
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.89
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.88
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.88
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.87
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.85
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.85
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.85
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.85
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.85
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.85
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.85
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.85
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.85
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.85
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.83
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.81
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.81
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.8
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.8
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.8
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.79
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.79
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.78
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.78
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.77
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.75
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.69
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.64
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=7.2e-52  Score=458.05  Aligned_cols=384  Identities=20%  Similarity=0.226  Sum_probs=315.6

Q ss_pred             chhhhhhhccchHHHHHHHHcCCHHHHHHHHHcCCCCcccccCCCCCcHHHHHHHcCCHHHHHHHHHhhCcCCccccccc
Q 004346           43 EDEEEKSMQMEIDNLFESAMRGHWDHIVQAYESNPMSQEAKITKSEDTALHLAAASGHSDVVCRLVETMGENESNILKIQ  122 (760)
Q Consensus        43 ~~~~~~~~~~~~~~L~~Aa~~g~~~~v~~lL~~~~~~~~~~~d~~g~t~Lh~A~~~g~~~~v~~Ll~~~~~~~~~~~~~~  122 (760)
                      +...+...+.+.||||.||..|+.+.++.+++.  +.+++..+..|.||||+||..|+.+++++|++.+++     ++.+
T Consensus         4 g~~~~~~~~~g~t~L~~Aa~~g~~~~v~~Ll~~--g~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~-----~~~~   76 (437)
T 1n11_A            4 GISGGGGGESGLTPLHVASFMGHLPIVKNLLQR--GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAK-----VNAK   76 (437)
T ss_dssp             -----------CCHHHHHHHHTCHHHHHHHHHT--TCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCC-----SSCC
T ss_pred             CCCccccCCCCCCHHHHHHHCCCHHHHHHHHHc--CCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCC-----CCCC
Confidence            445566677889999999999999999999998  788888899999999999999999999999999988     8899


Q ss_pred             cCCCChHHHHHHHcCCHHHHHHHHhcCCCccCCCCCCCCcHHHHHHHcCChHHHHHHHhcCCCCCCcccCCCCCChHHHH
Q 004346          123 NNRGNTALHLAAALGNVEMCRCMASKDPKLVGARNKDSETPLFLAALNGKKAAFLCLHFLSHDKDSSLGRKSNGDTILHA  202 (760)
Q Consensus       123 d~~g~TpLh~Aa~~g~~~~v~~Ll~~~~~~~~~~~~~g~tpL~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~~~g~t~Lh~  202 (760)
                      |..|+||||+|+..|+.+++++|+++|++ ++..|..|.||||+|+..|+.+++++|++.+.+   .+..+..|.||||+
T Consensus        77 ~~~g~t~L~~A~~~g~~~~v~~Ll~~ga~-~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~---~~~~~~~g~t~L~~  152 (437)
T 1n11_A           77 AKDDQTPLHCAARIGHTNMVKLLLENNAN-PNLATTAGHTPLHIAAREGHVETVLALLEKEAS---QACMTKKGFTPLHV  152 (437)
T ss_dssp             CTTSCCHHHHHHHHTCHHHHHHHHHHTCC-TTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCC---SCCCCTTSCCHHHH
T ss_pred             CCCCCCHHHHHHHCCCHHHHHHHHhCCCC-CCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCC---CcCCCCCCCCHHHH
Confidence            99999999999999999999999999999 899999999999999999999999999999877   56688899999999


Q ss_pred             HHHcCCHHHHHHHHHhCCCCccccccCCCcHHHHHhcCCCCCCccchhHHHHHHHhcccCchhhhhhhcccccCCCCCCC
Q 004346          203 AISGDYFSLAFHIIRCYPDLVNCVNENGLSPLHILAGKPNAFRSSSCLGLFDLMLYDCVSVDELREEKYDYSKNYGSHGT  282 (760)
Q Consensus       203 A~~~~~~~iv~~Ll~~~~~~~~~~d~~g~tpL~~A~~~~~~~~s~~~l~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~  282 (760)
                      |+..|+.+++++|++++++ ++..+..|.||||+|+..++       .++++.|+..|++++..+..             
T Consensus       153 A~~~g~~~~v~~Ll~~g~~-~~~~~~~g~t~L~~A~~~~~-------~~~v~~Ll~~g~~~~~~~~~-------------  211 (437)
T 1n11_A          153 AAKYGKVRVAELLLERDAH-PNAAGKNGLTPLHVAVHHNN-------LDIVKLLLPRGGSPHSPAWN-------------  211 (437)
T ss_dssp             HHHTTCHHHHHHHHHTTCC-TTCCCSSCCCHHHHHHHTTC-------HHHHHHHGGGTCCSCCCCTT-------------
T ss_pred             HHHcCCHHHHHHHHhCCCC-CCCCCCCCCCHHHHHHHcCC-------HHHHHHHHhCCCCCCCcCCC-------------
Confidence            9999999999999999998 99999999999999999997       79999999998866542111             


Q ss_pred             CCCCchhHhHHhHHHHHHHHHHHhhccCCCCCCCCCcCCCcccchhhccccccCCCCCCCCchhHHHHHHHHHHHHHHhc
Q 004346          283 AKFPENYRTCINFFRFIWTSLRILSGLLTKPKDELDEEDPQQNVISREKEDKEDHFCPPNCTTFVLFSKLMMKALLIVLG  362 (760)
Q Consensus       283 ~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  362 (760)
                                                                       +.+|++                .++     .
T Consensus       212 -------------------------------------------------g~t~L~----------------~A~-----~  221 (437)
T 1n11_A          212 -------------------------------------------------GYTPLH----------------IAA-----K  221 (437)
T ss_dssp             -------------------------------------------------CCCHHH----------------HHH-----H
T ss_pred             -------------------------------------------------CCCHHH----------------HHH-----H
Confidence                                                             011111                000     0


Q ss_pred             cchhhHHHHHHHHHHhHHHHHHHHHHHhcc-ccccccCCCCCCCCcccCCCCCCCCCCCCCCCCCCCccccccccccCCc
Q 004346          363 IGIWRISRIKEKKVRHKWAYLVMKELVQCA-SLYKYDDNGQNPENSRLDNKHGEPFLVPGARPVPENTETSQKNIVLSTP  441 (760)
Q Consensus       363 ~~~~~~~~~~~~~~~~~~~~~il~~Ll~~~-~~~~~d~~G~tpl~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~  441 (760)
                                      ....++++.|++.+ +.+..+..|.||++.++..+.          ..+++++.+.+.      
T Consensus       222 ----------------~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~----------~~~v~~Ll~~~~------  269 (437)
T 1n11_A          222 ----------------QNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGH----------AEMVALLLSKQA------  269 (437)
T ss_dssp             ----------------TTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHHHTTC----------HHHHHHHHTTTC------
T ss_pred             ----------------cCCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHHCCC----------HHHHHHHHhcCC------
Confidence                            11247889999987 566678889999988875433          334444444433      


Q ss_pred             cchhcccccCCCcHHHHHHhcChHHHHHHHHHhCCccccccccCCCchHHHHHHcCcHHHHHHHHhccchhhhhhccccC
Q 004346          442 EKKNTQQSRRKETPLLIATKTGVLEIVEKILDAFPVAIQDEDANGKNVVLLAVEHRQTHIYELLLKKKMIMENAFRKLDN  521 (760)
Q Consensus       442 ~~~~~~~d~~g~tpLh~Aa~~g~~eiv~~LL~~~~~~i~~~d~~G~T~Lh~A~~~~~~~iv~~Ll~~~a~~~~~in~~D~  521 (760)
                        ..+..|..|.||||+|+..|+.+++++|+++ +.+++.+|..|+||||+|+.+|+.++|++|+++|+    ++|.+|.
T Consensus       270 --~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~-g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~ga----d~n~~~~  342 (437)
T 1n11_A          270 --NGNLGNKSGLTPLHLVAQEGHVPVADVLIKH-GVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQA----DVNAKTK  342 (437)
T ss_dssp             --CTTCCCTTCCCHHHHHHHHTCHHHHHHHHHH-TCCTTCCCSSCCCHHHHHHHSSCSHHHHHHHHTTC----CTTCCCT
T ss_pred             --CCCCCCCCCCCHHHHHHHcCCHHHHHHHHhC-CccCCCCCCCCCCHHHHHHHcCcHHHHHHHHhcCC----CCCCCCC
Confidence              2346788999999999999999999999985 89999999999999999999999999999999999    9999999


Q ss_pred             CCCchhhHHhhcCCCCCCCCCchhHHHHHHHHHHHHHHHhcCCccchhccccCCCCccchhhhhh
Q 004346          522 QGNSALHYAAMFENHRPSSLIPGAALQMQWEIKWYKYVKESMPQNFFVRYNNNGQTPKELFTETH  586 (760)
Q Consensus       522 ~G~T~LhlAa~~g~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~g~tp~~i~~~~~  586 (760)
                      .|+||||+|++.|+.+++++|                ++.   ....+.+|.+|+||++++.+..
T Consensus       343 ~g~t~L~~A~~~g~~~iv~~L----------------l~~---ga~~~~~~~~g~t~l~~A~~~g  388 (437)
T 1n11_A          343 LGYSPLHQAAQQGHTDIVTLL----------------LKN---GASPNEVSSDGTTPLAIAKRLG  388 (437)
T ss_dssp             TSCCHHHHHHHTTCHHHHHHH----------------HHT---TCCSCCCCSSSCCHHHHHHHTT
T ss_pred             CCCCHHHHHHHCChHHHHHHH----------------HHC---cCCCCCCCCCCCCHHHHHHHcC
Confidence            999999999999987766211                111   1224678999999999986653



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 760
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-15
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-12
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-11
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-07
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 8e-11
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-09
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.004
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.003
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-08
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-06
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.003
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.003
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 9e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 9e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.003
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.001
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.003
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 75.4 bits (184), Expect = 6e-15
 Identities = 39/149 (26%), Positives = 67/149 (44%), Gaps = 10/149 (6%)

Query: 90  TALHLAAASGHSDVVCRLVETMGENESNILKIQNNRGNTALHLAAALGNVEMCRCMASKD 149
           T LH+A+  GH  +V  L++      ++   + N +  T LH+AA  G+ E+ + +    
Sbjct: 2   TPLHVASFMGHLPIVKNLLQ----RGASP-NVSNVKVETPLHMAARAGHTEVAKYLLQNK 56

Query: 150 PKLVGARNKDSETPLFLAALNGKKAAFLCLHFLSHDKDSSLGRKSNGDTILHAAISGDYF 209
            K V A+ KD +TPL  AA  G       L  L ++ + +L   +    +  AA  G   
Sbjct: 57  AK-VNAKAKDDQTPLHCAARIGHTNMVKLL--LENNANPNLATTAGHTPLHIAAREGHVE 113

Query: 210 SLAFHIIRCYPDLVNCVNENGLSPLHILA 238
           +     +        C+ + G +PLH+ A
Sbjct: 114 T--VLALLEKEASQACMTKKGFTPLHVAA 140


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query760
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.98
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.93
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.92
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.91
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.9
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.9
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.9
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.9
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.87
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.86
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.86
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.85
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.85
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.84
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.81
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=9e-43  Score=378.76  Aligned_cols=346  Identities=19%  Similarity=0.203  Sum_probs=255.5

Q ss_pred             hHHHHHHHHcCCHHHHHHHHHcCCCCcccccCCCCCcHHHHHHHcCCHHHHHHHHHhhCcCCccccccccCCCChHHHHH
Q 004346           54 IDNLFESAMRGHWDHIVQAYESNPMSQEAKITKSEDTALHLAAASGHSDVVCRLVETMGENESNILKIQNNRGNTALHLA  133 (760)
Q Consensus        54 ~~~L~~Aa~~g~~~~v~~lL~~~~~~~~~~~d~~g~t~Lh~A~~~g~~~~v~~Ll~~~~~~~~~~~~~~d~~g~TpLh~A  133 (760)
                      +||||.||..|+.+.|+.+++.  |++++..|..|+||||+||..|+.++|++|+++|++     ++.+|..|+||||+|
T Consensus         1 ~TpL~~Aa~~g~~~~v~~Ll~~--g~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gad-----i~~~~~~g~t~L~~A   73 (408)
T d1n11a_           1 LTPLHVASFMGHLPIVKNLLQR--GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAK-----VNAKAKDDQTPLHCA   73 (408)
T ss_dssp             CCHHHHHHHHTCHHHHHHHHHT--TCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCC-----SSCCCTTSCCHHHHH
T ss_pred             CChHHHHHHCcCHHHHHHHHHC--CCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCcCC-----CCCCCCCCCCHHHHH
Confidence            4899999999999999999998  788999999999999999999999999999999988     899999999999999


Q ss_pred             HHcCCHHHHHHHHhcCCCc--------------------------------cCCCCCCCCcHHHHHHHcCChHHHHHHHh
Q 004346          134 AALGNVEMCRCMASKDPKL--------------------------------VGARNKDSETPLFLAALNGKKAAFLCLHF  181 (760)
Q Consensus       134 a~~g~~~~v~~Ll~~~~~~--------------------------------~~~~~~~g~tpL~~A~~~g~~~~v~~Ll~  181 (760)
                      +..|+.+++++|+..+++.                                ....+.++.++++.|+..++.+++++|++
T Consensus        74 ~~~g~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~  153 (408)
T d1n11a_          74 ARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLE  153 (408)
T ss_dssp             HHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHH
T ss_pred             HHcCCHHHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHH
Confidence            9999999999999765541                                34455667777777777777777777777


Q ss_pred             cCCCCCCcccCCCCCChHHHHHHHcCCHHHHHHHHHhCCCCccccccCCCcHHHHHhcCCCCCCccchhHHHHHHHhccc
Q 004346          182 LSHDKDSSLGRKSNGDTILHAAISGDYFSLAFHIIRCYPDLVNCVNENGLSPLHILAGKPNAFRSSSCLGLFDLMLYDCV  261 (760)
Q Consensus       182 ~~~~~~~~~~~~~~g~t~Lh~A~~~~~~~iv~~Ll~~~~~~~~~~d~~g~tpL~~A~~~~~~~~s~~~l~~~~~ll~~~~  261 (760)
                      .+.+   ++..+.+|.+|||+|+..|+.+++++|++++++ ++..+..|.||+|++.....       .+....++..+.
T Consensus       154 ~~~~---~~~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~-~~~~~~~~~t~l~~~~~~~~-------~~~~~~l~~~~~  222 (408)
T d1n11a_         154 RDAH---PNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGS-PHSPAWNGYTPLHIAAKQNQ-------VEVARSLLQYGG  222 (408)
T ss_dssp             TTCC---TTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCC-SCCCCTTCCCHHHHHHHTTC-------HHHHHHHHHTTC
T ss_pred             cCCC---CCcCCCcCchHHHHHHHcCCHHHHHHHHhcCCc-ccccCCCCCCcchhhhccch-------hhhhhhhhhccc
Confidence            7665   555666777777777777777777777777776 67777777777777776654       345555544333


Q ss_pred             CchhhhhhhcccccCCCCCCCCCCCchhHhHHhHHHHHHHHHHHhhccCCCCCCCCCcCCCcccchhhccccccCCCCCC
Q 004346          262 SVDELREEKYDYSKNYGSHGTAKFPENYRTCINFFRFIWTSLRILSGLLTKPKDELDEEDPQQNVISREKEDKEDHFCPP  341 (760)
Q Consensus       262 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  341 (760)
                      .....+..+             ..+..+....                                                
T Consensus       223 ~~~~~~~~~-------------~t~l~~a~~~------------------------------------------------  241 (408)
T d1n11a_         223 SANAESVQG-------------VTPLHLAAQE------------------------------------------------  241 (408)
T ss_dssp             CTTCCCTTC-------------CCHHHHHHHT------------------------------------------------
T ss_pred             cccccCCCC-------------CCHHHHHHHh------------------------------------------------
Confidence            221100000             0000000000                                                


Q ss_pred             CCchhHHHHHHHHHHHHHHhccchhhHHHHHHHHHHhHHHHHHHHHHHhcc-ccccccCCCCCCCCcccCCCCCCCCCCC
Q 004346          342 NCTTFVLFSKLMMKALLIVLGIGIWRISRIKEKKVRHKWAYLVMKELVQCA-SLYKYDDNGQNPENSRLDNKHGEPFLVP  420 (760)
Q Consensus       342 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~il~~Ll~~~-~~~~~d~~G~tpl~~~~~~~~~~~~~~~  420 (760)
                                                            ...++++.+++.. .....|..|.+|++.++....       
T Consensus       242 --------------------------------------~~~~~~~~~~~~~~~~~~~~~~g~~~l~~a~~~~~-------  276 (408)
T d1n11a_         242 --------------------------------------GHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGH-------  276 (408)
T ss_dssp             --------------------------------------TCHHHHHHHHTTTCCTTCCCTTCCCHHHHHHHHTC-------
T ss_pred             --------------------------------------CcHhHhhhhhccccccccccCCCCChhhhhhhcCc-------
Confidence                                                  0123444444444 333345555555554443221       


Q ss_pred             CCCCCCCCccccccccccCCccchhcccccCCCcHHHHHHhcChHHHHHHHHHhCCccccccccCCCchHHHHHHcCcHH
Q 004346          421 GARPVPENTETSQKNIVLSTPEKKNTQQSRRKETPLLIATKTGVLEIVEKILDAFPVAIQDEDANGKNVVLLAVEHRQTH  500 (760)
Q Consensus       421 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~d~~g~tpLh~Aa~~g~~eiv~~LL~~~~~~i~~~d~~G~T~Lh~A~~~~~~~  500 (760)
                         ..+.+++.+.+.        +.+..+..+.||||.|+..|+.++++.+++ .|+++|.+|.+|+||||+||++|+.+
T Consensus       277 ---~~i~~~Ll~~g~--------~~~~~~~~~~t~L~~~~~~~~~~~~~~ll~-~g~~in~~d~~G~T~Lh~A~~~g~~~  344 (408)
T d1n11a_         277 ---VPVADVLIKHGV--------MVDATTRMGYTPLHVASHYGNIKLVKFLLQ-HQADVNAKTKLGYSPLHQAAQQGHTD  344 (408)
T ss_dssp             ---HHHHHHHHHHTC--------CTTCCCSSCCCHHHHHHHSSCSHHHHHHHH-TTCCTTCCCTTSCCHHHHHHHTTCHH
T ss_pred             ---HHHHHHHHHCCC--------ccccccccccccchhhcccCcceeeeeecc-ccccccccCCCCCCHHHHHHHcCCHH
Confidence               122222222221        223566789999999999999999999997 58999999999999999999999999


Q ss_pred             HHHHHHhccchhhhhhccccCCCCchhhHHhhcCCCCCC
Q 004346          501 IYELLLKKKMIMENAFRKLDNQGNSALHYAAMFENHRPS  539 (760)
Q Consensus       501 iv~~Ll~~~a~~~~~in~~D~~G~T~LhlAa~~g~~~~~  539 (760)
                      +|++|+++|+    ++|.+|++|+||||+|++.|+.+++
T Consensus       345 iv~~Ll~~GA----d~n~~d~~G~t~L~~A~~~~~~~iv  379 (408)
T d1n11a_         345 IVTLLLKNGA----SPNEVSSDGTTPLAIAKRLGYISVT  379 (408)
T ss_dssp             HHHHHHHTTC----CSCCCCSSSCCHHHHHHHTTCHHHH
T ss_pred             HHHHHHHCCC----CCCCCCCCCCCHHHHHHHcCCHHHH
Confidence            9999999999    9999999999999999999997776



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure