Citrus Sinensis ID: 004365

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------76
MATGIDIDQLKKDLFKRAMKGEWKEVVKNYEKDERIHKVKITRSGGTALHIAVSDGQEEIVEDLVRIIKEKQQLEALTIGDERGSTPLHIAAGLGNVSMCKCIATADRKLIGERNHENETPFFLAALHGHKDAFLCLHCLCASVDDGYTYSRRNDGETILHCAISGDYFDLAFQIIHLYEKLVNSVNEKGVSPLHVLATKPNAFRSGSHLGRCIGTIYHCIFVDKLQEETSYDQYQLETSKKQTNCPENYETCLNFIRLLKTMVIVLSNRGNTKKERDAEDPERSKGNDGTGDQGEESRHNIGAQGHQFFPPNYGTCFEFVKLVSKAMLVILGLGSTKIRKIRDKKQKHTWSVQILDELLRRASLYEYDDDGGKPLRRPSSQAEEDETSPYAIVDGGDTDAVLEGYQQPDTSLTDHNVVADTHKLSRNNGKNSEDRNEGGKTGSTIPDMAKRETPILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKPWLIPGAALQMQWELRWYEFVKESMPFHFFVRYNKQNKSPKDVFTETHKELVQAGGQWLTNTSESCSVVAALIATVAFATSATVPGGVKEDSGEPTLENQPAFNVFAISSLVALCFSVTAVVMFLAILTSRYQEGDFRSDLPGKLLLGLTSLFVSIASMLVSFCAGHFFVLREKLKYAAFPVYAVTCLPVTLFAIAQFPLYFDLIWATFKKVPQRSYKSIPL
cccccccccccHHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHcHHHHHHcccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHccccccccccccccHHHHccccHHHHcccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHccccccccccccccccccccccccccccHHHHHcccccHHHHccccccccccccccccccHHHHHHcccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
ccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccHcEEEEccccccEEEHEEccccHHHHHHHHHHcccccHHHHHHccccccccHHHHHHHHccHHHHHHHHHHcccHccccccccccHHHHHHHHccHHHHHHHHHHcccHHHHcHcccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccccccHHHHHcccccccccccccHHHHHHHEEcEEcccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEccccccccccccccccccccccHHccccccHHHHHHHccccccccccccEEcccccccccccccccccccccccccccccccccccHHHHHHHHcHHHHHHHHHHHccHHHHccccccccEEEEHHHccHHHHHHHHHHccHHHHHHHHHHccccccEEHHEccccccccccccHHHHHHHHHHHHHHHHHHHccccHEHEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHEHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
MATGIDIDQLKKDLFKRAMKGEWKEVVKNYEKDERIHKVkitrsggtalHIAVSDGQEEIVEDLVRIIKEKQQLEAltigdergstplhiaaglgnvsmcKCIATADRkligernhenetpFFLAALHGHKDAFLCLHCLCAsvddgytysrrndgetilhcaisgdyfDLAFQIIHLYEKLVNSvnekgvsplhvlatkpnafrsgshlgrcigTIYHCIFvdklqeetsydQYQLETskkqtncpenyETCLNFIRLLKTMVIVLSnrgntkkerdaedperskgndgtgdqgeesrhnigaqghqffppnygtcFEFVKLVSKAMLVILGLgstkirkirdkkqkhtWSVQILDELLRRASlyeydddggkplrrpssqaeedetspyaivdggdtdavlegyqqpdtsltdhnvvadthklsrnngknsedrneggktgstipdmakretPILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATlgdhkpwlipgaALQMQWELRWYEFVKESMPFHFFVrynkqnkspkdvFTETHKELVQAGGQWLTNTSESCSVVAALIATVAFatsatvpggvkedsgeptlenqpafnVFAISSLVALCFSVTAVVMFLAILTSryqegdfrsdlpgklLLGLTSLFVSIASMLVSFCAGHFFVLREKlkyaafpvyavTCLPVTLFAIAQFPLYFDLIWATFkkvpqrsyksipl
matgididqlkkdlfkramkgewkevvknyekderihkvkitrsggtalhiavsdgqEEIVEDLVRIIKEKQQLEAltigdergsTPLHIAAGLGNVSMCKCIATADRKLIGERNHENETPFFLAALHGHKDAFLCLHCLCASVDDGYTYSRRNDGETILHCAISGDYFDLAFQIIHLYEKLVNSVNEKGVSPLHVLATKPNAFRSGSHLGRCIGTIYHCIFVDKLQEETSYDQYQLEtskkqtncpeNYETCLNFIRLLKTMVIVLsnrgntkkerdaedperskgndgtgdqGEESRHNIGAQGHQFFPPNYGTCFEFVKLVSKAMLVILGlgstkirkirdkkqkhtwsvqiLDELLRRASLYeydddggkplrrpssqaeedetspyaivdGGDTDAVLEGYQQPdtsltdhnvvadthklsrnngknsedrneggktgstipdmakRETPILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKPWLIPGAALQMQWELRWYEFVKESMPFHFFVRYNKQNKSPKDVFTETHKELVQAGGQWLTNTSESCSVVAALIATVAFATSATVPGGVKEDSGEPTLENQPAFNVFAISSLVALCFSVTAVVMFLAILTSRYQEGDFRSDLPGKLLLGLTSLFVSIASMLVSFCAGHFFVLREKLKYAAFPVYAVTCLPVTLFAIAQFPLYFDLIWATFkkvpqrsyksipl
MATGIDIDQLKKDLFKRAMKGEWKEVVKNYEKDERIHKVKITRSGGTALHIAVSDGQEEIVEDLVRIIKEKQQLEALTIGDERGSTPLHIAAGLGNVSMCKCIATADRKLIGERNHENETPFFLAALHGHKDAFLCLHCLCASVDDGYTYSRRNDGETILHCAISGDYFDLAFQIIHLYEKLVNSVNEKGVSPLHVLATKPNAFRSGSHLGRCIGTIYHCIFVDKLQEETSYDQYQLETSKKQTNCPENYETCLNFIRLLKTMVIVLSNRGNTKKERDAEDPERSKGNDGTGDQGEESRHNIGAQGHQFFPPNYGTCFEFVKLVSKAMLVILGLGSTKIRKIRDKKQKHTWSVQILDELLRRASLYEYDDDGGKPLRRPSSQAEEDETSPYAIVDGGDTDAVLEGYQQPDTSLTDHNVVADTHKLSRNNGKNSEDRNEGGKTGSTIPDMAKRETPILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKPWLIPGAALQMQWELRWYEFVKESMPFHFFVRYNKQNKSPKDVFTETHKELVQAGGQWLTNTSESCSVVAALIATVAFATSATVPGGVKEDSGEPTLENQPAFNVFAISSLVALCFSVTAVVMFLAILTSRYQEGDFRSDlpgklllgltslFVSIASMLVSFCAGHFFVLREKLKYAAFPVYAVTCLPVTLFAIAQFPLYFDLIWATFKKVPQRSYKSIPL
***********KDLFKRAMKGEWKEVVKNYEKDERIHKVKITRSGGTALHIAVSDGQEEIVEDLVRIIKEKQQLEALTIGDERGSTPLHIAAGLGNVSMCKCIATADRKLIGERNHENETPFFLAALHGHKDAFLCLHCLCASVDDGYTYSRRNDGETILHCAISGDYFDLAFQIIHLYEKLVNSVNEKGVSPLHVLATKPNAFRSGSHLGRCIGTIYHCIFVDKLQEETSYDQYQLE****QTNCPENYETCLNFIRLLKTMVIVLS*************************************GHQFFPPNYGTCFEFVKLVSKAMLVILGLGSTKIRKIRDKKQKHTWSVQILDELLRRASLYEY**************************************************************************************PILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKPWLIPGAALQMQWELRWYEFVKESMPFHFFVRYNKQN***KDVFTETHKELVQAGGQWLTNTSESCSVVAALIATVAFATSATVP***************PAFNVFAISSLVALCFSVTAVVMFLAILTSRYQEGDFRSDLPGKLLLGLTSLFVSIASMLVSFCAGHFFVLREKLKYAAFPVYAVTCLPVTLFAIAQFPLYFDLIWATFKKV**********
*ATGIDIDQLKKDLFKRAMKGEWKEVVKNYEKDERIHKVKITRSGGTALHIAVSDGQEEIVEDLVRIIKEKQQLEALTIGDERGSTPLHIAAGLGNVSMCKCIATADRKLIGERNHENETPFFLAALHGHKDAFLCLHCLCASVDDGYTYSRRNDGETILHCAISGDYFDLAFQIIHLYEKLVNSVNEKGVSPLHVLATKPNAFRSGSHLGRCIGTIYHCIFVDKLQEETSYDQYQLETSKKQTNCPENYETCLNFIRLLKTMVIVLSNRGNTKKERDAEDPERSKGNDGTGDQGEESRHNIGAQGHQFFPPNYGTCFEFVKLVSKAMLVILGLGSTKIRKIRDKKQKHTWSVQILDELLRRASLYEYDDDGGKPLRRPSSQAEEDETSPYAIVDGGDTDAVLEGYQQPDTSLTDHNVVADTHKLSRNNGKNSEDRNEGGKTGSTIPDMAKRETPILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKPWLIPGAALQMQWELRWYEFVKESMPFHFFVRYNKQNKSPKD***************WLTNTSESCSVVAALIATVAFATSATVPGGVKEDSGEPTLENQPAFNVFAISSLVALCFSVTAVVMFLAILTSRYQEGDFRSDLPGKLLLGLTSLFVSIASMLVSFCAGHFFVLREKLKYAAFPVYAVTCLPVTLFAIAQFPLYFDLIWATFKKVPQRSY*S*P*
MATGIDIDQLKKDLFKRAMKGEWKEVVKNYEKDERIHKVKITRSGGTALHIAVSDGQEEIVEDLVRIIKEKQQLEALTIGDERGSTPLHIAAGLGNVSMCKCIATADRKLIGERNHENETPFFLAALHGHKDAFLCLHCLCASVDDGYTYSRRNDGETILHCAISGDYFDLAFQIIHLYEKLVNSVNEKGVSPLHVLATKPNAFRSGSHLGRCIGTIYHCIFVDKLQEETSYDQYQLETSKKQTNCPENYETCLNFIRLLKTMVIVLSNRG***************************RHNIGAQGHQFFPPNYGTCFEFVKLVSKAMLVILGLGSTKIR**********WSVQILDELLRRASLYEYDDD****************TSPYAIVDGGDTDAVLEGYQQPDTSLTDHNVVADTHKLS****************GSTIPDMAKRETPILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKPWLIPGAALQMQWELRWYEFVKESMPFHFFVRYNKQNKSPKDVFTETHKELVQAGGQWLTNTSESCSVVAALIATVAFATSATVPGGVKEDSGEPTLENQPAFNVFAISSLVALCFSVTAVVMFLAILTSRYQEGDFRSDLPGKLLLGLTSLFVSIASMLVSFCAGHFFVLREKLKYAAFPVYAVTCLPVTLFAIAQFPLYFDLIWATFKKV**********
****IDIDQLKKDLFKRAMKGEWKEVVKNYEKDERIHKVKITRSGGTALHIAVSDGQEEIVEDLVRIIKEKQQLEALTIGDERGSTPLHIAAGLGNVSMCKCIATADRKLIGERNHENETPFFLAALHGHKDAFLCLHCLCASVDDGYTYSRRNDGETILHCAISGDYFDLAFQIIHLYEKLVNSVNEKGVSPLHVLATKPNAFRSGSHLGRCIGTIYHCIFVDKLQEETSYDQYQLETSKKQTNCPENYETCLNFIRLLKTMVIVLSNR************************************HQFFPPNYGTCFEFVKLVSKAMLVILGLGSTKIRKIRDKKQKHTWSVQILDELLRRASLYEYDDDGG****************P*******D*DAVL*******************************************PDMAKRETPILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKPWLIPGAALQMQWELRWYEFVKESMPFHFFVRYNKQNKSPKDVFTETHKELVQAGGQWLTNTSESCSVVAALIATVAFATSATVPGGVKEDSGEPTLENQPAFNVFAISSLVALCFSVTAVVMFLAILTSRYQEGDFRSDLPGKLLLGLTSLFVSIASMLVSFCAGHFFVLREKLKYAAFPVYAVTCLPVTLFAIAQFPLYFDLIWATFKKVPQRSY*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATGIDIDQLKKDLFKRAMKGEWKEVVKNYEKDERIHKVKITRSGGTALHIAVSDGQEEIVEDLVRIIKEKQQLEALTIGDERGSTPLHIAAGLGNVSMCKCIATADRKLIGERNHENETPFFLAALHGHKDAFLCLHCLCASVDDGYTYSRRNDGETILHCAISGDYFDLAFQIIHLYEKLVNSVNEKGVSPLHVLATKPNAFRSGSHLGRCIGTIYHCIFVDKLQEETSYDQYQLETSKKQTNCPENYETCLNFIRLLKTMVIVLSNRGNTKKERDAEDPERSKGNDGTGDQGEESRHNIGAQGHQFFPPNYGTCFEFVKLVSKAMLVILGLGSTKIRKIRDKKQKHTWSVQILDELLRRASLYEYDDDGGKPLRRPSSQAEEDETSPYAIVDGGDTDAVLEGYQQPDTSLTDHNVVADTHKLSRNNGKNSEDRNEGGKTGSTIPDMAKRETPILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKPWLIPGAALQMQWELRWYEFVKESMPFHFFVRYNKQNKSPKDVFTETHKELVQAGGQWLTNTSESCSVVAALIATVAFATSATVPGGVKEDSGEPTLENQPAFNVFAISSLVALCFSVTAVVMFLAILTSRYQEGDFRSDLPGKLLLGLTSLFVSIASMLVSFCAGHFFVLREKLKYAAFPVYAVTCLPVTLFAIAQFPLYFDLIWATFKKVPQRSYKSIPL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query759 2.2.26 [Sep-21-2011]
Q9C7A2590 Ankyrin repeat-containing no no 0.330 0.425 0.254 4e-10
Q63369522 Nuclear factor NF-kappa-B yes no 0.189 0.275 0.288 3e-07
Q9XZC01413 Alpha-latrocrustotoxin-Lt N/A no 0.162 0.087 0.296 1e-06
P0C6S7 1260 Ankyrin repeat and steril no no 0.185 0.111 0.314 3e-06
P25799971 Nuclear factor NF-kappa-B yes no 0.189 0.148 0.282 4e-06
Q8BG95976 Protein phosphatase 1 reg no no 0.142 0.110 0.314 5e-06
Q7Z6G8 1248 Ankyrin repeat and steril yes no 0.185 0.112 0.314 5e-06
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus no no 0.194 0.037 0.269 5e-06
Q12955 4377 Ankyrin-3 OS=Homo sapiens no no 0.175 0.030 0.308 5e-06
Q8BIZ1 1259 Ankyrin repeat and steril no no 0.185 0.111 0.314 6e-06
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function desciption
 Score = 67.4 bits (163), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 132/311 (42%), Gaps = 60/311 (19%)

Query: 458 IAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFR 517
           +AA+ G  E+++ +L   P     I+ + +  + +AV+ +   V +LLL       ++  
Sbjct: 238 LAARQGHVEVIKALLSKDPQLARRIDKKGQTALHMAVKGQSSEVVKLLLDA---DPAIVM 294

Query: 518 KVDDQGNSALHLAA--------------------TLG-DHKPWLIPGAALQMQWELRWYE 556
           + D   N+ALH+A                     TL  DHK  L     L +  E     
Sbjct: 295 QPDKSCNTALHVATRKKRAEIVELLLSLPDTNANTLTRDHKTALDIAEGLPLSEE---SS 351

Query: 557 FVKESMPFHFFVRYNKQNKSPKDVFTET-------------------------HKELVQA 591
           ++KE +     +R N+ N+ P+D    T                          KEL + 
Sbjct: 352 YIKECLARSGALRANELNQ-PRDELRSTVTQIKNDVHIQLEQTKRTNKNVHNISKELRKL 410

Query: 592 GGQWLTNTSESCSVVAALIATVAFATSATVPGGVKEDSGEPTLENQPAFNVFAISSLVAL 651
             + + N + S +VVA L ATVAFA   TVPGG   D G   +  + +F +F I + +AL
Sbjct: 411 HREGINNATNSVTVVAVLFATVAFAAIFTVPGGDNND-GSAVVVGRASFKIFFIFNALAL 469

Query: 652 CFSVTAVVMFLAILTSRYQEGDFRSDLPGKLLLGLTSLFVSIASMLVSFCAGHFFVLREK 711
             S+  VV+ + ++    +      ++  KL+  L S+  S+A     F A  + V+  K
Sbjct: 470 FTSLAVVVVQITLVRGETKAEKRVVEVINKLMW-LASMCTSVA-----FLASSYIVVGRK 523

Query: 712 LKYAAFPVYAV 722
            ++AA  V  V
Sbjct: 524 NEWAAELVTVV 534

Arabidopsis thaliana (taxid: 3702)
>sp|Q63369|NFKB1_RAT Nuclear factor NF-kappa-B p105 subunit (Fragment) OS=Rattus norvegicus GN=Nfkb1 PE=2 SV=1 Back     alignment and function description
>sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 Back     alignment and function description
>sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 Back     alignment and function description
>sp|P25799|NFKB1_MOUSE Nuclear factor NF-kappa-B p105 subunit OS=Mus musculus GN=Nfkb1 PE=1 SV=2 Back     alignment and function description
>sp|Q8BG95|MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus GN=Ppp1r12b PE=1 SV=2 Back     alignment and function description
>sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query759
359479721749 PREDICTED: uncharacterized protein LOC10 0.949 0.962 0.578 0.0
147855983 1513 hypothetical protein VITISV_044165 [Viti 0.981 0.492 0.555 0.0
359476634 969 PREDICTED: uncharacterized protein LOC10 0.932 0.730 0.549 0.0
359495447733 PREDICTED: uncharacterized protein LOC10 0.901 0.933 0.546 0.0
449490509829 PREDICTED: uncharacterized LOC101211501 0.969 0.887 0.509 0.0
356546544725 PREDICTED: uncharacterized protein LOC10 0.911 0.954 0.521 0.0
255554112786 ankyrin repeat-containing protein, putat 0.963 0.930 0.501 0.0
449444907795 PREDICTED: uncharacterized protein LOC10 0.930 0.888 0.492 0.0
147841950714 hypothetical protein VITISV_026950 [Viti 0.895 0.952 0.494 0.0
359479729826 PREDICTED: uncharacterized protein LOC10 0.949 0.872 0.465 0.0
>gi|359479721|ref|XP_002272096.2| PREDICTED: uncharacterized protein LOC100255529 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/773 (57%), Positives = 560/773 (72%), Gaps = 52/773 (6%)

Query: 6   DIDQLKKDLFKRAMKGEWKEVVKNYEKDERIHKVKITRSGGTALHIAVSDGQEEIVEDLV 65
           +++ +KK LF+ AM+G+W EVV  Y+++E +H  KIT+SG TALH+AVSD Q  IVE L+
Sbjct: 10  NMEVIKKKLFRSAMQGKWDEVVNIYKENEEVHMAKITKSGDTALHVAVSDDQARIVEQLL 69

Query: 66  RIIKEKQQL-EALTIGDERGSTPLHIAAGLGNVSMCKCIATADRKLIGERNHENETPFFL 124
            II+ K ++ E L I +ERG+T LH+AA +G++ MCKCIA A   LIG RNH++ETP FL
Sbjct: 70  LIIRGKAKVKEVLKIQNERGNTILHLAASMGSMEMCKCIADALPDLIGARNHDSETPLFL 129

Query: 125 AALHGHKDAFLCLHCLCASVDDGYTYSRRNDGETILHCAISGDYFDLAFQIIHLYEKLVN 184
           AALHG K+AF+CL  +C  +D G TY RRNDG+TILHCAI+G+YFDLAFQII  Y+ LVN
Sbjct: 130 AALHGKKEAFICLDEICG-LDKGNTYCRRNDGDTILHCAIAGEYFDLAFQIISRYKNLVN 188

Query: 185 SVNEKGVSPLHVLATKPNAFRSGSHLGRCIGTIYHCIFVDKLQEETSYDQYQLETSKKQT 244
           SVNE+G+SPLH+LATK +AFRSGSH       IYHCIFV+KL+EET    ++ E +   +
Sbjct: 189 SVNEQGLSPLHLLATKHSAFRSGSHFRWFTNIIYHCIFVEKLEEET----FKQEEAISLS 244

Query: 245 NCPENYETCLNFIRLLKTMVIVLSNRGNTKKERDAEDPERSKGNDGTGDQGEESRHNIGA 304
             P +  T                    T  + D EDP  ++ N        +++  + +
Sbjct: 245 YFPFSANT---------------GKDPGTGGQADLEDPSGNQSN-------MKAKGELQS 282

Query: 305 QGHQFFPPNYGTCFEFVKLVSKAMLVILGLGSTKIRKIRDKKQKHTWSVQILDELLRRAS 364
           QGHQ  P NY TCF  +K V KA+LVILG G   ++K+R KK+KH W+ QILDELL  AS
Sbjct: 283 QGHQLIPSNYHTCFNIIKFVFKAILVILGFGFKAVKKVRQKKEKHVWAAQILDELLCHAS 342

Query: 365 LYEYDDDGGKPLRRPSSQAEEDETSPYAIVD--GGDTDAVLEGYQ-------QPDTSLT- 414
            YEY+D+G  P ++PS + + D T+PY+I D  G   D  LE          QP ++   
Sbjct: 343 FYEYEDNGRNP-QQPSQKKDAD-TTPYSISDDHGVSFDNTLESQHLPGGTAAQPSSATNQ 400

Query: 415 ---DHNVVAD-----THKLSRNNGKNSEDRNEGGKTGSTIPDMAKRETPILIAAKNGITE 466
              D    AD       +   +NGKN ++  +  K      +M ++ETP+L+AAKNG+ E
Sbjct: 401 QGEDKGAPADRSSPEAQRKQNDNGKNKKNEQDKKKPS----EMERKETPLLVAAKNGVVE 456

Query: 467 IVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSA 526
           IVE+ILE FPVAIHD + +KKNIVLLAVE RQPHVY+LL+K  ++KD+VFR VD  GNSA
Sbjct: 457 IVERILELFPVAIHDKDYQKKNIVLLAVEYRQPHVYELLVKRKVLKDAVFRHVDIDGNSA 516

Query: 527 LHLAATLGDHKPWLIPGAALQMQWELRWYEFVKESMPFHFFVRYNKQNKSPKDVFTETHK 586
           LHLAA LG++KPWLIPGAALQMQWE++WYEFVK S+P HFFVR N++ ++ KD+FTE H 
Sbjct: 517 LHLAAMLGENKPWLIPGAALQMQWEIKWYEFVKRSVPQHFFVRCNQKGETAKDIFTEKHM 576

Query: 587 ELVQAGGQWLTNTSESCSVVAALIATVAFATSATVPGGVKEDSGEPTLENQPAFNVFAIS 646
           +LVQAGG+WL  TSESCSVVAALIATVAFATS+TVPGGVKE  G PTLE++PAF++FAIS
Sbjct: 577 DLVQAGGEWLFKTSESCSVVAALIATVAFATSSTVPGGVKEKVGTPTLEDEPAFDIFAIS 636

Query: 647 SLVALCFSVTAVVMFLAILTSRYQEGDFRSDLPGKLLLGLTSLFVSIASMLVSFCAGHFF 706
           SLVALCFSV AV+MFLAILTSRYQE DFR  LP KLL+GLTSLFVSIASML+SFCAGH+F
Sbjct: 637 SLVALCFSVNAVIMFLAILTSRYQERDFRIYLPRKLLVGLTSLFVSIASMLISFCAGHYF 696

Query: 707 VLREKLKYAAFPVYAVTCLPVTLFAIAQFPLYFDLIWATFKKVPQRSYKSIPL 759
           VL +KL+Y A  VYAVTCLPV  FA+AQFPLYFDL+WATFKKVPQRSYK  PL
Sbjct: 697 VLMDKLQYTAILVYAVTCLPVIFFAVAQFPLYFDLMWATFKKVPQRSYKVAPL 749

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147855983|emb|CAN82817.1| hypothetical protein VITISV_044165 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359476634|ref|XP_002273692.2| PREDICTED: uncharacterized protein LOC100246246 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495447|ref|XP_002274376.2| PREDICTED: uncharacterized protein LOC100254555 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449490509|ref|XP_004158626.1| PREDICTED: uncharacterized LOC101211501 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356546544|ref|XP_003541685.1| PREDICTED: uncharacterized protein LOC100798360 [Glycine max] Back     alignment and taxonomy information
>gi|255554112|ref|XP_002518096.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223542692|gb|EEF44229.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449444907|ref|XP_004140215.1| PREDICTED: uncharacterized protein LOC101211501 [Cucumis sativus] Back     alignment and taxonomy information
>gi|147841950|emb|CAN67508.1| hypothetical protein VITISV_026950 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359479729|ref|XP_002274084.2| PREDICTED: uncharacterized protein LOC100245924 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query759
TAIR|locus:2080240574 AT3G54070 "AT3G54070" [Arabido 0.376 0.498 0.32 3.6e-44
TAIR|locus:2175413669 AT5G04700 "AT5G04700" [Arabido 0.384 0.436 0.356 4.9e-44
TAIR|locus:2180228625 AT5G04690 "AT5G04690" [Arabido 0.345 0.419 0.356 8.1e-39
TAIR|locus:2175448603 AT5G04730 "AT5G04730" [Arabido 0.384 0.484 0.335 1.2e-37
TAIR|locus:2165174347 AT5G35810 "AT5G35810" [Arabido 0.384 0.841 0.320 4.1e-37
TAIR|locus:2026489543 AT1G07710 "AT1G07710" [Arabido 0.391 0.546 0.250 5.1e-16
TAIR|locus:2046628601 AT2G24600 "AT2G24600" [Arabido 0.123 0.156 0.336 9.3e-16
TAIR|locus:2170081535 AT5G50140 "AT5G50140" [Arabido 0.225 0.319 0.264 2e-12
TAIR|locus:2092522590 ITN1 "INCREASED TOLERANCE TO N 0.329 0.423 0.25 6.8e-15
TAIR|locus:2075009607 AT3G09550 [Arabidopsis thalian 0.204 0.255 0.285 1.2e-14
TAIR|locus:2080240 AT3G54070 "AT3G54070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 372 (136.0 bits), Expect = 3.6e-44, Sum P(2) = 3.6e-44
 Identities = 96/300 (32%), Positives = 160/300 (53%)

Query:   459 AAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRK 518
             AA+ G  EI+  ++ S    +  +++  + +  +A   R  +++ L+ +   +KD +   
Sbjct:   262 AAELGNVEILVILIRSHLDLLWIVDNNNRTLFHVAALYRHENIFSLIYELGGIKDLIASY 321

Query:   519 VDDQG-NSALHLAATLGD-HKPWLIPGAALQMQWELRWYEFVKESMPFHFFVRYNKQNKS 576
              + Q  ++ LHL A L   ++  +  GAAL MQ EL W++ VKE +P  +    N + + 
Sbjct:   322 KEKQSKDTLLHLVARLPPMNRQQVGSGAALHMQKELLWFKAVKEIVPRSYIETKNTKGEL 381

Query:   577 PKDVFTETHKELVQAGGQWLTNTSESCSVVAALIATVAFATSATVPGGVKEDSGE----- 631
               D+FTE H+ L + G +W+  T+ +C + A LIATV FA + T+PGG  +DSG+     
Sbjct:   382 AHDIFTEQHENLRKEGERWMKETATACMLGATLIATVVFAAAITIPGG-NDDSGDKANTL 440

Query:   632 --PTLENQPAFNVFAISSLVALCFSVTAVVMFLAILTSRYQEGDFRSDXXXXXXXXXXXX 689
               P    +  F++F +S  VAL  S+ ++V+FL+I TSRY E DFR D            
Sbjct:   441 GFPNFRKRLLFDIFTLSDSVALFSSMMSIVIFLSIFTSRYAEEDFRYDLPTKLMFGLSAL 500

Query:   690 FVSIASMLVSFCAGHFFVLREKLKYAAFPVYAVTCLPVTLFAIAQFPLYFDLIWATFKKV 749
             F+SI SM+++F      +  EK   A+  +  ++CL  +L A+    LYF L + T + V
Sbjct:   501 FISIISMILAFTFSMILIRVEK---ASLSLVLISCL-ASLTALTFAYLYFHLWFNTLRSV 556
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2175413 AT5G04700 "AT5G04700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180228 AT5G04690 "AT5G04690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175448 AT5G04730 "AT5G04730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165174 AT5G35810 "AT5G35810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026489 AT1G07710 "AT1G07710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046628 AT2G24600 "AT2G24600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170081 AT5G50140 "AT5G50140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092522 ITN1 "INCREASED TOLERANCE TO NACL" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query759
pfam13962114 pfam13962, PGG, Domain of unknown function 1e-33
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-09
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-08
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-07
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-07
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-04
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-04
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 0.001
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.001
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information 
 Score =  124 bits (315), Expect = 1e-33
 Identities = 47/120 (39%), Positives = 65/120 (54%), Gaps = 13/120 (10%)

Query: 594 QWLTNTSESCSVVAALIATVAFATSATVPGGVKEDS-----GEPTLENQP-AFNVFAISS 647
           +WL  T  S  VVA LIATV FA   T PGG  +D      G P L  +P  F  F +S+
Sbjct: 2   EWLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVSN 61

Query: 648 LVALCFSVTAVVMFLAILTSRYQEGDFRSDLPGKLLLGLTSLFVSIASMLVSFCAGHFFV 707
            +A   S+ AV++ L I+        F   LP +LL  LT L++S+ S++V+F AG + V
Sbjct: 62  TIAFVASLVAVILLLYIV------PSFSRRLP-RLLALLTLLWLSLLSLMVAFAAGSYRV 114

The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 759
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.98
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.98
PHA02792631 ankyrin-like protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02795437 ankyrin-like protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02795437 ankyrin-like protein; Provisional 99.95
TIGR00870743 trp transient-receptor-potential calcium channel p 99.95
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.95
TIGR00870743 trp transient-receptor-potential calcium channel p 99.94
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.94
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.93
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.93
PF13962113 PGG: Domain of unknown function 99.93
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.93
PLN03192823 Voltage-dependent potassium channel; Provisional 99.92
PLN03192823 Voltage-dependent potassium channel; Provisional 99.92
KOG0514452 consensus Ankyrin repeat protein [General function 99.9
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.9
PHA02743166 Viral ankyrin protein; Provisional 99.9
PHA02741169 hypothetical protein; Provisional 99.89
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.89
PHA02743166 Viral ankyrin protein; Provisional 99.88
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.88
PHA02741169 hypothetical protein; Provisional 99.87
PHA02884300 ankyrin repeat protein; Provisional 99.87
KOG0514452 consensus Ankyrin repeat protein [General function 99.87
PHA02736154 Viral ankyrin protein; Provisional 99.87
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.86
PHA02736154 Viral ankyrin protein; Provisional 99.86
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.84
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.83
PHA02884300 ankyrin repeat protein; Provisional 99.83
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.81
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.74
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.74
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.72
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.72
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.71
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.7
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.62
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.58
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.57
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.56
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.52
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.49
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.48
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.45
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.44
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.43
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.43
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.43
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.42
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.42
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 99.02
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.86
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.81
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.79
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.79
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.78
PF1360630 Ank_3: Ankyrin repeat 98.78
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.73
KOG3609822 consensus Receptor-activated Ca2+-permeable cation 98.71
PF1360630 Ank_3: Ankyrin repeat 98.7
KOG0522560 consensus Ankyrin repeat protein [General function 98.63
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.62
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.61
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.6
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.59
KOG0522560 consensus Ankyrin repeat protein [General function 98.57
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.48
KOG0520975 consensus Uncharacterized conserved protein, conta 98.4
KOG2384223 consensus Major histocompatibility complex protein 98.25
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.14
KOG2384223 consensus Major histocompatibility complex protein 98.14
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.13
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.1
KOG0511516 consensus Ankyrin repeat protein [General function 98.04
KOG0511516 consensus Ankyrin repeat protein [General function 97.94
KOG0520975 consensus Uncharacterized conserved protein, conta 97.62
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.77
KOG2505591 consensus Ankyrin repeat protein [General function 96.52
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.51
KOG2505591 consensus Ankyrin repeat protein [General function 95.95
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 93.87
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 90.13
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 88.44
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 87.71
PF06570206 DUF1129: Protein of unknown function (DUF1129); In 83.76
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 80.77
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1e-45  Score=429.33  Aligned_cols=374  Identities=14%  Similarity=0.083  Sum_probs=287.2

Q ss_pred             ccHHHHHHHHcCCHHHHHHHHhhCcCccccccCCCCChHHHHHH------------------------------------
Q 004365           10 LKKDLFKRAMKGEWKEVVKNYEKDERIHKVKITRSGGTALHIAV------------------------------------   53 (759)
Q Consensus        10 ~~~~L~~aa~~g~~~~v~~lL~~~~~~~~~~~d~~g~TpLh~Aa------------------------------------   53 (759)
                      ..+|||.|+..|+.+.|+.++.++|. .++..|..|.||||+|+                                    
T Consensus        41 ~~t~LH~A~~~g~~e~V~~ll~~~~~-~~~~~~~~~~tpLh~a~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~  119 (682)
T PHA02876         41 PFTAIHQALQLRQIDIVEEIIQQNPE-LIYITDHKCHSTLHTICIIPNVMDIVISLTLDCDIILDIKYASIILNKHKLDE  119 (682)
T ss_pred             cchHHHHHHHHHhhhHHHHHHHhCcc-cchhhchhhccccccccCCCCccccccccccchhhcccccHHHHHHHHHHHHH
Confidence            37899999999999999999998765 34566888999999776                                    


Q ss_pred             ----------------------------------HcCCHHHHHHHHHHhhhhcccccCccCCCCCChHHHHHHHcCCHHH
Q 004365           54 ----------------------------------SDGQEEIVEDLVRIIKEKQQLEALTIGDERGSTPLHIAAGLGNVSM   99 (759)
Q Consensus        54 ----------------------------------~~g~~~iv~~Ll~~g~~~~~~~~~~~~d~~G~TpLh~Aa~~g~~ei   99 (759)
                                                        ..|+.+++++|++.|      +++|.+|..|+||||+||..|+.++
T Consensus       120 ~~~~il~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~~i~k~Ll~~G------advn~~d~~G~TpLh~Aa~~G~~~i  193 (682)
T PHA02876        120 ACIHILKEAISGNDIHYDKINESIEYMKLIKERIQQDELLIAEMLLEGG------ADVNAKDIYCITPIHYAAERGNAKM  193 (682)
T ss_pred             HHHHHHHHHhcCCcccHHhhccchhhhHHHHHHHHCCcHHHHHHHHhCC------CCCCCCCCCCCCHHHHHHHCCCHHH
Confidence                                              446677888888776      6788888888888888888888888


Q ss_pred             HHHHHHcCCcccCCCCCCCCcHHHHHHHCCCHHHHHHHHhcCCCCCCCCccccCCCCCcHHHHHHHcCCHHHHHHHHHhc
Q 004365          100 CKCIATADRKLIGERNHENETPFFLAALHGHKDAFLCLHCLCASVDDGYTYSRRNDGETILHCAISGDYFDLAFQIIHLY  179 (759)
Q Consensus       100 v~~Ll~~g~~~~~~~d~~G~TpLh~Aa~~g~~~iv~~Ll~~ga~~~~~~~~~~d~~g~TpLh~A~~~g~~~iv~~Ll~~~  179 (759)
                      |++|+++|++ ++..+..|.||||+|+..|+.+++++|++.+.+++         .+.++|+.|+..++.+++++|++ .
T Consensus       194 v~~LL~~Gad-~n~~~~~g~t~L~~A~~~~~~~ivk~Ll~~~~~~~---------~~~~~L~~ai~~~~~~~~~~Ll~-~  262 (682)
T PHA02876        194 VNLLLSYGAD-VNIIALDDLSVLECAVDSKNIDTIKAIIDNRSNIN---------KNDLSLLKAIRNEDLETSLLLYD-A  262 (682)
T ss_pred             HHHHHHCCCC-cCccCCCCCCHHHHHHHcCCHHHHHHHHhcCCCCC---------CCcHHHHHHHHcCCHHHHHHHHH-C
Confidence            8888888887 78888888888888888888888888888777654         23467777888888888888887 4


Q ss_pred             CcCcccccCCCCcHHHHHHhCCCCCccCchHHHHHHHHhcCcCccchhhhhhhhhhhhhhccccCCCCcchHhHHH-HHH
Q 004365          180 EKLVNSVNEKGVSPLHVLATKPNAFRSGSHLGRCIGTIYHCIFVDKLQEETSYDQYQLETSKKQTNCPENYETCLN-FIR  258 (759)
Q Consensus       180 ~~~~~~~d~~G~TpLh~Aa~~~~~~~~~~~~~~~~~Ll~~ga~~~~~~~~~~~~~~~~~~~~~~~~~p~~~a~~~~-~~~  258 (759)
                      |.+++..|..|.||||+|+..++      ..++++.|+++|++++..+.              .|+||++++...+ ..+
T Consensus       263 g~~vn~~d~~g~TpLh~Aa~~~~------~~~iv~lLl~~gadin~~d~--------------~g~TpLh~Aa~~g~~~~  322 (682)
T PHA02876        263 GFSVNSIDDCKNTPLHHASQAPS------LSRLVPKLLERGADVNAKNI--------------KGETPLYLMAKNGYDTE  322 (682)
T ss_pred             CCCCCCCCCCCCCHHHHHHhCCC------HHHHHHHHHHCCCCCCCcCC--------------CCCCHHHHHHHhCCCHH
Confidence            67788889999999999998875      34688999999999887664              7889999998877 477


Q ss_pred             HHHHHHHHHhcCCCCccccCCCCccccCCCCCCCCCCcccccccCCCCCcCCCCCcchhhHHHHHHHHHHHHHHhcchhH
Q 004365          259 LLKTMVIVLSNRGNTKKERDAEDPERSKGNDGTGDQGEESRHNIGAQGHQFFPPNYGTCFEFVKLVSKAMLVILGLGSTK  338 (759)
Q Consensus       259 ~~~~ll~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~  338 (759)
                      .++.++..+.+.+...                                     ..+.|.+++..          ..+   
T Consensus       323 ~v~~Ll~~gadin~~d-------------------------------------~~g~TpLh~A~----------~~~---  352 (682)
T PHA02876        323 NIRTLIMLGADVNAAD-------------------------------------RLYITPLHQAS----------TLD---  352 (682)
T ss_pred             HHHHHHHcCCCCCCcc-------------------------------------cCCCcHHHHHH----------HhC---
Confidence            7887777665432100                                     11222222221          111   


Q ss_pred             HHHHHHhhhhhhhHHHHHHHHHHhc-ccceecCCCCCCCCCCCCccccccCCCcccccCCCCccccccCCCCCCCccccc
Q 004365          339 IRKIRDKKQKHTWSVQILDELLRRA-SLYEYDDDGGKPLRRPSSQAEEDETSPYAIVDGGDTDAVLEGYQQPDTSLTDHN  417 (759)
Q Consensus       339 ~~~~~~~~~~~~~~~~iv~~Ll~~~-~~~~~d~~G~TpL~~a~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~  417 (759)
                                  ...++++.|++.+ ..+..|..|+||||+|+..+..              .+                
T Consensus       353 ------------~~~~iv~lLl~~gadin~~d~~G~TpLh~Aa~~~~~--------------~i----------------  390 (682)
T PHA02876        353 ------------RNKDIVITLLELGANVNARDYCDKTPIHYAAVRNNV--------------VI----------------  390 (682)
T ss_pred             ------------CcHHHHHHHHHcCCCCccCCCCCCCHHHHHHHcCCH--------------HH----------------
Confidence                        1257888899987 6777899999999998764432              11                


Q ss_pred             cccccccccccCCCCCccccCCCCCCCCccCCCCCCcHHHHHHHcCc-HHHHHHHHHHCCcceecccCCCCcchhHHHHc
Q 004365          418 VVADTHKLSRNNGKNSEDRNEGGKTGSTIPDMAKRETPILIAAKNGI-TEIVEKILESFPVAIHDINSEKKNIVLLAVEN  496 (759)
Q Consensus       418 ~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~d~~g~TpLh~Aa~~g~-~eiv~~LL~~~~~~~~~~d~~G~TpLH~Av~~  496 (759)
                          +..|+..++             +.+..+..|.||||+|+..++ .++++.|+++ +.+++.+|..|+||||+|+..
T Consensus       391 ----v~~Ll~~ga-------------d~~~~~~~g~T~Lh~A~~~~~~~~~vk~Ll~~-gadin~~d~~G~TpLh~Aa~~  452 (682)
T PHA02876        391 ----INTLLDYGA-------------DIEALSQKIGTALHFALCGTNPYMSVKTLIDR-GANVNSKNKDLSTPLHYACKK  452 (682)
T ss_pred             ----HHHHHHCCC-------------CccccCCCCCchHHHHHHcCCHHHHHHHHHhC-CCCCCcCCCCCChHHHHHHHh
Confidence                122332222             223367789999999998766 5678888887 788999999999999999997


Q ss_pred             C-ChhHHHHHHcCCCcccchhccccCCCCcHhHHHHhcCC
Q 004365          497 R-QPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGD  535 (759)
Q Consensus       497 ~-~~~iv~~Ll~~~~~~~~~~n~~D~~G~TpLh~Aa~~g~  535 (759)
                      + +.+++++|++.|+    ++|.+|..|+||||+|+..+.
T Consensus       453 ~~~~~iv~lLl~~Ga----d~n~~d~~g~tpl~~a~~~~~  488 (682)
T PHA02876        453 NCKLDVIEMLLDNGA----DVNAINIQNQYPLLIALEYHG  488 (682)
T ss_pred             CCcHHHHHHHHHCCC----CCCCCCCCCCCHHHHHHHhCC
Confidence            6 6899999999998    999999999999999998654

>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06570 DUF1129: Protein of unknown function (DUF1129); InterPro: IPR009214 There are currently no experimental data for members of this group or their homologues Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query759
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 1e-05
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 2e-05
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 2e-05
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-05
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 3e-05
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 8e-05
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 9e-05
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 2e-04
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 2e-04
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-04
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 3e-04
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 3e-04
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-04
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 3e-04
2xee_A157 Structural Determinants For Improved Thermal Stabil 3e-04
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 3e-04
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 5e-04
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 5e-04
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 6e-04
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 7e-04
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure 
Iteration: 1

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 57/114 (50%), Gaps = 7/114 (6%)
Query: 25  EVVKN-YEKDERIHKVKITRSGGTALHIAVSDGQEEIVEDLVRIIKEKQQLEALTIGDER 83
           EVVK+ Y++  +    KIT  G T LH+AV     E+ + L+      +   ++ I D+ 
Sbjct: 86  EVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLI------ENGASVRIKDKF 139
Query: 84  GSTPLHIAAGLGNVSMCKCIATADRKLIGERNHENETPFFLAALHGHKDAFLCL 137
              PLH AA +G++ + + +    +  +  ++ +  TP F A   GH DA + L
Sbjct: 140 NQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLL 193
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query759
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-17
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-15
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-13
2etb_A256 Transient receptor potential cation channel subfam 1e-16
2etb_A256 Transient receptor potential cation channel subfam 5e-07
2etb_A256 Transient receptor potential cation channel subfam 1e-06
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-16
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-15
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-14
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-09
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-16
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-12
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-12
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-09
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-11
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-15
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-13
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-15
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-15
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-13
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-14
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-14
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-04
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-15
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-06
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-15
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-10
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-15
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-09
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-14
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-14
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-12
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-04
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-14
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-14
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-13
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-11
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-13
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-07
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-14
1awc_B153 Protein (GA binding protein beta 1); complex (tran 9e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-06
2pnn_A273 Transient receptor potential cation channel subfa 3e-14
2pnn_A273 Transient receptor potential cation channel subfa 2e-13
2pnn_A273 Transient receptor potential cation channel subfa 2e-12
2pnn_A273 Transient receptor potential cation channel subfa 5e-10
2pnn_A273 Transient receptor potential cation channel subfa 4e-08
2pnn_A273 Transient receptor potential cation channel subfa 4e-04
2pnn_A273 Transient receptor potential cation channel subfa 5e-04
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-12
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-05
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-14
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-10
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-06
2rfa_A232 Transient receptor potential cation channel subfa 6e-14
2rfa_A232 Transient receptor potential cation channel subfa 4e-13
2rfa_A232 Transient receptor potential cation channel subfa 1e-12
2rfa_A232 Transient receptor potential cation channel subfa 2e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-14
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-14
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-13
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-13
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-13
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-05
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-13
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-13
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 8e-12
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-13
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-13
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-13
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 9e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-13
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-12
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-08
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-06
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-11
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-11
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-07
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-13
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-12
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-10
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-12
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-11
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-11
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-11
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-05
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-12
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-10
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-12
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-09
1sw6_A327 Regulatory protein SWI6; transcription regulation, 9e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-09
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-12
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-05
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 6e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-06
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-08
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-11
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-10
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-07
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 9e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 8e-04
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
 Score = 81.0 bits (201), Expect = 2e-17
 Identities = 42/196 (21%), Positives = 70/196 (35%), Gaps = 44/196 (22%)

Query: 18  AMKGEWKEVVK---------NYEKDERIHKVKITRSGGTALHIAVSDGQEEIVEDLVRII 68
            M+ E+ +V +           +KD+          G   LH +VS    EI   L   +
Sbjct: 10  CMENEFFKVQELLHSKPSLLL-QKDQ---------DGRIPLHWSVSFQAHEITSFL---L 56

Query: 69  KEKQQLEALTIGDERGSTPLHIAAGLGNVSMCKC----IATADRKLIGERNHENETPFFL 124
            + + +      D+ G TP HIA  +GN+ + K         D   + +  ++  T   L
Sbjct: 57  SKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPD---LNKITNQGVTCLHL 113

Query: 125 AALHGHKDA--FLCLHCLCASVDDGYTYSRRNDGETILHCAISGDYFDLAFQIIHLYEKL 182
           A      +   FL  +   ASV       +    +  LH A S     L   +       
Sbjct: 114 AVGKKWFEVSQFLIEN--GASVR-----IKDKFNQIPLHRAASVGSLKLIELLC---GLG 163

Query: 183 VNSVNEK---GVSPLH 195
            ++VN +   G +PL 
Sbjct: 164 KSAVNWQDKQGWTPLF 179
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query759
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.98
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.94
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.94
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.93
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.91
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.91
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.9
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.9
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.9
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.9
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.9
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.89
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.89
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.88
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.87
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.87
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.86
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.86
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.85
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.85
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.84
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.84
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.84
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.83
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.76
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.76
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=3.8e-55  Score=484.11  Aligned_cols=231  Identities=20%  Similarity=0.196  Sum_probs=204.0

Q ss_pred             CCcCCcccc----cHHHHHHHHcCCHHHHHHHHhhCcCccccccCCCCChHHHHHHHcCCHHHHHHHHHHhhhhcccccC
Q 004365            2 ATGIDIDQL----KKDLFKRAMKGEWKEVVKNYEKDERIHKVKITRSGGTALHIAVSDGQEEIVEDLVRIIKEKQQLEAL   77 (759)
Q Consensus         2 ~~g~d~~~~----~~~L~~aa~~g~~~~v~~lL~~~~~~~~~~~d~~g~TpLh~Aa~~g~~~iv~~Ll~~g~~~~~~~~~   77 (759)
                      +.|++++..    .+|||.||..|+.+.|+.|+.+  +++++..+..|+||||+||..|+.++|++|+++|      +++
T Consensus         2 ~~g~~~~~~~~~g~t~L~~Aa~~g~~~~v~~Ll~~--g~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g------~~~   73 (437)
T 1n11_A            2 SPGISGGGGGESGLTPLHVASFMGHLPIVKNLLQR--GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNK------AKV   73 (437)
T ss_dssp             -------------CCHHHHHHHHTCHHHHHHHHHT--TCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHT------CCS
T ss_pred             CCCCCccccCCCCCCHHHHHHHCCCHHHHHHHHHc--CCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCC------CCC
Confidence            357888764    6799999999999999999988  7889999999999999999999999999999997      789


Q ss_pred             ccCCCCCChHHHHHHHcCCHHHHHHHHHcCCcccCCCCCCCCcHHHHHHHCCCHHHHHHHHhcCCCCCCCCccccCCCCC
Q 004365           78 TIGDERGSTPLHIAAGLGNVSMCKCIATADRKLIGERNHENETPFFLAALHGHKDAFLCLHCLCASVDDGYTYSRRNDGE  157 (759)
Q Consensus        78 ~~~d~~G~TpLh~Aa~~g~~eiv~~Ll~~g~~~~~~~d~~G~TpLh~Aa~~g~~~iv~~Ll~~ga~~~~~~~~~~d~~g~  157 (759)
                      +.+|.+|+||||+||..|+.+++++|+++|++ ++.+|..|.||||+|+..|+.+++++|++++++++     ..+..|.
T Consensus        74 ~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~ga~-~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~-----~~~~~g~  147 (437)
T 1n11_A           74 NAKAKDDQTPLHCAARIGHTNMVKLLLENNAN-PNLATTAGHTPLHIAAREGHVETVLALLEKEASQA-----CMTKKGF  147 (437)
T ss_dssp             SCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCC-TTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSC-----CCCTTSC
T ss_pred             CCCCCCCCCHHHHHHHCCCHHHHHHHHhCCCC-CCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCc-----CCCCCCC
Confidence            99999999999999999999999999999999 99999999999999999999999999999999988     8899999


Q ss_pred             cHHHHHHHcCCHHHHHHHHHhcCcCcccccCCCCcHHHHHHhCCCCCccCchHHHHHHHHhcCcCccchhhhhhhhhhhh
Q 004365          158 TILHCAISGDYFDLAFQIIHLYEKLVNSVNEKGVSPLHVLATKPNAFRSGSHLGRCIGTIYHCIFVDKLQEETSYDQYQL  237 (759)
Q Consensus       158 TpLh~A~~~g~~~iv~~Ll~~~~~~~~~~d~~G~TpLh~Aa~~~~~~~~~~~~~~~~~Ll~~ga~~~~~~~~~~~~~~~~  237 (759)
                      ||||+|+..|+.+++++|+++ +.+++..|..|.||||+|+..++       .+++++|+++|++++..+.         
T Consensus       148 t~L~~A~~~g~~~~v~~Ll~~-g~~~~~~~~~g~t~L~~A~~~~~-------~~~v~~Ll~~g~~~~~~~~---------  210 (437)
T 1n11_A          148 TPLHVAAKYGKVRVAELLLER-DAHPNAAGKNGLTPLHVAVHHNN-------LDIVKLLLPRGGSPHSPAW---------  210 (437)
T ss_dssp             CHHHHHHHTTCHHHHHHHHHT-TCCTTCCCSSCCCHHHHHHHTTC-------HHHHHHHGGGTCCSCCCCT---------
T ss_pred             CHHHHHHHcCCHHHHHHHHhC-CCCCCCCCCCCCCHHHHHHHcCC-------HHHHHHHHhCCCCCCCcCC---------
Confidence            999999999999999999995 77899999999999999999995       9999999999999877653         


Q ss_pred             hhccccCCCCcchHhHHHHHHHHHHHHHHHh
Q 004365          238 ETSKKQTNCPENYETCLNFIRLLKTMVIVLS  268 (759)
Q Consensus       238 ~~~~~~~~~p~~~a~~~~~~~~~~~ll~~~~  268 (759)
                           .|.+|++++...+..++++.|++.+.
T Consensus       211 -----~g~t~L~~A~~~~~~~~~~~Ll~~g~  236 (437)
T 1n11_A          211 -----NGYTPLHIAAKQNQVEVARSLLQYGG  236 (437)
T ss_dssp             -----TCCCHHHHHHHTTCHHHHHHHHHTTC
T ss_pred             -----CCCCHHHHHHHcCCHHHHHHHHHcCC
Confidence                 67789988877766666666655443
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 759
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-12
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-07
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.001
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.002
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.002
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.004
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.001
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-06
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.001
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.004
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 9e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.002
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 66.2 bits (160), Expect = 5e-12
 Identities = 40/186 (21%), Positives = 70/186 (37%), Gaps = 40/186 (21%)

Query: 47  TALHIAVSDGQEEIVEDLVRIIKEKQQLEALTIGDERGSTPLHIAAGLGNVSMCKCI--A 104
           T LH+A   G   IV++L+      Q+  +  + + +  TPLH+AA  G+  + K +   
Sbjct: 2   TPLHVASFMGHLPIVKNLL------QRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQN 55

Query: 105 TADRKLIGERNHENETPFFLAALHGHKDAFLCLHCLCASVDDGYTY-------------- 150
            A    +  +  +++TP   AA  GH +    L    A+ +   T               
Sbjct: 56  KAK---VNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHV 112

Query: 151 --------------SRRNDGETILHCAISGDYFDLAFQIIHLYEKLVNSVNEKGVSPLHV 196
                              G T LH A       +A +++   +   N+  + G++PLHV
Sbjct: 113 ETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVA-ELLLERDAHPNAAGKNGLTPLHV 171

Query: 197 LATKPN 202
                N
Sbjct: 172 AVHHNN 177
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query759
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.96
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.93
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.92
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.91
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.91
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.9
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.89
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.89
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=8.4e-46  Score=402.62  Aligned_cols=344  Identities=18%  Similarity=0.181  Sum_probs=252.5

Q ss_pred             HHHHHHHHcCCHHHHHHHHhhCcCccccccCCCCChHHHHHHHcCCHHHHHHHHHHhhhhcccccCccCCCCCChHHHHH
Q 004365           12 KDLFKRAMKGEWKEVVKNYEKDERIHKVKITRSGGTALHIAVSDGQEEIVEDLVRIIKEKQQLEALTIGDERGSTPLHIA   91 (759)
Q Consensus        12 ~~L~~aa~~g~~~~v~~lL~~~~~~~~~~~d~~g~TpLh~Aa~~g~~~iv~~Ll~~g~~~~~~~~~~~~d~~G~TpLh~A   91 (759)
                      ||||.||..|+.+.|+.++..  |++++..|.+|+||||+||..|+.++|++|+++|      ++++.+|.+|+||||+|
T Consensus         2 TpL~~Aa~~g~~~~v~~Ll~~--g~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~g------adi~~~~~~g~t~L~~A   73 (408)
T d1n11a_           2 TPLHVASFMGHLPIVKNLLQR--GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNK------AKVNAKAKDDQTPLHCA   73 (408)
T ss_dssp             CHHHHHHHHTCHHHHHHHHHT--TCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHT------CCSSCCCTTSCCHHHHH
T ss_pred             ChHHHHHHCcCHHHHHHHHHC--CCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCc------CCCCCCCCCCCCHHHHH
Confidence            799999999999999999987  7899999999999999999999999999999997      78999999999999999


Q ss_pred             HHcCCHHHHHHHHHcCCcc--------------------------------cCCCCCCCCcHHHHHHHCCCHHHHHHHHh
Q 004365           92 AGLGNVSMCKCIATADRKL--------------------------------IGERNHENETPFFLAALHGHKDAFLCLHC  139 (759)
Q Consensus        92 a~~g~~eiv~~Ll~~g~~~--------------------------------~~~~d~~G~TpLh~Aa~~g~~~iv~~Ll~  139 (759)
                      +..|+.+++++|+..+++.                                .+.++..|.++|+.|+..++.+++++|++
T Consensus        74 ~~~g~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~  153 (408)
T d1n11a_          74 ARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLE  153 (408)
T ss_dssp             HHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHH
T ss_pred             HHcCCHHHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHH
Confidence            9999999999999876651                                34445666666777776666677777776


Q ss_pred             cCCCCCCCCccccCCCCCcHHHHHHHcCCHHHHHHHHHhcCcCcccccCCCCcHHHHHHhCCCCCccCchHHHHHHHHhc
Q 004365          140 LCASVDDGYTYSRRNDGETILHCAISGDYFDLAFQIIHLYEKLVNSVNEKGVSPLHVLATKPNAFRSGSHLGRCIGTIYH  219 (759)
Q Consensus       140 ~ga~~~~~~~~~~d~~g~TpLh~A~~~g~~~iv~~Ll~~~~~~~~~~d~~G~TpLh~Aa~~~~~~~~~~~~~~~~~Ll~~  219 (759)
                      +|++++     ..+.+|.+|||+|+..|+.+++++|+++ +.+++..+..|.||+|+++...+       .+....++..
T Consensus       154 ~~~~~~-----~~~~~~~~~L~~A~~~~~~~~~~~Ll~~-g~~~~~~~~~~~t~l~~~~~~~~-------~~~~~~l~~~  220 (408)
T d1n11a_         154 RDAHPN-----AAGKNGLTPLHVAVHHNNLDIVKLLLPR-GGSPHSPAWNGYTPLHIAAKQNQ-------VEVARSLLQY  220 (408)
T ss_dssp             TTCCTT-----CCCSSCCCHHHHHHHTTCHHHHHHHGGG-TCCSCCCCTTCCCHHHHHHHTTC-------HHHHHHHHHT
T ss_pred             cCCCCC-----cCCCcCchHHHHHHHcCCHHHHHHHHhc-CCcccccCCCCCCcchhhhccch-------hhhhhhhhhc
Confidence            666666     5666666677777776777766666663 45566666666777776666653       5566666555


Q ss_pred             CcCccchhhhhhhhhhhhhhccccCCCCcchHhHHHHHHHHHHHHHHHhcCCCCccccCCCCccccCCCCCCCCCCcccc
Q 004365          220 CIFVDKLQEETSYDQYQLETSKKQTNCPENYETCLNFIRLLKTMVIVLSNRGNTKKERDAEDPERSKGNDGTGDQGEESR  299 (759)
Q Consensus       220 ga~~~~~~~~~~~~~~~~~~~~~~~~~p~~~a~~~~~~~~~~~ll~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~  299 (759)
                      +......+.              .+.+|+++++..+..++++.                                     
T Consensus       221 ~~~~~~~~~--------------~~~t~l~~a~~~~~~~~~~~-------------------------------------  249 (408)
T d1n11a_         221 GGSANAESV--------------QGVTPLHLAAQEGHAEMVAL-------------------------------------  249 (408)
T ss_dssp             TCCTTCCCT--------------TCCCHHHHHHHTTCHHHHHH-------------------------------------
T ss_pred             cccccccCC--------------CCCCHHHHHHHhCcHhHhhh-------------------------------------
Confidence            554443332              34455555555444444443                                     


Q ss_pred             cccCCCCCcCCCCCcchhhHHHHHHHHHHHHHHhcchhHHHHHHHhhhhhhhHHHHHHHHHHhc-ccceecCCCCCCCCC
Q 004365          300 HNIGAQGHQFFPPNYGTCFEFVKLVSKAMLVILGLGSTKIRKIRDKKQKHTWSVQILDELLRRA-SLYEYDDDGGKPLRR  378 (759)
Q Consensus       300 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~iv~~Ll~~~-~~~~~d~~G~TpL~~  378 (759)
                                                                                 +++.. .....|..|.|||+.
T Consensus       250 -----------------------------------------------------------~~~~~~~~~~~~~~g~~~l~~  270 (408)
T d1n11a_         250 -----------------------------------------------------------LLSKQANGNLGNKSGLTPLHL  270 (408)
T ss_dssp             -----------------------------------------------------------HHTTTCCTTCCCTTCCCHHHH
T ss_pred             -----------------------------------------------------------hhccccccccccCCCCChhhh
Confidence                                                                       33332 222333344444443


Q ss_pred             CCCccccccCCCcccccCCCCccccccCCCCCCCccccccccccccccccCCCCCccccCCCCCCCCccCCCCCCcHHHH
Q 004365          379 PSSQAEEDETSPYAIVDGGDTDAVLEGYQQPDTSLTDHNVVADTHKLSRNNGKNSEDRNEGGKTGSTIPDMAKRETPILI  458 (759)
Q Consensus       379 a~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~d~~g~TpLh~  458 (759)
                      +...+..              .+                    ...++..+.             +.+..+..+.||||.
T Consensus       271 a~~~~~~--------------~i--------------------~~~Ll~~g~-------------~~~~~~~~~~t~L~~  303 (408)
T d1n11a_         271 VAQEGHV--------------PV--------------------ADVLIKHGV-------------MVDATTRMGYTPLHV  303 (408)
T ss_dssp             HHHHTCH--------------HH--------------------HHHHHHHTC-------------CTTCCCSSCCCHHHH
T ss_pred             hhhcCcH--------------HH--------------------HHHHHHCCC-------------ccccccccccccchh
Confidence            3322110              00                    001111111             111145668999999


Q ss_pred             HHHcCcHHHHHHHHHHCCcceecccCCCCcchhHHHHcCChhHHHHHHcCCCcccchhccccCCCCcHhHHHHhcCCCCc
Q 004365          459 AAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKP  538 (759)
Q Consensus       459 Aa~~g~~eiv~~LL~~~~~~~~~~d~~G~TpLH~Av~~~~~~iv~~Ll~~~~~~~~~~n~~D~~G~TpLh~Aa~~g~~~~  538 (759)
                      |+..|+.++++.+++. +.+++.+|.+|+||||+||++|+.++|++|+++|+    ++|.+|++|+||||+|++.|+.++
T Consensus       304 ~~~~~~~~~~~~ll~~-g~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GA----d~n~~d~~G~t~L~~A~~~~~~~i  378 (408)
T d1n11a_         304 ASHYGNIKLVKFLLQH-QADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGA----SPNEVSSDGTTPLAIAKRLGYISV  378 (408)
T ss_dssp             HHHSSCSHHHHHHHHT-TCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTC----CSCCCCSSSCCHHHHHHHTTCHHH
T ss_pred             hcccCcceeeeeeccc-cccccccCCCCCCHHHHHHHcCCHHHHHHHHHCCC----CCCCCCCCCCCHHHHHHHcCCHHH
Confidence            9999999999999997 77889999999999999999999999999999998    899999999999999999999544
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure