Citrus Sinensis ID: 004426


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750----
MRGLKFIEKFKSTQVHALNQQDASSGGCNGCANGSKLSNHKRTKFTGSKSNKTKSGSVAQALLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQVSSSK
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccHHHccccccccccccEEEccccccccccccccccccccccccccccccHHHHHHHHHccccccccEEEEEccEEEEcHHHHHHcccHHHHHHHccccccccccEEEEEcccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccHHHHcccccccccccHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccEEEccEEccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccccccccc
ccccEEEccccccEEEEEccccccccccccccccccccccccccccccccccccccccHHHcccccccHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHcccccccccccccccccHHHEccccccccccccccccccccccccEEEccccccccccccccEEEEEcccEEEEEEEHHHHccHHHHHHHcccccHccccHEEcccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHccccccccccHEEEHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccccEEcccccHHHHHHHHHHHHHHccHcHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHccHEEEEcEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccccccc
MRGLKFIEKFKSTQVHAlnqqdassggcngcangsklsnhkrtkftgsksnktksgsvaqallpyglpstdllepsidphlkpihCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERredellgsssmdccgfilecpkaalisgcdpnstydhckcfeenaksnlgpiVEKFVCLsleeddsvtfcvrdkEISFVRNKiaslsspfkamlyggfveskrktidfshdgvsveGLRAVEVYTrtsrvdlfcPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRelpsslynpkvMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIIsehkptgwmyqerslynlgrekivdlnyaseldptlsfpyKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHvrswspadcwiklydrwssvddigSLAVINQMlindpgksFLRFRQSLLLLRLNCQKAAMRCLRLArnhssseherlVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILadtnldpesSTYVIQLLEEALrcpsdglrkgqvsssk
MRGLKFIEKFKSTQVHAlnqqdassggcNGCANgsklsnhkrtkftgsksnktksgsvAQALLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEenaksnlgpIVEKFVCLSLEEDDSVTFCvrdkeisfvrnkiaslsspfkAMLYGGFVESKRKTidfshdgvsvegLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRelpsslynpKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNyaseldptlsFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLarnhssseherlVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEAlrcpsdglrkgqvsssk
MRGLKFIEKFKSTQVHALNQQDassggcngcangsKLSNHKRtkftgsksnktksgsVAQALLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKsflrfrqsllllrlNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQVSSSK
*************************************************************LLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRC**************
**GLK**EKFKSTQVHA*********************************************LPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRF*******KSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISG****************************VCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKD*VSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRL*******EH*RLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGL*********
MRGLKFIEKFKSTQVHALNQQDASSGGCNGCANGSKLSNHKRTK***********GSVAQALLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPS************
*RGLKFIEKFKSTQVHALNQ************************************SVAQALLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCP*************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRGLKFIEKFKSTQVHALNQQDASSGGCNGCANGSKLSNHKRTKFTGSKSNKTKSGSVAQALLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQVSSSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query754 2.2.26 [Sep-21-2011]
O65020 951 Ethylene-overproduction p yes no 0.990 0.785 0.604 0.0
Q9LV01 925 ETO1-like protein 2 OS=Ar no no 0.974 0.794 0.565 0.0
Q9ZQX6 888 ETO1-like protein 1 OS=Ar no no 0.876 0.744 0.468 1e-158
>sp|O65020|ETO1_ARATH Ethylene-overproduction protein 1 OS=Arabidopsis thaliana GN=ETO1 PE=1 SV=2 Back     alignment and function desciption
 Score =  950 bits (2455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/777 (60%), Positives = 585/777 (75%), Gaps = 30/777 (3%)

Query: 1   MRGLKFIEKFKSTQVHALNQQDASSGGCNGCANG--------------------SKLSNH 40
           MR LK  E  K TQV+ALN    +     G ++                       LS+H
Sbjct: 1   MRSLKLAEGCKGTQVYALNPSAPTPPPPPGNSSTGGGGGGGSGGGTGGVGDKLLQHLSDH 60

Query: 41  KRTKFTGSKSNKTKSGSV-------AQALLPYGLPSTDLLEPSIDPHLKPIHCVKSLADL 93
            R     SKS++T             + LLP GLP TDLLEP IDP LK +  V+ +A +
Sbjct: 61  LRVNSVRSKSSRTYPPPTQPNAVVSPEFLLPCGLPVTDLLEPQIDPCLKFVDLVEKMAQV 120

Query: 94  YRRFETCLESDKSMLFIEQYAYLCGLGDAKLLRRCLRSARQYAGDLHLKVVLSAWLKFER 153
           YRR E C + +KS  ++EQ A   G+ D KL RR LRS+RQ+A D+H KVVL++WL+FER
Sbjct: 121 YRRIENCSQFEKSGAYLEQCAIFRGISDPKLFRRSLRSSRQHAVDVHAKVVLASWLRFER 180

Query: 154 REDELLGSSSMDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLS 213
           REDEL+G++SMDCCG  LECPKA L+SG DP S YD C C   +  S    + E     S
Sbjct: 181 REDELIGTTSMDCCGRNLECPKATLVSGYDPESVYDPCVC---SGASRSEMMNEDECSTS 237

Query: 214 LEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRA 273
            E D  ++FC+ D+E+  VR KIASLS PFKAMLYGGF E KR TI+F+ +G+SVEG+RA
Sbjct: 238 QEVDYDMSFCIGDEEVRCVRYKIASLSRPFKAMLYGGFREMKRATINFTQNGISVEGMRA 297

Query: 274 VEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLE 333
            E+++RT+R+D F P +VLELL  ANRFCC+E+KSACD+HLA LV  +++A++LI+YGLE
Sbjct: 298 AEIFSRTNRLDNFPPNVVLELLKLANRFCCDELKSACDSHLAHLVNSLDEAMLLIEYGLE 357

Query: 334 ERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAME 393
           E A LLVA+CLQV LRELPSS++NP V+KIFCS+E  ERLA++GHASF LY+FLSQ+AME
Sbjct: 358 EAAYLLVAACLQVFLRELPSSMHNPNVIKIFCSAEGRERLASLGHASFTLYFFLSQIAME 417

Query: 394 KDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYS 453
            D  SNTTVMLLERL EC+ + W++ LA HQLG VM ER+EYKDA  +F AA +AGH+YS
Sbjct: 418 DDMKSNTTVMLLERLVECAVDSWEKQLAYHQLGVVMLERKEYKDAQRWFNAAVEAGHLYS 477

Query: 454 LAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPT 513
           L G+AR K+K   +YSAYK+INS+IS+HK TGWM+QERSLY  G+EK++DL+ A+E DPT
Sbjct: 478 LVGVARTKFKRDHRYSAYKIINSLISDHKATGWMHQERSLYCSGKEKLLDLDTATEFDPT 537

Query: 514 LSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLA 573
           L+FPYK+RAVA +EE Q  AAI+E+++I+ FK S DCLE+RAW+ I  +DYE AL+D  A
Sbjct: 538 LTFPYKFRAVALVEENQFGAAIAELNKILGFKASPDCLEMRAWISIGMEDYEGALKDIRA 597

Query: 574 LLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQML 633
           LL LE N+MMF+ ++ GDH+V+LL    + WS ADCW++LYDRWSSVDDIGSLAV++ ML
Sbjct: 598 LLTLEPNFMMFNWKIHGDHMVELLRPLAQQWSQADCWMQLYDRWSSVDDIGSLAVVHHML 657

Query: 634 INDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEA 693
            NDPGKS LRFRQSLLLLRLNCQKAAMR LRLARNHS SEHERLVYEGWILYDTGHREEA
Sbjct: 658 ANDPGKSLLRFRQSLLLLRLNCQKAAMRSLRLARNHSKSEHERLVYEGWILYDTGHREEA 717

Query: 694 LSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQV 750
           L++AE+SISI+R+FEAFFLKAY LAD+ LDP+SS YVIQLL+EAL+CPSDGLRKGQ 
Sbjct: 718 LAKAEESISIQRSFEAFFLKAYALADSTLDPDSSNYVIQLLQEALKCPSDGLRKGQA 774




Essential regulator of the ethylene pathway, which acts by regulating the stability of 1-aminocyclopropane-1-carboxylate synthase (ACS) enzymes. May act as a substrate-specific adapter that connects ACS enzymes, such as ACS5, to ubiquitin ligase complexes, leading to proteasomal degradation of ACS enzymes.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LV01|ETOL2_ARATH ETO1-like protein 2 OS=Arabidopsis thaliana GN=EOL2 PE=1 SV=2 Back     alignment and function description
>sp|Q9ZQX6|ETOL1_ARATH ETO1-like protein 1 OS=Arabidopsis thaliana GN=EOL1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query754
224105907 896 predicted protein [Populus trichocarpa] 0.952 0.801 0.714 0.0
225434510 927 PREDICTED: ethylene-overproduction prote 0.988 0.803 0.692 0.0
255560353 911 Ethylene-overproduction protein, putativ 0.965 0.799 0.683 0.0
356566016 902 PREDICTED: ethylene-overproduction prote 0.964 0.805 0.648 0.0
356553104 955 PREDICTED: ethylene-overproduction prote 0.988 0.780 0.634 0.0
356541801 895 PREDICTED: ethylene-overproduction prote 0.953 0.803 0.638 0.0
356500888 937 PREDICTED: ethylene-overproduction prote 0.989 0.796 0.637 0.0
297819878 947 ethylene-overproduction protein 1 [Arabi 0.989 0.787 0.609 0.0
225439486 951 PREDICTED: ethylene-overproduction prote 0.994 0.788 0.628 0.0
50400253 951 RecName: Full=Ethylene-overproduction pr 0.990 0.785 0.604 0.0
>gi|224105907|ref|XP_002313975.1| predicted protein [Populus trichocarpa] gi|222850383|gb|EEE87930.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1087 bits (2812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/750 (71%), Positives = 623/750 (83%), Gaps = 32/750 (4%)

Query: 1   MRGLKFIEKFKSTQVHALNQQDASSGGCNGCANGSKLSNHKRTKFTGSKSNKTKSGSVAQ 60
           M G K +++FKSTQVHAL+ QD+     N C+ G KLS   + KFT +       GSVAQ
Sbjct: 1   MHGFKLLDRFKSTQVHALSPQDS-----NPCSRG-KLS---KCKFTNT-------GSVAQ 44

Query: 61  ALLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLG 120
           ALLP GLP+T+LLEPSID +LKPI  V+SLA++YRR  TC ++DKS+L IEQ++ L GLG
Sbjct: 45  ALLPCGLPTTELLEPSIDSYLKPIDYVESLAEIYRRLNTCSQTDKSLLCIEQFSILRGLG 104

Query: 121 DAKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALIS 180
           D KLLRRCL +ARQYA D+H KVVLSAWL+FERREDE +G SS DC G+ILECP AAL+S
Sbjct: 105 DPKLLRRCLCAARQYAIDVHSKVVLSAWLRFERREDEFIGVSSKDCSGYILECPMAALVS 164

Query: 181 GCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLS 240
           GCDPNS YDHC+C ++N                LE D  V+FC+ D+ +  VR KIASLS
Sbjct: 165 GCDPNSIYDHCQCGQDN----------------LEADSDVSFCIGDELVHCVRFKIASLS 208

Query: 241 SPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANR 300
           SPFKAMLYG FVES+R  IDFS  G+SV+G+RAV+VY+RT RVDLFCP IVLELLSFANR
Sbjct: 209 SPFKAMLYGSFVESRRDKIDFSKIGISVKGMRAVQVYSRTGRVDLFCPEIVLELLSFANR 268

Query: 301 FCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKV 360
           FCCEE+K ACDAHLASLV   EDALILID+GLEERA LLVASCLQV LRELP+SLYN KV
Sbjct: 269 FCCEELKCACDAHLASLVCGTEDALILIDHGLEERANLLVASCLQVFLRELPNSLYNHKV 328

Query: 361 MKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRML 420
           M +FC+SEA ERLA +GHASFLLYYFLSQVAME++  SN  VMLLE L E +TE+WQ+ L
Sbjct: 329 MSVFCNSEARERLAMLGHASFLLYYFLSQVAMEENVASNAAVMLLEGLEEFATEKWQKAL 388

Query: 421 ALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISE 480
           ALHQLGCVM ER+EYK A +YFEAA +AGH+YSLAG+AR KYK GQQYSA++L+NS+I +
Sbjct: 389 ALHQLGCVMLERKEYKGAQFYFEAAVEAGHVYSLAGVARTKYKQGQQYSAFRLMNSLIFK 448

Query: 481 HKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDR 540
           HKP GWMYQERSLY +G+EKI+D+N A+ELDPTLSFPYK+RAV K+EE QIRAAI+EID+
Sbjct: 449 HKPVGWMYQERSLYGVGQEKIMDMNTATELDPTLSFPYKFRAVMKVEEKQIRAAITEIDK 508

Query: 541 IIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHH 600
           II FKLS DCLELRAW FIA +D+ESALRD  ALL LE  YMMFHGRVSGDHLV+LL+H 
Sbjct: 509 IIGFKLSPDCLELRAWFFIALEDFESALRDIRALLTLEPKYMMFHGRVSGDHLVELLSHR 568

Query: 601 VRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAM 660
           +R W+ ADCW++LY+RWSSVDDIGSLAV++QML NDP KS L FRQSLLLLRLNCQKAAM
Sbjct: 569 IRLWNLADCWMQLYERWSSVDDIGSLAVLHQMLSNDPAKSLLWFRQSLLLLRLNCQKAAM 628

Query: 661 RCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADT 720
           RCLRLARNH+SS HERL+YEGW+L+D+GHREEALSRAEKSISI+R+FEAFFL AY LADT
Sbjct: 629 RCLRLARNHTSSVHERLIYEGWLLFDSGHREEALSRAEKSISIQRSFEAFFLMAYTLADT 688

Query: 721 NLDPESSTYVIQLLEEALRCPSDGLRKGQV 750
           NLDPESS+ VIQLLEEALRCPSDGLRKGQ 
Sbjct: 689 NLDPESSSTVIQLLEEALRCPSDGLRKGQA 718




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225434510|ref|XP_002278414.1| PREDICTED: ethylene-overproduction protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255560353|ref|XP_002521192.1| Ethylene-overproduction protein, putative [Ricinus communis] gi|223539606|gb|EEF41192.1| Ethylene-overproduction protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356566016|ref|XP_003551231.1| PREDICTED: ethylene-overproduction protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356553104|ref|XP_003544898.1| PREDICTED: ethylene-overproduction protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356541801|ref|XP_003539361.1| PREDICTED: ethylene-overproduction protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356500888|ref|XP_003519262.1| PREDICTED: ethylene-overproduction protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|297819878|ref|XP_002877822.1| ethylene-overproduction protein 1 [Arabidopsis lyrata subsp. lyrata] gi|297323660|gb|EFH54081.1| ethylene-overproduction protein 1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225439486|ref|XP_002269998.1| PREDICTED: ethylene-overproduction protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|50400253|sp|O65020.2|ETO1_ARATH RecName: Full=Ethylene-overproduction protein 1; AltName: Full=Protein ETHYLENE OVERPRODUCER 1; Short=Protein ETO1 gi|46810683|gb|AAT01656.1| ethylene overproducer 1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query754
TAIR|locus:2074343 959 ETO1 "ETHYLENE OVERPRODUCER 1" 0.908 0.714 0.633 1.8e-242
TAIR|locus:2132402 888 EOL1 "ETO1-like 1" [Arabidopsi 0.876 0.744 0.450 9e-148
TAIR|locus:2074343 ETO1 "ETHYLENE OVERPRODUCER 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2306 (816.8 bits), Expect = 1.8e-242, Sum P(2) = 1.8e-242
 Identities = 436/688 (63%), Positives = 543/688 (78%)

Query:    62 LLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIEQYAYLCGLGD 121
             LLP GLP TDLLEP IDP LK +  V+ +A +YRR E C + +KS  ++EQ A   G+ D
Sbjct:    97 LLPCGLPVTDLLEPQIDPCLKFVDLVEKMAQVYRRIENCSQFEKSGAYLEQCAIFRGISD 156

Query:   122 AKLLRRCLRSARQYAGDLHLKVVLSAWLKFERREDELLGSSSMDCCGFILECPKAALISG 181
              KL RR LRS+RQ+A D+H KVVL++WL+FERREDEL+G++SMDCCG  LECPKA L+SG
Sbjct:   157 PKLFRRSLRSSRQHAVDVHAKVVLASWLRFERREDELIGTTSMDCCGRNLECPKATLVSG 216

Query:   182 CDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSS 241
              DP S YD C C   +  S    + E     S E D  ++FC+ D+E+  VR KIASLS 
Sbjct:   217 YDPESVYDPCVC---SGASRSEMMNEDECSTSQEVDYDMSFCIGDEEVRCVRYKIASLSR 273

Query:   242 PFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRF 301
             PFKAMLYGGF E KR TI+F+ +G+SVEG+RA E+++RT+R+D F P +VLELL  ANRF
Sbjct:   274 PFKAMLYGGFREMKRATINFTQNGISVEGMRAAEIFSRTNRLDNFPPNVVLELLKLANRF 333

Query:   302 CCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVM 361
             CC+E+KSACD+HLA LV  +++A++LI+YGLEE A LLVA+CLQV LRELPSS++NP V+
Sbjct:   334 CCDELKSACDSHLAHLVNSLDEAMLLIEYGLEEAAYLLVAACLQVFLRELPSSMHNPNVI 393

Query:   362 KIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLA 421
             KIFCS+E  ERLA++GHASF LY+FLSQ+AME D  SNTTVMLLERL EC+ + W++ LA
Sbjct:   394 KIFCSAEGRERLASLGHASFTLYFFLSQIAMEDDMKSNTTVMLLERLVECAVDSWEKQLA 453

Query:   422 LHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEH 481
              HQLG VM ER+EYKDA  +F AA +AGH+YSL G+AR K+K   +YSAYK+INS+IS+H
Sbjct:   454 YHQLGVVMLERKEYKDAQRWFNAAVEAGHLYSLVGVARTKFKRDHRYSAYKIINSLISDH 513

Query:   482 KPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRI 541
             K TGWM+QERSLY  G+EK++DL+ A+E DPTL+FPYK+RAVA +EE Q  AAI+E+++I
Sbjct:   514 KATGWMHQERSLYCSGKEKLLDLDTATEFDPTLTFPYKFRAVALVEENQFGAAIAELNKI 573

Query:   542 IVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHV 601
             + FK S DCLE+RAW+ I  +DYE AL+D  ALL LE N+MMF+ ++ GDH+V+LL    
Sbjct:   574 LGFKASPDCLEMRAWISIGMEDYEGALKDIRALLTLEPNFMMFNWKIHGDHMVELLRPLA 633

Query:   602 RSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKXXXXXXXXXXXXXXNCQKAAMR 661
             + WS ADCW++LYDRWSSVDDIGSLAV++ ML NDPGK              NCQKAAMR
Sbjct:   634 QQWSQADCWMQLYDRWSSVDDIGSLAVVHHMLANDPGKSLLRFRQSLLLLRLNCQKAAMR 693

Query:   662 CLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTN 721
              LRLARNHS SEHERLVYEGWILYDTGHREEAL++AE+SISI+R+FEAFFLKAY LAD+ 
Sbjct:   694 SLRLARNHSKSEHERLVYEGWILYDTGHREEALAKAEESISIQRSFEAFFLKAYALADST 753

Query:   722 LDPESSTYVIQLLEEALRCPSDGLRKGQ 749
             LDP+SS YVIQLL+EAL+CPSDGLRKGQ
Sbjct:   754 LDPDSSNYVIQLLQEALKCPSDGLRKGQ 781


GO:0005634 "nucleus" evidence=ISM
GO:0009693 "ethylene biosynthetic process" evidence=IMP
GO:0010182 "sugar mediated signaling pathway" evidence=RCA;TAS
GO:0005515 "protein binding" evidence=IPI
GO:0010364 "regulation of ethylene biosynthetic process" evidence=IDA
GO:0030674 "protein binding, bridging" evidence=IPI
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=IPI
GO:0017145 "stem cell division" evidence=IMP
GO:2000069 "regulation of post-embryonic root development" evidence=IMP
GO:0006487 "protein N-linked glycosylation" evidence=RCA
GO:0009755 "hormone-mediated signaling pathway" evidence=RCA
GO:0048825 "cotyledon development" evidence=RCA
GO:0016036 "cellular response to phosphate starvation" evidence=IMP
TAIR|locus:2132402 EOL1 "ETO1-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O65020ETO1_ARATHNo assigned EC number0.60480.99070.7854yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query754
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 2e-08
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
 Score = 52.3 bits (126), Expect = 2e-08
 Identities = 30/98 (30%), Positives = 43/98 (43%), Gaps = 3/98 (3%)

Query: 220 VTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTR 279
           VT  V  K+    +  +A+ S  FKA+    F ES +  I    D VS E  RA+  +  
Sbjct: 2   VTLVVGGKKFHAHKAVLAAHSPYFKALFSSDFKESDKSEIYL--DDVSPEDFRALLNFLY 59

Query: 280 TSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASL 317
           T ++DL     V ELL  A+      +   C+  L  L
Sbjct: 60  TGKLDL-PEENVEELLELADYLQIPGLVELCEEFLLKL 96


Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures. Length = 97

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 754
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
PHA02790480 Kelch-like protein; Provisional 99.95
PHA02713557 hypothetical protein; Provisional 99.95
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.95
PHA03098534 kelch-like protein; Provisional 99.95
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.94
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.94
KOG4350620 consensus Uncharacterized conserved protein, conta 99.93
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.92
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.91
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.91
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.9
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.89
KOG0547606 consensus Translocase of outer mitochondrial membr 99.89
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.88
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.88
KOG0547606 consensus Translocase of outer mitochondrial membr 99.87
PRK11788389 tetratricopeptide repeat protein; Provisional 99.87
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.85
KOG1126638 consensus DNA-binding cell division cycle control 99.85
PRK11189296 lipoprotein NlpI; Provisional 99.83
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.83
PRK11788389 tetratricopeptide repeat protein; Provisional 99.82
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.81
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.8
PLN02789320 farnesyltranstransferase 99.79
PRK12370553 invasion protein regulator; Provisional 99.78
PRK11189296 lipoprotein NlpI; Provisional 99.78
KOG2075521 consensus Topoisomerase TOP1-interacting protein B 99.77
KOG1126638 consensus DNA-binding cell division cycle control 99.76
PRK12370553 invasion protein regulator; Provisional 99.76
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.74
PLN02789320 farnesyltranstransferase 99.74
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.73
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.71
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.7
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.7
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.7
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.69
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.69
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.68
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.67
KOG1125579 consensus TPR repeat-containing protein [General f 99.66
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.65
PRK15359144 type III secretion system chaperone protein SscB; 99.65
PRK15359144 type III secretion system chaperone protein SscB; 99.64
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.64
KOG4591280 consensus Uncharacterized conserved protein, conta 99.64
KOG1129478 consensus TPR repeat-containing protein [General f 99.63
KOG4682488 consensus Uncharacterized conserved protein, conta 99.61
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.6
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.59
KOG2076 895 consensus RNA polymerase III transcription factor 99.59
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.59
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.58
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.58
KOG1125579 consensus TPR repeat-containing protein [General f 99.57
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.56
KOG07831267 consensus Uncharacterized conserved protein, conta 99.55
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.55
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.53
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.5
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.49
PRK14574 822 hmsH outer membrane protein; Provisional 99.49
PRK14574 822 hmsH outer membrane protein; Provisional 99.47
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.45
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.45
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.44
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.44
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.42
KOG0553304 consensus TPR repeat-containing protein [General f 99.42
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.41
PRK10370198 formate-dependent nitrite reductase complex subuni 99.4
KOG1129478 consensus TPR repeat-containing protein [General f 99.4
KOG2076 895 consensus RNA polymerase III transcription factor 99.39
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.38
PRK10370198 formate-dependent nitrite reductase complex subuni 99.37
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.36
KOG0553304 consensus TPR repeat-containing protein [General f 99.35
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.34
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.33
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.3
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.28
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.22
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.22
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.2
PLN03218 1060 maturation of RBCL 1; Provisional 99.19
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.18
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.17
KOG1128777 consensus Uncharacterized conserved protein, conta 99.17
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.16
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.15
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.14
KOG2003840 consensus TPR repeat-containing protein [General f 99.14
PLN03218 1060 maturation of RBCL 1; Provisional 99.13
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.1
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.09
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.09
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.07
PLN03077857 Protein ECB2; Provisional 99.07
PRK11906458 transcriptional regulator; Provisional 99.07
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.07
PRK04841903 transcriptional regulator MalT; Provisional 99.06
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.05
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.05
PLN03077 857 Protein ECB2; Provisional 99.03
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.03
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.02
KOG4648 536 consensus Uncharacterized conserved protein, conta 99.01
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.99
KOG2003840 consensus TPR repeat-containing protein [General f 98.98
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.98
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.97
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.97
PRK11906458 transcriptional regulator; Provisional 98.97
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.92
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.92
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.91
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.91
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.91
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.91
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.91
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.9
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.89
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.89
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.88
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.86
KOG4555175 consensus TPR repeat-containing protein [Function 98.85
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.84
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 98.83
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.81
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.81
KOG0511516 consensus Ankyrin repeat protein [General function 98.8
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.78
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.78
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.76
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.74
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.72
PRK04841 903 transcriptional regulator MalT; Provisional 98.72
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.71
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.7
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.7
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.67
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 98.66
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.65
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.65
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.64
KOG4234271 consensus TPR repeat-containing protein [General f 98.64
KOG4234271 consensus TPR repeat-containing protein [General f 98.62
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.61
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.61
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.6
PRK10803263 tol-pal system protein YbgF; Provisional 98.54
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.52
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.52
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.5
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.5
PF12688120 TPR_5: Tetratrico peptide repeat 98.5
PRK10803263 tol-pal system protein YbgF; Provisional 98.47
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.46
PF1337173 TPR_9: Tetratricopeptide repeat 98.43
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.39
PF12688120 TPR_5: Tetratrico peptide repeat 98.38
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.38
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.37
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.37
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.36
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.35
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.34
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.34
PF1337173 TPR_9: Tetratricopeptide repeat 98.34
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.33
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.33
KOG4555175 consensus TPR repeat-containing protein [Function 98.24
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.22
PRK15331165 chaperone protein SicA; Provisional 98.21
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.21
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.17
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.17
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.16
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.16
PF07707103 BACK: BTB And C-terminal Kelch; InterPro: IPR01170 98.15
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 98.13
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.11
PRK15331165 chaperone protein SicA; Provisional 98.09
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.06
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.06
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.05
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.03
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.02
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.01
PF1343134 TPR_17: Tetratricopeptide repeat 98.0
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.99
KOG2716230 consensus Polymerase delta-interacting protein PDI 97.99
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.98
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.97
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 97.96
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.95
PF13512142 TPR_18: Tetratricopeptide repeat 97.92
COG4700251 Uncharacterized protein conserved in bacteria cont 97.88
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.87
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.86
PF1343134 TPR_17: Tetratricopeptide repeat 97.85
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.85
KOG1987297 consensus Speckle-type POZ protein SPOP and relate 97.83
KOG1915677 consensus Cell cycle control protein (crooked neck 97.81
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.8
COG4700251 Uncharacterized protein conserved in bacteria cont 97.79
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.78
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.77
KOG2838401 consensus Uncharacterized conserved protein, conta 97.74
KOG1915677 consensus Cell cycle control protein (crooked neck 97.74
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 97.71
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.7
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.69
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.69
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.68
KOG2047835 consensus mRNA splicing factor [RNA processing and 97.65
smart00875101 BACK BTB And C-terminal Kelch. The BACK domain is 97.64
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.61
PF13512142 TPR_18: Tetratricopeptide repeat 97.59
PF1342844 TPR_14: Tetratricopeptide repeat 97.54
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.49
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 97.44
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.36
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.3
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.28
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.28
KOG3473112 consensus RNA polymerase II transcription elongati 97.24
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.2
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.16
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.14
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.11
COG3898531 Uncharacterized membrane-bound protein [Function u 97.07
KOG1550552 consensus Extracellular protein SEL-1 and related 97.07
KOG2838401 consensus Uncharacterized conserved protein, conta 97.05
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.98
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.9
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.85
KOG1941518 consensus Acetylcholine receptor-associated protei 96.85
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.84
PF1342844 TPR_14: Tetratricopeptide repeat 96.79
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.72
PF11822317 DUF3342: Domain of unknown function (DUF3342); Int 96.64
KOG1550552 consensus Extracellular protein SEL-1 and related 96.64
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.53
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.53
KOG2471696 consensus TPR repeat-containing protein [General f 96.5
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.5
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.36
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.32
KOG1586288 consensus Protein required for fusion of vesicles 96.31
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.26
KOG1665302 consensus AFH1-interacting protein FIP2, contains 96.22
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.16
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.14
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.12
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.1
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.03
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 96.0
PRK10941269 hypothetical protein; Provisional 95.96
KOG1310 758 consensus WD40 repeat protein [General function pr 95.88
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.84
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.84
KOG2714465 consensus SETA binding protein SB1 and related pro 95.81
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 95.79
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.79
PRK10941269 hypothetical protein; Provisional 95.77
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.76
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 95.75
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.66
COG4941415 Predicted RNA polymerase sigma factor containing a 95.64
KOG2610491 consensus Uncharacterized conserved protein [Funct 95.57
KOG2300629 consensus Uncharacterized conserved protein [Funct 95.53
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.5
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 95.41
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.38
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.38
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 95.31
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.3
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.3
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.29
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.15
KOG1724162 consensus SCF ubiquitin ligase, Skp1 component [Po 95.14
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.14
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 95.11
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 94.94
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.91
KOG0529 421 consensus Protein geranylgeranyltransferase type I 94.79
KOG1585308 consensus Protein required for fusion of vesicles 94.68
KOG1310 758 consensus WD40 repeat protein [General function pr 94.67
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 94.62
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.5
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 94.46
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 94.38
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.23
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.19
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 94.1
KOG1586288 consensus Protein required for fusion of vesicles 93.99
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 93.97
COG2976207 Uncharacterized protein conserved in bacteria [Fun 93.88
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 93.66
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.65
KOG3616 1636 consensus Selective LIM binding factor [Transcript 93.28
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 93.25
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 93.24
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 93.09
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 93.08
COG4976 287 Predicted methyltransferase (contains TPR repeat) 92.91
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 92.85
KOG4507 886 consensus Uncharacterized conserved protein, conta 92.83
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 92.34
COG4976287 Predicted methyltransferase (contains TPR repeat) 92.15
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 92.01
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 91.73
KOG4507 886 consensus Uncharacterized conserved protein, conta 91.43
KOG1585308 consensus Protein required for fusion of vesicles 91.27
COG4941415 Predicted RNA polymerase sigma factor containing a 91.23
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 91.18
COG2912269 Uncharacterized conserved protein [Function unknow 91.15
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 90.86
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 90.73
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 90.64
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 90.6
PF1286294 Apc5: Anaphase-promoting complex subunit 5 90.34
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 90.16
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 90.05
KOG2471 696 consensus TPR repeat-containing protein [General f 89.72
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 89.64
KOG1778319 consensus CREB binding protein/P300 and related TA 89.55
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 89.49
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 88.75
COG2912269 Uncharacterized conserved protein [Function unknow 88.55
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 88.55
KOG3364149 consensus Membrane protein involved in organellar 88.41
COG3629280 DnrI DNA-binding transcriptional activator of the 88.15
KOG2715210 consensus Uncharacterized conserved protein, conta 87.83
COG5201158 SKP1 SCF ubiquitin ligase, SKP1 component [Posttra 87.36
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 87.34
PF0146678 Skp1: Skp1 family, dimerisation domain; InterPro: 87.28
KOG0511516 consensus Ankyrin repeat protein [General function 86.15
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 86.13
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 85.95
COG4649221 Uncharacterized protein conserved in bacteria [Fun 85.26
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 84.81
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 84.56
KOG0529 421 consensus Protein geranylgeranyltransferase type I 84.28
PF09986214 DUF2225: Uncharacterized protein conserved in bact 83.92
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 83.51
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 82.59
KOG2300629 consensus Uncharacterized conserved protein [Funct 82.28
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 82.21
KOG3616 1636 consensus Selective LIM binding factor [Transcript 81.93
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 81.89
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 81.89
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 81.76
KOG3364149 consensus Membrane protein involved in organellar 80.58
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=1.4e-33  Score=308.31  Aligned_cols=297  Identities=16%  Similarity=0.140  Sum_probs=263.9

Q ss_pred             HHHHHhhhhhhHhhccchHHHHHHHHHHhhhcc--hhhhhhHHHHHHHhCCHHHHHHHHHHHHHccCCCHHHHHHhhh--
Q 004426          418 RMLALHQLGCVMFEREEYKDACYYFEAAADAGH--IYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSL--  493 (754)
Q Consensus       418 ka~Al~~LG~v~~~~g~~~eA~~~f~~AL~~~~--~~a~~~larv~~~~G~~~~A~~~~~~aI~~~~~~g~ay~~r~~--  493 (754)
                      .+++|-+||++.-..|+..+|+..|++|++++|  .++++++|+|+-..+.++.|+..|.+|+..+|+.+.++.+.+.  
T Consensus       217 fAiawsnLg~~f~~~Gei~~aiq~y~eAvkldP~f~dAYiNLGnV~ke~~~~d~Avs~Y~rAl~lrpn~A~a~gNla~iY  296 (966)
T KOG4626|consen  217 FAIAWSNLGCVFNAQGEIWLAIQHYEEAVKLDPNFLDAYINLGNVYKEARIFDRAVSCYLRALNLRPNHAVAHGNLACIY  296 (966)
T ss_pred             eeeeehhcchHHhhcchHHHHHHHHHHhhcCCCcchHHHhhHHHHHHHHhcchHHHHHHHHHHhcCCcchhhccceEEEE
Confidence            467899999999999999999999999999976  4689999999999999999999999999999998888877753  


Q ss_pred             cCCh--hhHHHHHHHHHhhCCCChHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCC-HHHHHHHHHHHHHcCCHHHHHHH
Q 004426          494 YNLG--REKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLS-VDCLELRAWLFIAADDYESALRD  570 (754)
Q Consensus       494 y~~g--~eAl~dl~kAi~LdP~~~~ay~~rg~~l~~lg~~~eAl~~~~rAl~l~p~-~~~~~~ra~~~~~lgd~~~Al~d  570 (754)
                      |.+|  +-|+..|.+|++++|++..||.|+|+++.+.|+..||...|++||.+.|+ ++..+++|+++.++|.+++|++.
T Consensus       297 yeqG~ldlAI~~Ykral~~~P~F~~Ay~NlanALkd~G~V~ea~~cYnkaL~l~p~hadam~NLgni~~E~~~~e~A~~l  376 (966)
T KOG4626|consen  297 YEQGLLDLAIDTYKRALELQPNFPDAYNNLANALKDKGSVTEAVDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRL  376 (966)
T ss_pred             eccccHHHHHHHHHHHHhcCCCchHHHhHHHHHHHhccchHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhccchHHHHH
Confidence            3333  88999999999999999999999999999999999999999999999996 89999999999999999999999


Q ss_pred             HHHHHhcCCCccccccchhhhHHHHHHhhhhccccchhhhhhhhhccccccccchHHHHHHHHHcCCCChhHHHhHHHHH
Q 004426          571 TLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLL  650 (754)
Q Consensus       571 ~~~al~l~P~~~~~~~~~~~~~~~~~l~~~~~~~~~A~~~~~l~~~~~~~~d~~al~~~~~aL~l~P~~~~~~~~~g~~L  650 (754)
                      |.+|++..|.+      .++.+.++.+...+...++|                  +.+|..||.++|..++++.|+|+++
T Consensus       377 y~~al~v~p~~------aaa~nNLa~i~kqqgnl~~A------------------i~~YkealrI~P~fAda~~NmGnt~  432 (966)
T KOG4626|consen  377 YLKALEVFPEF------AAAHNNLASIYKQQGNLDDA------------------IMCYKEALRIKPTFADALSNMGNTY  432 (966)
T ss_pred             HHHHHhhChhh------hhhhhhHHHHHHhcccHHHH------------------HHHHHHHHhcCchHHHHHHhcchHH
Confidence            99999999998      44555555444445555555                  8999999999999999999999999


Q ss_pred             HHcCCHHHHHHHHHHHHhcCCCchhHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCChH-HHHHHHHHhhccC--CC-CCc
Q 004426          651 LRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFE-AFFLKAYILADTN--LD-PES  726 (754)
Q Consensus       651 ~~lg~~eeAl~~~~~Al~l~P~~~ea~~~~G~~ly~~G~~eeAl~~~e~Ai~l~~~~~-a~~~~~~~~~~~~--~~-~~~  726 (754)
                      -.+|+..+|+.+|.+|+..+|..+||+.|+|.++-+.|+..+|++.|++|+.|+|+|. ||-+.+-++-=-+  .| ..-
T Consensus       433 ke~g~v~~A~q~y~rAI~~nPt~AeAhsNLasi~kDsGni~~AI~sY~~aLklkPDfpdA~cNllh~lq~vcdw~D~d~~  512 (966)
T KOG4626|consen  433 KEMGDVSAAIQCYTRAIQINPTFAEAHSNLASIYKDSGNIPEAIQSYRTALKLKPDFPDAYCNLLHCLQIVCDWTDYDKR  512 (966)
T ss_pred             HHhhhHHHHHHHHHHHHhcCcHHHHHHhhHHHHhhccCCcHHHHHHHHHHHccCCCCchhhhHHHHHHHHHhcccchHHH
Confidence            9999999999999999999999999999999999999999999999999999999999 9999998874222  22 122


Q ss_pred             hhHHHHHHHHHh
Q 004426          727 STYVIQLLEEAL  738 (754)
Q Consensus       727 ~~~~~~~~~~~~  738 (754)
                      -.++++..++-+
T Consensus       513 ~~kl~sivrdql  524 (966)
T KOG4626|consen  513 MKKLVSIVRDQL  524 (966)
T ss_pred             HHHHHHHHHHHH
Confidence            355666666654



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4350 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG2075 consensus Topoisomerase TOP1-interacting protein BTBD1 [Function unknown] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4591 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4682 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO) Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2716 consensus Polymerase delta-interacting protein PDIP1 and related proteins, contain BTB/POZ domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1987 consensus Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>smart00875 BACK BTB And C-terminal Kelch Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3473 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin C [Transcription] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG2714 consensus SETA binding protein SB1 and related proteins, contain BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG1724 consensus SCF ubiquitin ligase, Skp1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1778 consensus CREB binding protein/P300 and related TAZ Zn-finger proteins [Transcription] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2715 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>COG5201 SKP1 SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF01466 Skp1: Skp1 family, dimerisation domain; InterPro: IPR016072 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query754
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 7e-08
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 1e-07
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 2e-07
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 4e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-06
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-04
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-07
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-05
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 4e-06
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 8e-06
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-05
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-05
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-05
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-05
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 3e-05
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-05
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-05
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 2e-04
2vpk_A116 Myoneurin; transcription regulation, transcription 3e-04
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 3e-04
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 7e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 73.7 bits (180), Expect = 2e-13
 Identities = 103/682 (15%), Positives = 198/682 (29%), Gaps = 181/682 (26%)

Query: 131 SARQYA-GDLHLKVVLSAWLK-FERR--EDELLGSSSMDCCGFILECPKAALISGCDPNS 186
              QY   D+ L V   A++  F+ +  +D      S +    I+             + 
Sbjct: 12  GEHQYQYKDI-LSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKD-------AVSG 63

Query: 187 TYDHCKCFEENAKSNLGPIVEKFVCLSLEED-----DSVTFCVRDKEI---SFV--RNKI 236
           T           +     +V+KFV   L  +       +    R   +    ++  R+++
Sbjct: 64  TLRLFWTLLSKQEE----MVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRL 119

Query: 237 ASLSSPFKAMLYGGFVESKRKTIDF--------SHDGVSVEGLR-------AVEVYTRTS 281
            + +  F        V   +  +              V ++G+        A++V   + 
Sbjct: 120 YNDNQVFAKY----NVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVC-LSY 174

Query: 282 RVDLFCPGIVLELLSFANRFCCEE----MKSAC---DAHLASLVGDIEDALILIDYGLEE 334
           +V       +   L+  N    E     ++      D +  S   D    + L  + ++ 
Sbjct: 175 KVQCKMDFKIF-WLNLKNCNSPETVLEMLQKLLYQIDPNWTSR-SDHSSNIKLRIHSIQA 232

Query: 335 RATLLVAS-----CLQVLLRELPSSLYNPKVMKIF---CSSEATERLANVGHASFLLYYF 386
               L+ S     CL VL      ++ N K    F   C    T R   V    FL    
Sbjct: 233 ELRRLLKSKPYENCLLVL-----LNVQNAKAWNAFNLSCKILLTTRFKQV--TDFLSAAT 285

Query: 387 LSQVAMEKDRVSNTTVMLLERLGECSTERWQ----RMLALHQLGCVMFEREEYKDACYYF 442
            + ++++   ++ T   +   L +    R Q     +L  +     +   E  +D     
Sbjct: 286 TTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIA-ESIRD----- 339

Query: 443 EAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIV 502
                        GLA       +  +  KL   I            E SL         
Sbjct: 340 -------------GLATWDNW--KHVNCDKLTTII------------ESSL--------- 363

Query: 503 DLNYASELDPTLSFPYKYRAVAKMEEG-QI---------RAAISEIDRIIVFKLSVDCLE 552
                + L+P       +  ++       I            I     ++V KL    L 
Sbjct: 364 -----NVLEPAEYRKM-FDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLV 417

Query: 553 LRAWLFIAADDYESALRD-TLALLALESNYMMFHGRVSGDHLVKLLNHH--VRSWSPADC 609
            +        +   ++    L L     N    H          +++H+   +++   D 
Sbjct: 418 EKQP-----KESTISIPSIYLELKVKLENEYALHR--------SIVDHYNIPKTFDSDDL 464

Query: 610 WIKLYDR-WSSVDDIGS-LAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLAR 667
                D+ + S   IG  L  I         +    FR   + L     +  +R    A 
Sbjct: 465 IPPYLDQYFYSH--IGHHLKNIEH------PERMTLFRM--VFLDFRFLEQKIRHDSTAW 514

Query: 668 NHSSSEHERL----VYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLD 723
           N S S    L     Y+ +I  +    E  ++      +I       FL      + NL 
Sbjct: 515 NASGSILNTLQQLKFYKPYICDNDPKYERLVN------AILD-----FLPKI---EENLI 560

Query: 724 PESSTYVIQLLEEALRCPSDGL 745
               T ++++   AL    + +
Sbjct: 561 CSKYTDLLRI---ALMAEDEAI 579


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query754
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.98
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.97
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 99.96
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.95
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.95
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.94
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.94
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.94
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.93
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.93
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.93
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.93
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.93
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.93
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.93
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.93
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.92
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.92
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.92
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.92
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.91
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.91
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.91
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.91
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.91
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.9
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.9
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.9
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.89
3u4t_A272 TPR repeat-containing protein; structural genomics 99.89
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.89
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.87
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.87
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.86
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.86
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.86
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.86
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.86
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.86
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.86
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.85
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.85
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.85
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.84
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.84
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.83
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.83
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.83
3u4t_A272 TPR repeat-containing protein; structural genomics 99.83
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.83
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.83
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.83
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.82
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.82
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.82
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.82
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.82
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.81
2vpk_A116 Myoneurin; transcription regulation, transcription 99.81
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.81
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.81
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.81
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.81
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.8
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.8
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.8
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.8
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.8
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.79
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.79
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.79
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.79
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.79
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.79
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.79
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.78
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.78
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.78
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.77
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.77
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.77
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.77
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.76
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.76
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.76
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.76
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.75
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.75
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.75
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.75
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.75
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.75
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.75
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.74
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.74
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.74
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.72
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.72
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.71
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.7
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.7
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.7
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.7
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.7
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.69
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.68
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.68
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.68
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.67
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.67
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.67
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.67
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.65
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.65
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.65
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.64
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.63
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.63
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.62
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.62
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.62
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.62
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.61
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.6
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.6
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.6
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.59
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.58
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.58
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.57
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.57
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.56
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.56
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.55
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.54
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.54
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.54
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.53
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.53
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.52
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.52
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.51
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.5
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.49
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.49
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.48
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 99.47
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.47
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.47
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.46
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.46
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.45
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.45
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.45
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.44
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.44
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.43
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.43
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.42
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.4
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.4
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.4
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.4
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.39
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.39
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.38
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.38
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.38
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.38
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.37
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.37
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.37
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.34
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.32
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.31
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.31
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.3
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.3
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.3
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.29
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.29
3k9i_A117 BH0479 protein; putative protein binding protein, 99.29
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.29
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.28
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.27
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.26
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.26
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.25
3k9i_A117 BH0479 protein; putative protein binding protein, 99.24
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.24
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.23
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.23
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.21
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.2
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.19
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.19
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.18
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.17
4ajy_C97 Transcription elongation factor B polypeptide 1; E 99.16
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 99.15
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.13
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.11
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.1
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.1
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.09
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.03
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.02
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.02
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 99.01
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.0
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.99
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 98.99
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.97
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.96
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.83
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.82
2eqx_A105 Kelch repeat and BTB domain-containing protein 4; 98.78
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.76
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.76
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.76
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.67
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.65
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.61
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.57
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.52
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 98.46
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.46
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.45
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.43
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 98.37
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.35
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.34
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 98.31
2fnj_C96 Transcription elongation factor B polypeptide 1; b 98.3
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.28
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.2
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.19
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.17
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.02
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.92
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 97.9
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 97.86
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.7
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.68
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.65
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.57
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 97.52
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.21
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.62
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 96.37
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.29
3kvt_A115 Potassium channel protein SHAW; tetramerization do 96.12
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.78
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.78
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 95.65
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 95.64
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 95.54
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 95.27
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 95.15
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 94.84
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 94.74
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 94.3
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 94.26
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.14
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 92.12
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 92.11
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.07
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.36
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 91.16
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 90.51
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 90.44
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 90.22
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 88.44
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 84.72
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 80.24
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=99.98  E-value=3e-30  Score=281.15  Aligned_cols=319  Identities=16%  Similarity=0.091  Sum_probs=203.2

Q ss_pred             hhhHHHHHHHhhhchhhhHHHHHHHhhhhhhHhhccchHHHHHHHHHHhhhcch--hhhhhHHHHHHHhCCHHHHHHHHH
Q 004426          398 SNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHI--YSLAGLARAKYKVGQQYSAYKLIN  475 (754)
Q Consensus       398 ~~~~v~LLer~vr~~~~~~qka~Al~~LG~v~~~~g~~~eA~~~f~~AL~~~~~--~a~~~larv~~~~G~~~~A~~~~~  475 (754)
                      .+....+++.+++..+.   ...+++.+|.++...|++++|+..|+++++++|.  .++.++|.++...|++++|...+.
T Consensus        49 ~~~a~~~~~~a~~~~p~---~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~  125 (388)
T 1w3b_A           49 LDRSAHFSTLAIKQNPL---LAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYV  125 (388)
T ss_dssp             HHHHHHHHHHHHHHCTT---CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHH
T ss_pred             HHHHHHHHHHHHhcCCC---chHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCcchHHHHHHHHHHHHHcCCHHHHHHHHH
Confidence            34455555555443322   2456667777777777777777777777776443  356667777777777777777777


Q ss_pred             HHHHccCCCHHHHHHhhhc----CChhhHHHHHHHHHhhCCCChHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCC-HHH
Q 004426          476 SIISEHKPTGWMYQERSLY----NLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLS-VDC  550 (754)
Q Consensus       476 ~aI~~~~~~g~ay~~r~~y----~~g~eAl~dl~kAi~LdP~~~~ay~~rg~~l~~lg~~~eAl~~~~rAl~l~p~-~~~  550 (754)
                      +++...|+...++...+..    +..++|+..|+++++.+|+++.+|.++|.++..+|++++|+..|+++++++|+ +..
T Consensus       126 ~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~  205 (388)
T 1w3b_A          126 SALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDA  205 (388)
T ss_dssp             HHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHH
T ss_pred             HHHHhCCCcHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHH
Confidence            7777777665555554421    23367777777777777777777777777777777777777777777777775 566


Q ss_pred             HHHHHHHHHHcCCHHHHHHHHHHHHhcCCCccccccchh-hhHHHHHHhhhhc--------cccchhhhhhhhhcccccc
Q 004426          551 LELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVS-GDHLVKLLNHHVR--------SWSPADCWIKLYDRWSSVD  621 (754)
Q Consensus       551 ~~~ra~~~~~lgd~~~Al~d~~~al~l~P~~~~~~~~~~-~~~~~~~l~~~~~--------~~~~A~~~~~l~~~~~~~~  621 (754)
                      +..+|.++...|++++|+..|+++++++|++...+.+.+ +....+......+        ..+..++|..+...+...+
T Consensus       206 ~~~lg~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g  285 (388)
T 1w3b_A          206 YINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKG  285 (388)
T ss_dssp             HHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHS
T ss_pred             HHHHHHHHHHcCCHHHHHHHHHHHHhhCcCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcC
Confidence            666777777777777777777777777776643222111 1111111111110        1112233444444444444


Q ss_pred             ccc-hHHHHHHHHHcCCCChhHHHhHHHHHHHcCCHHHHHHHHHHHHhcCCCchhHHHHHHHHHHHcCCHHHHHHHHHHH
Q 004426          622 DIG-SLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKS  700 (754)
Q Consensus       622 d~~-al~~~~~aL~l~P~~~~~~~~~g~~L~~lg~~eeAl~~~~~Al~l~P~~~ea~~~~G~~ly~~G~~eeAl~~~e~A  700 (754)
                      ++. |+..++++++++|.++.+++++|.++..+|++++|+..++++++++|+++.+++++|+++..+|++++|+..|+++
T Consensus       286 ~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~a  365 (388)
T 1w3b_A          286 SVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEA  365 (388)
T ss_dssp             CHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHhhCcccHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHH
Confidence            544 5667777777777777777777777777777777777777777777777777777777777777777777777777


Q ss_pred             HhcCCChH-HHHHHHHHhhc
Q 004426          701 ISIERTFE-AFFLKAYILAD  719 (754)
Q Consensus       701 i~l~~~~~-a~~~~~~~~~~  719 (754)
                      ++++|++. +++..|.++.+
T Consensus       366 ~~~~p~~~~a~~~lg~~~~~  385 (388)
T 1w3b_A          366 IRISPTFADAYSNMGNTLKE  385 (388)
T ss_dssp             HTTCTTCHHHHHHHHHHHHH
T ss_pred             HhhCCCCHHHHHhHHHHHHH
Confidence            77777766 77777776654



>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 754
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-06
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.002
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 48.1 bits (113), Expect = 2e-06
 Identities = 21/144 (14%), Positives = 42/144 (29%), Gaps = 6/144 (4%)

Query: 405 LERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAA--ADAGHIYSLAGLARAKY 462
           +       +      +    L CV +E+     A   +  A         +   LA A  
Sbjct: 223 VAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALK 282

Query: 463 KVGQQYSAYKLINSIISEHKPTGWMYQERS--LYNLGR--EKIVDLNYASELDPTLSFPY 518
           + G    A    N+ +             +      G   E +     A E+ P  +  +
Sbjct: 283 EKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAH 342

Query: 519 KYRAVAKMEEGQIRAAISEIDRII 542
              A    ++G+++ A+      I
Sbjct: 343 SNLASVLQQQGKLQEALMHYKEAI 366


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query754
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.97
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.94
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.92
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.9
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.89
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.89
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.84
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.83
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.83
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.81
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.77
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.74
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.72
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.65
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.62
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.59
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.56
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.55
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.49
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.48
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.48
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.43
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.4
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.38
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.38
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.36
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.35
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.35
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.34
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.32
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.3
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.3
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.29
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.28
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.27
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.26
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.21
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.21
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.2
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.19
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.19
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.13
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.08
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.08
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.04
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.93
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.82
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.74
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.67
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.62
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.0
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 97.66
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.6
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.48
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.39
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 97.36
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 97.12
d3kvta_103 akv3.1 voltage-gated potassium channel {California 97.01
d1t1da_100 Shaker potassium channel {California sea hare (Apl 96.43
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 93.89
d1fs1b155 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 89.04
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 87.7
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 86.67
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 86.53
d1nexa170 Centromere DNA-binding protein complex Cbf3 subuni 85.69
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=2e-28  Score=258.60  Aligned_cols=295  Identities=14%  Similarity=0.032  Sum_probs=233.5

Q ss_pred             hhhHHHHHHHhhhchhhhHHHHHHHhhhhhhHhhccchHHHHHHHHHHhhhcc--hhhhhhHHHHHHHhCCHHHHHHHHH
Q 004426          398 SNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGH--IYSLAGLARAKYKVGQQYSAYKLIN  475 (754)
Q Consensus       398 ~~~~v~LLer~vr~~~~~~qka~Al~~LG~v~~~~g~~~eA~~~f~~AL~~~~--~~a~~~larv~~~~G~~~~A~~~~~  475 (754)
                      .+.+...++++++..++.   ..+++.+|.++...|++++|+..|+++++++|  ..++..+|.++..+|++++|+..+.
T Consensus        15 ~~~A~~~~~~~l~~~p~~---~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~A~~~~~   91 (388)
T d1w3ba_          15 FEAAERHCMQLWRQEPDN---TGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYR   91 (388)
T ss_dssp             HHHHHHHHHHHHHHCTTC---HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhCCCC---HHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhccccccccccc
Confidence            445556666655433322   45667777777777888888888877777754  3466677777777787777777665


Q ss_pred             HHHHcc--------------------------------------------------------------------CCCHHH
Q 004426          476 SIISEH--------------------------------------------------------------------KPTGWM  487 (754)
Q Consensus       476 ~aI~~~--------------------------------------------------------------------~~~g~a  487 (754)
                      .++...                                                                    |+.+.+
T Consensus        92 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  171 (388)
T d1w3ba_          92 HALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVA  171 (388)
T ss_dssp             HHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHH
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccCcchhHH
Confidence            555443                                                                    333344


Q ss_pred             HHHhhh----cCChhhHHHHHHHHHhhCCCChHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCC-HHHHHHHHHHHHHcC
Q 004426          488 YQERSL----YNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLS-VDCLELRAWLFIAAD  562 (754)
Q Consensus       488 y~~r~~----y~~g~eAl~dl~kAi~LdP~~~~ay~~rg~~l~~lg~~~eAl~~~~rAl~l~p~-~~~~~~ra~~~~~lg  562 (754)
                      +..++.    .+...+|...++++++++|+++.+|..+|.++...|++++|+..|++++.++|. +..+..+|.++..+|
T Consensus       172 ~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~  251 (388)
T d1w3ba_         172 WSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQG  251 (388)
T ss_dssp             HHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTT
T ss_pred             HHhhcccccccCcHHHHHHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCC
Confidence            433332    122278888999999999999999999999999999999999999999999885 677788899999999


Q ss_pred             CHHHHHHHHHHHHhcCCCccccccchhhhHHHHHHhhhhccccchhhhhhhhhccccccccchHHHHHHHHHcCCCChhH
Q 004426          563 DYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFL  642 (754)
Q Consensus       563 d~~~Al~d~~~al~l~P~~~~~~~~~~~~~~~~~l~~~~~~~~~A~~~~~l~~~~~~~~d~~al~~~~~aL~l~P~~~~~  642 (754)
                      ++++|+..|+++++++|++.      .+...++.+....+++++                  |+..+++++...|.++..
T Consensus       252 ~~~~A~~~~~~al~~~p~~~------~~~~~l~~~~~~~~~~~~------------------A~~~~~~~~~~~~~~~~~  307 (388)
T d1w3ba_         252 LIDLAIDTYRRAIELQPHFP------DAYCNLANALKEKGSVAE------------------AEDCYNTALRLCPTHADS  307 (388)
T ss_dssp             CHHHHHHHHHHHHHTCSSCH------HHHHHHHHHHHHHSCHHH------------------HHHHHHHHHHHCTTCHHH
T ss_pred             CHHHHHHHHHHHHHhCCCCH------HHHHHHHHHHHHcCCHHH------------------HHHHHHhhhccCCccchh
Confidence            99999999999999999873      233333333333334443                  488999999999999999


Q ss_pred             HHhHHHHHHHcCCHHHHHHHHHHHHhcCCCchhHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCChH-HHHHHHHHhhc
Q 004426          643 RFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFE-AFFLKAYILAD  719 (754)
Q Consensus       643 ~~~~g~~L~~lg~~eeAl~~~~~Al~l~P~~~ea~~~~G~~ly~~G~~eeAl~~~e~Ai~l~~~~~-a~~~~~~~~~~  719 (754)
                      ++.+|.++..+|++++|+..|++|++++|+++++++++|.++..+|++++|+..|++|++++|++. +++.+|.++.+
T Consensus       308 ~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~  385 (388)
T d1w3ba_         308 LNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKE  385 (388)
T ss_dssp             HHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHH
T ss_pred             hhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999999988 99999998754



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure