Citrus Sinensis ID: 004449


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750---
MASLVAKGSSSSCQVSPLMLVQEKGSRNKRKFRADPPLGEPNKIIPSPQNECPTYEFTAEKFDITPGHGQTGACDLCGVNQDHSDGLKLDLGLSSAVGSSEVGPSRPREELEVEEFQDADWSDLTESQLEELVLSNLDAIFKSAIKKIVACGYMEEVATKAVLRSGLCYGSKDTVSNIVDNTLAFLRSGQEINSSREHYFQDLPQLEKYILAELVCVLREVRPFFSTGDAMWCLLICDMNVSHACAMDGDPLSSFSGDGASNGNSHITTQLQTKTEAKCSELNLPNPSKPVPSIPCSHSSQPEAPTVAGIPNITKSKNSHVGSEISEKDGTNSISDNVDKTFSVAGTSQSPALEEKFVGSRKVHSGSSKREYMLRQKSLHLEKHYRTYGSKGSSRAGKLSGLGGLILDKKLKSVSDTTSVNLKNASSKISKAIEVHQDNGSHNLSTSPGTSSPATFHSQGANAISALPKTSMPSTFPPGGTPAVLPLANTLPVLSAADTELSLSLPTKSNSTQVPAGINSVAPNCGYAGILSDDTSLEHLVPQDKRDEIILKLIPRVRELHNQLHEWTEWANQKVMQAARRLSKDKAELKTLRQEKEEVERLKKEKQILEENTMKKLSEMENALCKASGQVERANSAVRRLEVENTALRQEMEAAKLRAAESAASCQEVSKREKKTQMKFQSWEKQKALFQEELVTEKRKVVQLLQELDQAKALQEQLEEMSNETALISDPWRYDYNACWFQQSALSSPNMCV
cccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
cccEEEEcccccccccccEcccccccccccccccccccccccccccccccccccccccHHHcccccccccccHHHHHcccHHHHHHHccccccccccccHccccccccHHccHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccHHHHHHHccccEEEccccEccccccccccccccccHHHHHcccccccccccccccccccHHHEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccHccccEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
maslvakgsssscqvsplmlvqekgsrnkrkfradpplgepnkiipspqnecptyeftaekfditpghgqtgacdlcgvnqdhsdglkldlglssavgssevgpsrpreeleveefqdadwsdlteSQLEELVLSNLDAIFKSAIKKIVACGYMEEVATKAVLrsglcygskdtvsniVDNTLAFLRSGQEINSSREHYFQDLPQLEKYILAELVCVLRevrpffstgDAMWCLLICDMnvshacamdgdplssfsgdgasngnshittqlqtkteakcselnlpnpskpvpsipcshssqpeaptvagipnitksknshvgseisekdgtnsisdnvdktfsvagtsqspaleekfvgsrkvhsgsskrEYMLRQKSLHLEKHYrtygskgssragklsglgglildkklksvsdttsvnlknasSKISKAIEVhqdngshnlstspgtsspatfhsqganaisalpktsmpstfppggtpavlplantlpvlsaadtelslslptksnstqvpaginsvapncgyagilsddtslehlvpqdkrdEIILKLIPRVRELHNQLHEWTEWANQKVMQAARRLSKDKAELKTLRQEKEEVERLKKEKQILEENTMKKLSEMENALCKASGQVERANSAVRRLEVENTALRQEMEAAKLRAAESAASCQEVSKREKKTQMKFQSWEKQKALFQEELVTEKRKVVQLLQELDQAKALQEQLEEMsnetalisdpwrydynacwfqqsalsspnmcv
maslvakgsssscqvsplmlvqekgsrnkrkfradpplgepnkiipspqnECPTYEFTAEKFDITPGHGQTGACDLCGVNQDHSDGLKLDLGLSSavgssevgpsrpreelevEEFQDADWSDLTESQLEELVLSNLDAIFKSAIKKIVACGYMEEVATKAVLRSGLCYGSKDTVSNIVDNTLAFLRSGQEINSSREHYFQDLPQLEKYILAELVCVLREVRPFFSTGDAMWCLLICDMNVSHACAMDGDPLSSFSGDGASNGNSHITTQLQTKTEAKCSELNLPNPSKPVPSIPCSHSSQPEAPTVAGipnitksknshvgseisekdgtnsisdNVDKTFSVagtsqspaleekfvgsrkvhsgsskreYMLRQKSLHLEKHYRtygskgssragklSGLGGLILDKKLKSVSDTTSVNLKNASSKISKAIEVHQDNGSHNLSTSPGTSSPATFHSQGANAISALPKTSMPSTFPPGGTPAVLPLANTLPVLSAADTELSLSlptksnstqvpaGINSVAPNCGYAGILSDDTSLEHLVPQDKRDEIILKLIPRVRELHNQLHEWTEWANQKVMQAARRLSKDKaelktlrqekeeverlkkekqilEENTMKKLSEMENALCKASgqveransavRRLEVENTALRQEMEAAKLRAAESAASCQEVSKREKKTQMKFQSWEKQKALFQEELVTEKRKVVQLLQELDQAKALQEQLEEMSNETALISDPWRYDYNACWFqqsalsspnmcv
MASLVAKGSSSSCQVSPLMLVQEKGSRNKRKFRADPPLGEPNKIIPSPQNECPTYEFTAEKFDITPGHGQTGACDLCGVNQDHsdglkldlglssAVGSSEVGPSRPREELEVEEFQDADWSDLTESQLEELVLSNLDAIFKSAIKKIVACGYMEEVATKAVLRSGLCYGSKDTVSNIVDNTLAFLRSGQEINSSREHYFQDLPQLEKYILAELVCVLREVRPFFSTGDAMWCLLICDMNVSHACAMDGDPLSSFSGDGASNGNSHITTQLQTKTEAKCSELNLPNPSKPVPSIPCSHSSQPEAPTVAGIPNITKSKNSHVGSEISEKDGTNSISDNVDKTFSVAGTSQSPALEEKFVGSRKVHSGSSKREYMLRQKSLHLEKHYRTYGSKGSSRAgklsglgglildkklkSVSDTTSVNLKNASSKISKAIEVHQDNGSHNLSTSPGTSSPATFHSQGANAISALPKTSMPSTFPPGGTPAVLPLANTLPVLSAADTELSLSLPTKSNSTQVPAGINSVAPNCGYAGILSDDTSLEHLVPQDKRDEIILKLIPRVRELHNQLHEWTEWANQKVMQAARRLSKDKAELKTlrqekeeverlkkekqILEENTMKKLSEMENALCKASGQVERANSAVRRLEVENTALRQEMeaaklraaesaasCQEVSKREKKTQMKFQSWEKQKALFQEELVTEKRKVVQLLQELDQAKALQEQLEEMSNETALISDPWRYDYNACWFQQSALSSPNMCV
*****************************************************TYEFTAEKFDITPGHGQTGACDLCGVNQD*****************************************LTESQLEELVLSNLDAIFKSAIKKIVACGYMEEVATKAVLRSGLCYGSKDTVSNIVDNTLAFLRSGQEINSSREHYFQDLPQLEKYILAELVCVLREVRPFFSTGDAMWCLLICDMNVSHACAM************************************************************************************************************************************************************GLIL**********************************************************************************TL*V***********************GINSVAPNCGYAGILSDDTSLEHLVPQDKRDEIILKLIPRVRELHNQLHEWTEWANQKV*****************************************************************************************************************LFQEELVTEKRKVVQLLQ******************TALISDPWRYDYNACWFQQ**********
*********************************************PSPQNECPTYEFTAEKFDIT********CDLCGVNQDHSDGLKLDLGLSSAVGSSEV***********EEFQDADWSDLTESQLEELVLSNLDAIFKSAIKKIVACGYMEEVATKAVLRSGLCYGSKDTVSNIVDNTLAF*************YFQDLPQLEKYILAELVCVLREVRPFFSTGDAMWCLLICDMNVSHA**************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************MC*
**************VSPLMLVQEKGSRNKRKFRADPPLGEPNKIIPSPQNECPTYEFTAEKFDITPGHGQTGACDLCGVNQDHSDGLKLDLGLS**********************QDADWSDLTESQLEELVLSNLDAIFKSAIKKIVACGYMEEVATKAVLRSGLCYGSKDTVSNIVDNTLAFLRSGQEINSSREHYFQDLPQLEKYILAELVCVLREVRPFFSTGDAMWCLLICDMNVSHACAMDGDPLSSFSGDGASNGNSHITTQLQTKTEAKCSELNLPNPSK***************PTVAGIPNITKS***************NSISDNVDKTFSVAGTSQSPALEEK**************EYMLRQKSLHLEKHYRTYGSKGSSRAGKLSGLGGLILDKKLKSVSDTTSVNLKNASSKISKAIEVHQD****************TFHSQGANAISALPKTSMPSTFPPGGTPAVLPLANTLPVLSAADTELSLSLPTKSNSTQVPAGINSVAPNCGYAGILSDDTSLEHLVPQDKRDEIILKLIPRVRELHNQLHEWTEWANQKVMQAARRLSKDKAELKTLRQEKEEVERLKKEKQILEENTMKKLSEMENALCKASGQVERANSAVRRLEVENTALRQEMEA***************************SWEKQKALFQEELVTEKRKVVQLLQELDQAKALQEQLEEMSNETALISDPWRYDYNACWFQQSA********
*********************************************PSPQNECPTYEFTAEKFDITPGHGQTGACDLCGVNQDHSDGLKLDLGLSSAVGSSEVGPSRPREELEVEEFQDADWSDLTESQLEELVLSNLDAIFKSAIKKIVACGYMEEVATKAVLRSGLCYGSKDTVSNIVDNTLAFLRSGQEINSSREHYFQDLPQLEKYILAELVCVLREVRPFFSTGDAMWCLLICDMNVSHACAMDGDP*******************************************************************************************************************SSKREYMLRQKSLHLEKHYRTY***********************************NASSKISKAIEVHQ***********************************************************************************VAPNCGYAGILSDDTSLEHLVPQDKRDEIILKLIPRVRELHNQLHEWTEWANQKVMQAARRLSKDKAELKTLRQEKEEVERLKKEKQILEENTMKKLSEMENALCKASGQVERANSAVRRLEVENTALRQEMEAAKLRAAESAASCQEVSKREKKTQMKFQSWEKQKALFQEELVTEKRKVVQLLQELDQAKALQEQLEEMSNETALISDPWRYDYNACWFQQSALS****C*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASLVAKGSSSSCQVSPLMLVQEKGSRNKRKFRADPPLGEPNKIIPSPQNECPTYEFTAEKFDITPGHGQTGACDLCGVNQDHSDGLKLDLGLSSAVGSSEVGPSRPREELEVEEFQDADWSDLTESQLEELVLSNLDAIFKSAIKKIVACGYMEEVATKAVLRSGLCYGSKDTVSNIVDNTLAFLRSGQEINSSREHYFQDLPQLEKYILAELVCVLREVRPFFSTGDAMWCLLICDMNVSHACAMDGDPLSSFSGDGASNGNSHITTQLQTKTEAKCSELNLPNPSKPVPSIPCSHSSQPEAPTVAGIPNITKSKNSHVGSEISEKDGTNSISDNVDKTFSVAGTSQSPALEEKFVGSRKVHSGSSKREYMLRQKSLHLEKHYRTYGSKGSSRAGKLSGLGGLILDKKLKSVSDTTSVNLKNASSKISKAIEVHQDNGSHNLSTSPGTSSPATFHSQGANAISALPKTSMPSTFPPGGTPAVLPLANTLPVLSAADTELSLSLPTKSNSTQVPAGINSVAPNCGYAGILSDDTSLEHLVPQDKRDEIILKLIPRVRELHNQLHEWTEWANQKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMENALCKASGQxxxxxxxxxxxxxxxxxxxxxxxxxxxxAAESAASCQEVSKREKKTQMKFQSWEKQKALFQEExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTALISDPWRYDYNACWFQQSALSSPNMCV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query753 2.2.26 [Sep-21-2011]
Q0WPJ7 814 Putative E3 ubiquitin-pro yes no 0.810 0.749 0.375 1e-102
Q9ZVT8 823 Putative E3 ubiquitin-pro no no 0.833 0.763 0.366 4e-86
Q8RX22 711 MND1-interacting protein no no 0.249 0.264 0.412 4e-26
>sp|Q0WPJ7|RF298_ARATH Putative E3 ubiquitin-protein ligase RF298 OS=Arabidopsis thaliana GN=RF298 PE=2 SV=1 Back     alignment and function desciption
 Score =  374 bits (960), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 270/720 (37%), Positives = 386/720 (53%), Gaps = 110/720 (15%)

Query: 8   GSSSSCQVSPLMLVQEKGSRNKRKFRADPPLGEPNKIIPSPQNECPTYEFTAEKFDITPG 67
           G+SSS  VSP    Q+KG +NKRK  ADP          SPQN     EF   ++++   
Sbjct: 20  GTSSS--VSP---PQDKGRKNKRKL-ADP----------SPQNAASLTEFP--RYELHSF 61

Query: 68  HGQTGACDLCGVNQDHSDGLKLDLGLSSAVGSSEVGPSRPREELEVEEFQDADWSDLTES 127
             Q+  C      ++ S+G                       +L+ EE     W D    
Sbjct: 62  KSQSPLC------ENDSNG-----------------------QLKAEESDSVGWDDPFAC 92

Query: 128 QLEELVLSNLDAIFKSAIKKIVACGYMEEVATKAVLRSGLCYGSKDTVSNIVDNTLAFLR 187
            LE L+ SNL  +F+SA+ +I+ CGY E+V  KA+  S    G  D VSNIV++TL+FL+
Sbjct: 93  HLEGLLSSNLLTLFRSAMNQIMDCGYSEDVVLKAISSSRFYCGGTDLVSNIVNDTLSFLK 152

Query: 188 SGQEINSSREHYFQDLPQLEKYILAELVCVLREVRPFFSTGDAMWCLLICDMNVSHACAM 247
           SG+++  SR++ F+DL QL  Y L E + ++REVRP  ST +AMW LLICD+NV  A  +
Sbjct: 153 SGKKVAGSRDYVFEDLQQLVAYSLVEKISLVREVRPSLSTDEAMWRLLICDLNVLKAFEV 212

Query: 248 DGDPLSSFSGDGASNGNSHITTQLQTKTEAKCSELNLP------NPSKPVPSIPCSHSSQ 301
           D D L                +     +E+  +E N P      NP  PV +   + S Q
Sbjct: 213 DADGLEG-----------SSVSNASKSSESPVAECNPPKSSDADNPKAPVSN---TQSKQ 258

Query: 302 PEAPTVAGIPNITKSKNSHVGSEISEKDGTNSISDNVDKTFSVAGTSQSPALEEKFVGSR 361
            E        N+  SKN H       K+  +  + + + T S + TS S   +EK V  R
Sbjct: 259 SEPVKFGNFANVNNSKNPHASGATPGKEVFSVSTASGEGTKSASLTSVS---DEKLVSCR 315

Query: 362 KVHSGSSKREY-MLRQKSLHLEKHYRTYGSKGSSRAGKLSGLGGLILDKKLKSVSDTTSV 420
           K   G +K+E  MLRQKS  +EK  RTY   G  +  K    GG +++K+ KS SD  S 
Sbjct: 316 K---GRTKKEMAMLRQKSC-VEK-IRTYSKGGGYKTAKF---GGFLVEKRGKSASDLLSA 367

Query: 421 NLKNASSKIS-KAIEVHQDNGSHNLSTSPGTSSPATFHSQGANAISALPKTSMPSTFPPG 479
             +N+SSKI+ + +++     S  LS S  + SPA    +    ++ALP  + P+     
Sbjct: 368 QARNSSSKITTEVMKIPLAESSSTLSNSTKSDSPALDVKEH---VTALPANNAPA----- 419

Query: 480 GTPAVLPLANTLPVLSAADTELSLSLPTKSNSTQVPAGINSVAPNCGYAGILSDDTSLEH 539
                 P+A+     S ++ E   S+ TK              P   Y   +  D +L  
Sbjct: 420 ------PVASEKK--SGSEPEEKPSVSTK--------------PAPDYYAAIPYDATLGI 457

Query: 540 LVPQDKRDEIILKLIPRVRELHNQLHEWTEWANQKVMQAARRLSKDKAELKTLRQEKEEV 599
            +P++KRDE+ILKL+PR+++L  +L +WT+WANQKV QA  RL KD+ ELK LR+EKEE 
Sbjct: 458 YIPRNKRDELILKLVPRMKDLQKELQDWTDWANQKVKQATVRLLKDQPELKALRKEKEEA 517

Query: 600 ERLKKEKQILEENTMKKLSEMENALCKASGQVERANSAVRRLEVENTALRQEMEAAKLRA 659
           E  +KEKQ+LEENT+K+ SEME AL  A+ Q+ER N+ +RRLE+E + L++E EAA +RA
Sbjct: 518 EEFRKEKQLLEENTIKRRSEMELALNNATNQLERTNNTIRRLELEQSLLKREREAANIRA 577

Query: 660 AESAASCQEVSKREKKTQMKFQSWEKQKALFQEELVTEKRKVVQLLQELDQAKALQEQLE 719
           +ESA SC+E  +R ++     QSWE QK L QEEL +++ KV  L QE+ +AK  Q Q+E
Sbjct: 578 SESAESCREAKERVQRLLKNSQSWEGQKNLLQEELKSQRDKVAGLQQEVAKAKTRQNQIE 637





Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9ZVT8|RF4_ARATH Putative E3 ubiquitin-protein ligase RF4 OS=Arabidopsis thaliana GN=RF4 PE=3 SV=1 Back     alignment and function description
>sp|Q8RX22|MIP1_ARATH MND1-interacting protein 1 OS=Arabidopsis thaliana GN=MIP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query753
225432464 893 PREDICTED: putative E3 ubiquitin-protein 0.940 0.792 0.743 0.0
255551557 894 conserved hypothetical protein [Ricinus 0.944 0.795 0.742 0.0
356555592 855 PREDICTED: putative E3 ubiquitin-protein 0.934 0.823 0.672 0.0
356520015 890 PREDICTED: putative E3 ubiquitin-protein 0.930 0.787 0.634 0.0
449432767 901 PREDICTED: putative E3 ubiquitin-protein 0.950 0.794 0.654 0.0
449495437 901 PREDICTED: LOW QUALITY PROTEIN: putative 0.950 0.794 0.650 0.0
356549037 883 PREDICTED: putative E3 ubiquitin-protein 0.922 0.787 0.653 0.0
356564559 877 PREDICTED: putative E3 ubiquitin-protein 0.924 0.793 0.631 0.0
224102555762 predicted protein [Populus trichocarpa] 0.799 0.790 0.649 0.0
357447567 929 Baculoviral IAP repeat-containing protei 0.903 0.731 0.637 0.0
>gi|225432464|ref|XP_002277269.1| PREDICTED: putative E3 ubiquitin-protein ligase RF298-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1058 bits (2735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/724 (74%), Positives = 595/724 (82%), Gaps = 16/724 (2%)

Query: 1   MASLVAKGSSS-SCQVSPLMLVQEKGSRNKRKFRADPPLGEPNKIIPSPQNECPTYEFTA 59
           M+S+   GSS+   Q SP +  QEKGSRNKRKFRADPPLG+PNKI+ S Q++C +YEF+A
Sbjct: 1   MSSMAVNGSSTCGTQGSPSVSAQEKGSRNKRKFRADPPLGDPNKIVSS-QDQCLSYEFSA 59

Query: 60  EKFDITPGHGQTGACDLCGVNQDHSDGLKLDLGLSSAVGSSEVGPSRPREELEVEEFQDA 119
           EKF++T  HGQ GAC +C +NQDHSDGLKLDLGLSSA GSSEVGPS+PR+ELE ++FQDA
Sbjct: 60  EKFEVTSSHGQPGACGMCNLNQDHSDGLKLDLGLSSAAGSSEVGPSQPRDELEADDFQDA 119

Query: 120 DWSDLTESQLEELVLSNLDAIFKSAIKKIVACGYMEEVATKAVLRSGLCYGSKDTVSNIV 179
           DWSDLTESQLEELVLSNLD IFKSAIKKIVACGY EEVATKAVLRSGLCYG KDTVSNIV
Sbjct: 120 DWSDLTESQLEELVLSNLDTIFKSAIKKIVACGYSEEVATKAVLRSGLCYGCKDTVSNIV 179

Query: 180 DNTLAFLRSGQEINSSREHYFQDLPQLEKYILAELVCVLREVRPFFSTGDAMWCLLICDM 239
           DNTLAFLR+GQEI+ SREHYF DL QLEKYILAELVCVLREVRPFFSTGDAMWCLLICDM
Sbjct: 180 DNTLAFLRNGQEIDPSREHYFDDLQQLEKYILAELVCVLREVRPFFSTGDAMWCLLICDM 239

Query: 240 NVSHACAMDGDPLSSF-SGDGASNGNSHITTQLQTKTEAKCSELNLPNPSKPVPSIPCSH 298
           NVSHACAMDGD  SS  SGDGASNG+S  + Q Q+KTEAK SELNLPNP  PV SIPC+H
Sbjct: 240 NVSHACAMDGDSFSSIVSGDGASNGSSSTSGQPQSKTEAKSSELNLPNPCNPVHSIPCAH 299

Query: 299 SSQPEAPTVAGIPNITKSKNSHV-GSEISEKDGTNSISDNVDKTFSVAGTSQSPALEEKF 357
           SSQ E P  +G+PN+ K KNS V    +SEKDG N+ SD  DK+FSV GTSQS A EEKF
Sbjct: 300 SSQSETPIASGVPNLAKPKNSLVLNGLVSEKDGLNNTSDTTDKSFSVTGTSQSAAPEEKF 359

Query: 358 VGSRKVHSGSSKREYMLRQKSLHLEKHYRTYGSKGSSRAGKLSGLGGLILDKKLKSVSDT 417
             SRKVHSG +KRE MLRQKSLHLEK+YRTYG KGSSR  KLSGLG  +LDKKLKSVSD+
Sbjct: 360 GLSRKVHSGGTKRESMLRQKSLHLEKNYRTYGCKGSSRTAKLSGLGSYMLDKKLKSVSDS 419

Query: 418 TSVNLKNASSKISKA--IEVHQDNGSHNLSTSPGTSSPATFHSQGANAISALPKTSMPST 475
           T VNLKNAS KISKA  ++V QDNG+HNLS + G SS A F+ +  N I +LPKT+ PS 
Sbjct: 420 TGVNLKNASLKISKAMGVDVPQDNGNHNLSPNSGLSSSAAFNLETVNTIGSLPKTNSPSA 479

Query: 476 FPPGGTPAVLPLANTLPVLSAADTELSLSLPTKSNSTQVPAGINSVAPNCGYAGILSDDT 535
            PP  TP         P+ S ADTELSLSL TKSNS  VP   N+   NC Y GI   D 
Sbjct: 480 LPPVNTP---------PIPSGADTELSLSLTTKSNSAPVPLSCNAETSNCSYTGI-PYDK 529

Query: 536 SLEHLVPQDKRDEIILKLIPRVRELHNQLHEWTEWANQKVMQAARRLSKDKAELKTLRQE 595
           SL   VPQDK+DE+ILKL+PRVREL NQL EWTEWANQKVMQAARRL KDKAELKTLRQE
Sbjct: 530 SLGQWVPQDKKDEMILKLVPRVRELQNQLQEWTEWANQKVMQAARRLGKDKAELKTLRQE 589

Query: 596 KEEVERLKKEKQILEENTMKKLSEMENALCKASGQVERANSAVRRLEVENTALRQEMEAA 655
           KEEVERLKKEKQ LE+NT KKLSEMENAL KASGQVERAN+AVRRLEVEN++LRQEMEAA
Sbjct: 590 KEEVERLKKEKQTLEDNTAKKLSEMENALGKASGQVERANAAVRRLEVENSSLRQEMEAA 649

Query: 656 KLRAAESAASCQEVSKREKKTQMKFQSWEKQKALFQEELVTEKRKVVQLLQELDQAKALQ 715
           KL AAESAASCQEVSKREKKT MKFQ+WEKQKA F EEL +EKR++ QL QEL+QA  LQ
Sbjct: 650 KLEAAESAASCQEVSKREKKTLMKFQTWEKQKAFFHEELTSEKRRLAQLRQELEQATELQ 709

Query: 716 EQLE 719
           +QLE
Sbjct: 710 DQLE 713




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255551557|ref|XP_002516824.1| conserved hypothetical protein [Ricinus communis] gi|223543912|gb|EEF45438.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356555592|ref|XP_003546114.1| PREDICTED: putative E3 ubiquitin-protein ligase RF298-like [Glycine max] Back     alignment and taxonomy information
>gi|356520015|ref|XP_003528662.1| PREDICTED: putative E3 ubiquitin-protein ligase RF298-like [Glycine max] Back     alignment and taxonomy information
>gi|449432767|ref|XP_004134170.1| PREDICTED: putative E3 ubiquitin-protein ligase RF298-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449495437|ref|XP_004159841.1| PREDICTED: LOW QUALITY PROTEIN: putative E3 ubiquitin-protein ligase RF298-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356549037|ref|XP_003542905.1| PREDICTED: putative E3 ubiquitin-protein ligase RF298-like [Glycine max] Back     alignment and taxonomy information
>gi|356564559|ref|XP_003550520.1| PREDICTED: putative E3 ubiquitin-protein ligase RF298-like [Glycine max] Back     alignment and taxonomy information
>gi|224102555|ref|XP_002312723.1| predicted protein [Populus trichocarpa] gi|222852543|gb|EEE90090.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357447567|ref|XP_003594059.1| Baculoviral IAP repeat-containing protein [Medicago truncatula] gi|355483107|gb|AES64310.1| Baculoviral IAP repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query753
TAIR|locus:2062374 738 AT2G35330 [Arabidopsis thalian 0.286 0.292 0.365 3.1e-55
TAIR|locus:2033765711 AT1G32530 [Arabidopsis thalian 0.169 0.180 0.422 1.7e-44
TAIR|locus:2139310 814 AT4G03000 [Arabidopsis thalian 0.774 0.716 0.267 7.3e-40
DICTYBASE|DDB_G0271670374 DDB_G0271670 [Dictyostelium di 0.402 0.810 0.181 6.3e-05
TAIR|locus:2062374 AT2G35330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 333 (122.3 bits), Expect = 3.1e-55, Sum P(2) = 3.1e-55
 Identities = 83/227 (36%), Positives = 124/227 (54%)

Query:   499 TELSLSLP-TKSNSTQVPAGINSVAPNCGYAGILSD--DTSLEHLV---PQDKRDEIILK 552
             T LS +   T S   + P    S    C ++ +L    D +L+  V   P++ +D+ ++ 
Sbjct:   344 TSLSCTAAATHSEKCEQPHVFGS--EEC-FSSVLEKFRDLNLDDNVDSAPEELKDDALIG 400

Query:   553 LIPRVRELHNQLHEWTEWANQKVMQAARRLSKDKAELKTXXXXXXXXXXXXXXXXILEEN 612
             L+ +V++L  QL E  +WA +K MQAA+++S + +ELK+                  E++
Sbjct:   401 LLQQVQDLKKQLKERKDWAQKKAMQAAQKVSDELSELKSLRSEREEIQRVKKGKQTREDS 460

Query:   613 TMKKLSEMENALCKASGQVERANSAVRRLEVENTALRQEMXXXXXXXXXXXXXCQEVSKR 672
             T+KKLSEMENAL KASGQV++AN+ VR LE E+  +R EM             C E SK+
Sbjct:   461 TLKKLSEMENALRKASGQVDKANAVVRALENESAEIRAEMEASKLSASESLTACMEASKK 520

Query:   673 EKKTQMKFQSWEKQKALFQEELVTEKRKVVQLLQELDQAKALQEQLE 719
             EKK   K  +WEKQK   Q+E+  EK K+  L + L  A+  QE+ E
Sbjct:   521 EKKCLKKLLAWEKQKMKLQDEITAEKEKIKALNRAL--AQITQEEKE 565


GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2033765 AT1G32530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139310 AT4G03000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0271670 DDB_G0271670 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00019866001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (797 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query753
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 6e-11
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-10
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-09
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 7e-07
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 1e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-05
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 1e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-05
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 2e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-05
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 4e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 7e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-04
pfam01576 859 pfam01576, Myosin_tail_1, Myosin tail 1e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-04
COG4942420 COG4942, COG4942, Membrane-bound metallopeptidase 2e-04
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 2e-04
pfam13904261 pfam13904, DUF4207, Domain of unknown function (DU 4e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 7e-04
pfam13868 349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 7e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 8e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.001
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.001
pfam00769244 pfam00769, ERM, Ezrin/radixin/moesin family 0.001
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.002
TIGR02680 1353 TIGR02680, TIGR02680, TIGR02680 family protein 0.003
pfam13514 1118 pfam13514, AAA_27, AAA domain 0.003
pfam05557 722 pfam05557, MAD, Mitotic checkpoint protein 0.003
TIGR03319 514 TIGR03319, RNase_Y, ribonuclease Y 0.003
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.004
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 0.004
PRK04863 1486 PRK04863, mukB, cell division protein MukB; Provis 0.004
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.004
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
 Score = 65.9 bits (161), Expect = 6e-11
 Identities = 38/173 (21%), Positives = 79/173 (45%)

Query: 548 EIILKLIPRVRELHNQLHEWTEWANQKVMQAARRLSKDKAELKTLRQEKEEVERLKKEKQ 607
           E +   +  + E   +L E  E   +++ +    L   +  L  L++E EE+E  ++  Q
Sbjct: 733 EQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQ 792

Query: 608 ILEENTMKKLSEMENALCKASGQVERANSAVRRLEVENTALRQEMEAAKLRAAESAASCQ 667
              E   ++L E E  L     ++E       RLE E   L +E+E  + +  E     +
Sbjct: 793 EELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELE 852

Query: 668 EVSKREKKTQMKFQSWEKQKALFQEELVTEKRKVVQLLQELDQAKALQEQLEE 720
           E+ K  ++ + + +  E +K   ++EL   + +  +L +EL + ++   +L+E
Sbjct: 853 ELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAELKE 905


Length = 1163

>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|205692 pfam13514, AAA_27, AAA domain Back     alignment and domain information
>gnl|CDD|218636 pfam05557, MAD, Mitotic checkpoint protein Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 753
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 97.23
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 97.23
PRK02224 880 chromosome segregation protein; Provisional 96.65
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 96.64
PRK09039343 hypothetical protein; Validated 96.63
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 96.35
PRK03918 880 chromosome segregation protein; Provisional 96.35
PRK03918 880 chromosome segregation protein; Provisional 96.24
KOG0963 629 consensus Transcription factor/CCAAT displacement 96.12
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 96.11
PRK11637 428 AmiB activator; Provisional 96.1
PRK11637 428 AmiB activator; Provisional 96.02
PRK02224 880 chromosome segregation protein; Provisional 96.01
PF05276239 SH3BP5: SH3 domain-binding protein 5 (SH3BP5); Int 95.85
KOG0933 1174 consensus Structural maintenance of chromosome pro 95.83
PF10186 302 Atg14: UV radiation resistance protein and autopha 95.73
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 95.73
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 95.73
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 95.63
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 95.58
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 95.26
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 95.23
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 95.13
PHA02562 562 46 endonuclease subunit; Provisional 95.06
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 94.96
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 94.85
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 94.81
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 94.62
PF05701522 WEMBL: Weak chloroplast movement under blue light; 94.33
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 94.33
KOG0933 1174 consensus Structural maintenance of chromosome pro 94.27
PRK04863 1486 mukB cell division protein MukB; Provisional 94.23
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 94.18
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 94.18
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 94.1
PRK04778 569 septation ring formation regulator EzrA; Provision 94.04
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 93.77
PRK04863 1486 mukB cell division protein MukB; Provisional 93.39
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 93.34
PHA02562 562 46 endonuclease subunit; Provisional 93.14
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 93.13
KOG0996 1293 consensus Structural maintenance of chromosome pro 93.12
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 93.05
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 93.04
PF15066527 CAGE1: Cancer-associated gene protein 1 family 92.9
PF00038312 Filament: Intermediate filament protein; InterPro: 92.56
KOG0979 1072 consensus Structural maintenance of chromosome pro 92.56
PF05911769 DUF869: Plant protein of unknown function (DUF869) 92.52
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 92.44
PF13166 712 AAA_13: AAA domain 92.4
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 92.35
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 92.1
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 92.04
PF13514 1111 AAA_27: AAA domain 92.04
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 92.02
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 91.96
PF13514 1111 AAA_27: AAA domain 91.83
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 91.82
KOG0979 1072 consensus Structural maintenance of chromosome pro 91.81
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 91.76
PF10186 302 Atg14: UV radiation resistance protein and autopha 91.64
KOG2412 591 consensus Nuclear-export-signal (NES)-containing p 91.59
TIGR02971327 heterocyst_DevB ABC exporter membrane fusion prote 91.54
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 91.51
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 91.43
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 91.42
PRK09039 343 hypothetical protein; Validated 91.4
KOG2891445 consensus Surface glycoprotein [General function p 91.27
PF00038312 Filament: Intermediate filament protein; InterPro: 91.16
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 91.06
PF05701 522 WEMBL: Weak chloroplast movement under blue light; 90.93
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 90.79
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 90.77
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 90.69
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 90.66
PF05911769 DUF869: Plant protein of unknown function (DUF869) 90.53
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 90.27
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 90.07
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 90.02
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 89.97
KOG0996 1293 consensus Structural maintenance of chromosome pro 89.96
TIGR02977219 phageshock_pspA phage shock protein A. Members of 89.45
PRK10246 1047 exonuclease subunit SbcC; Provisional 89.41
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 89.39
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 89.18
COG4942420 Membrane-bound metallopeptidase [Cell division and 89.07
KOG4673 961 consensus Transcription factor TMF, TATA element m 89.03
PRK11281 1113 hypothetical protein; Provisional 89.01
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 88.99
PRK01156 895 chromosome segregation protein; Provisional 88.92
PRK04778 569 septation ring formation regulator EzrA; Provision 88.91
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 88.83
KOG0994 1758 consensus Extracellular matrix glycoprotein Lamini 88.66
COG4942 420 Membrane-bound metallopeptidase [Cell division and 88.39
PRK12704 520 phosphodiesterase; Provisional 88.33
KOG2891445 consensus Surface glycoprotein [General function p 88.19
PF10174775 Cast: RIM-binding protein of the cytomatrix active 88.18
TIGR03794 421 NHPM_micro_HlyD NHPM bacteriocin system secretion 87.77
PRK01156 895 chromosome segregation protein; Provisional 87.72
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 87.54
PF05600507 DUF773: Protein of unknown function (DUF773); Inte 87.5
KOG0964 1200 consensus Structural maintenance of chromosome pro 87.3
cd07627216 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of 87.12
COG2433 652 Uncharacterized conserved protein [Function unknow 86.84
PF02841297 GBP_C: Guanylate-binding protein, C-terminal domai 86.65
TIGR00618 1042 sbcc exonuclease SbcC. This family is based on the 86.64
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 86.06
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 85.81
smart0054643 CUE Domain that may be involved in binding ubiquit 85.76
PF07246264 Phlebovirus_NSM: Phlebovirus nonstructural protein 85.69
PF07058 351 Myosin_HC-like: Myosin II heavy chain-like; InterP 85.4
PF05615139 THOC7: Tho complex subunit 7; InterPro: IPR008501 85.11
PRK10361 475 DNA recombination protein RmuC; Provisional 84.99
TIGR00634 563 recN DNA repair protein RecN. All proteins in this 84.91
PRK10698222 phage shock protein PspA; Provisional 84.89
KOG4403 575 consensus Cell surface glycoprotein STIM, contains 84.86
KOG0964 1200 consensus Structural maintenance of chromosome pro 84.36
TIGR00618 1042 sbcc exonuclease SbcC. This family is based on the 84.23
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 84.11
PF15456124 Uds1: Up-regulated During Septation 83.46
PF06248 593 Zw10: Centromere/kinetochore Zw10; InterPro: IPR00 83.14
KOG0240607 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] 83.02
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 82.97
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 82.91
PF06705247 SF-assemblin: SF-assemblin/beta giardin 82.76
PRK10929 1109 putative mechanosensitive channel protein; Provisi 82.71
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 82.56
PF15294278 Leu_zip: Leucine zipper 82.5
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 82.45
KOG0018 1141 consensus Structural maintenance of chromosome pro 82.32
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 82.27
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 82.26
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 82.24
PRK10884206 SH3 domain-containing protein; Provisional 82.21
PTZ00121 2084 MAEBL; Provisional 82.15
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 82.1
PRK10246 1047 exonuclease subunit SbcC; Provisional 82.1
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 81.8
PF05483 786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 81.48
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 81.45
PF15369 328 KIAA1328: Uncharacterised protein KIAA1328 81.03
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 80.99
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 80.79
PF13904264 DUF4207: Domain of unknown function (DUF4207) 80.71
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 80.68
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 80.43
PRK15136390 multidrug efflux system protein EmrA; Provisional 80.34
PTZ00266 1021 NIMA-related protein kinase; Provisional 80.11
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
Probab=97.23  E-value=0.18  Score=60.86  Aligned_cols=166  Identities=22%  Similarity=0.205  Sum_probs=124.2

Q ss_pred             cCcccCcCcccccCCCCchhHHHHHHhHHHHHHHHHHHHhhHHHHHHHHHHHHHhhhcHHHHHHHHHhHHHHHHHHHHHh
Q 004449          528 AGILSDDTSLEHLVPQDKRDEIILKLIPRVRELHNQLHEWTEWANQKVMQAARRLSKDKAELKTLRQEKEEVERLKKEKQ  607 (753)
Q Consensus       528 ~~i~~D~~~l~~~VP~D~KDEmilkLv~rv~eLq~qlqewtdWAnqKvMQAarRL~kdk~ELksLR~EkEE~erlkKeKq  607 (753)
                      .-+|.+ .++     +|.+|..|.-|.+.+..|..++---++=|+-.+-|...+|.-..-+|.--|.+.+|+        
T Consensus       319 ~~~~~~-~sq-----kd~~~~~~~~~~~e~~~~~~~l~~~~~ear~~~~q~~~ql~~le~~~~e~q~~~qe~--------  384 (980)
T KOG0980|consen  319 ASDPPN-ASQ-----KDPRELQIEQLSREVAQLKAQLENLKEEARRRIEQYENQLLALEGELQEQQREAQEN--------  384 (980)
T ss_pred             ccCCcc-ccc-----CChhhHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHH--------
Confidence            334555 555     299999999999999999999988888888888888877765555554444433332        


Q ss_pred             hhhhhhhhhHHHHHHHHHHhhhhhHhhhhHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHhHHHHH
Q 004449          608 ILEENTMKKLSEMENALCKASGQVERANSAVRRLEVENTALRQEMEAAKLRAAESAASCQEVSKREKKTQMKFQSWEKQK  687 (753)
Q Consensus       608 ~lEe~T~KrLsEmEnAL~kasgQlerAns~vrrLE~EnA~lR~EmEAaKL~A~ES~~sc~Ev~krekk~lkk~qsWEkQK  687 (753)
                      ..|..   +|-+-+--|....+|+++|+..|...|.++......-+.-|--=++-..-.+++++|=....|++.+=+.-+
T Consensus       385 ~~e~e---qLr~elaql~a~r~q~eka~~~~ee~e~~~l~~e~ry~klkek~t~l~~~h~~lL~K~~di~kQle~~~~s~  461 (980)
T KOG0980|consen  385 REEQE---QLRNELAQLLASRTQLEKAQVLVEEAENKALAAENRYEKLKEKYTELRQEHADLLRKYDDIQKQLESAEQSI  461 (980)
T ss_pred             HHHHH---HHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhH
Confidence            11222   677777777888899999998898888888888888888888778888888888888888888887777777


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q 004449          688 ALFQEELVTEKRKVVQLLQELDQ  710 (753)
Q Consensus       688 ~lLQEELa~EK~Kl~~l~qel~q  710 (753)
                      ....+++..--.+|.+++.+..+
T Consensus       462 ~~~~~~~~~L~d~le~~~~~~~~  484 (980)
T KOG0980|consen  462 DDVEEENTNLNDQLEELQRAAGR  484 (980)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            76666666666666666666655



>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF05276 SH3BP5: SH3 domain-binding protein 5 (SH3BP5); InterPro: IPR007940 The SH3 domain-binding protein inhibits the auto and transphophorylation of BTK and acts as a negative regulator of BTK-related signalling in B cells Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification] Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG2891 consensus Surface glycoprotein [General function prediction only] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>KOG2891 consensus Surface glycoprotein [General function prediction only] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF05600 DUF773: Protein of unknown function (DUF773); InterPro: IPR008491 This family contains several eukaryotic sequences which are thought to be CDK5 activator-binding proteins, however, the function of this family is unknown Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07627 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps5p Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>PF07246 Phlebovirus_NSM: Phlebovirus nonstructural protein NS-M; InterPro: IPR009879 This entry consists of several Phlebovirus nonstructural NS-M proteins, which represent the N-terminal region of the M polyprotein precursor Back     alignment and domain information
>PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana Back     alignment and domain information
>PF05615 THOC7: Tho complex subunit 7; InterPro: IPR008501 The Tho complex (THOC) is involved in transcription elongation and mRNA export from the nucleus [] Back     alignment and domain information
>PRK10361 DNA recombination protein RmuC; Provisional Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PF15456 Uds1: Up-regulated During Septation Back     alignment and domain information
>PF06248 Zw10: Centromere/kinetochore Zw10; InterPro: IPR009361 Zeste white 10 (ZW10) was initially identified as a mitotic checkpoint protein involved in chromosome segregation, and then implicated in targeting cytoplasmic dynein and dynactin to mitotic kinetochores, but it is also important in non-dividing cells Back     alignment and domain information
>KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF06705 SF-assemblin: SF-assemblin/beta giardin Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PTZ00121 MAEBL; Provisional Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>PF15369 KIAA1328: Uncharacterised protein KIAA1328 Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PF13904 DUF4207: Domain of unknown function (DUF4207) Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query753
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 1e-11
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-10
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-10
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-09
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-08
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 3e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-11
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 4e-08
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 1e-07
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 1e-07
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 2e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 3e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 1e-05
1c1g_A 284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 8e-05
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 2e-06
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 6e-06
4f61_I240 Stathmin-like domain R4; alpha-tubulin, beta-tubul 1e-05
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 2e-05
2zuo_A861 MVP, major vault protein; repeat domains, protein- 3e-05
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 9e-05
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 1e-04
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 3e-04
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 3e-04
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 5e-04
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
 Score = 67.2 bits (164), Expect = 1e-11
 Identities = 33/180 (18%), Positives = 73/180 (40%), Gaps = 4/180 (2%)

Query: 545  KRDEIILKLIPRVRELHNQLHEWTEWANQKVMQAARRLSKDKAELKTLRQEKEEVERLKK 604
             +DE + +   R ++   +L E  +   Q   +      K +AE +   + +E   RL  
Sbjct: 861  AKDEELQRTKERQQKAEAELKELEQKHTQLCEEKNLLQEKLQAETELYAEAEEMRVRLAA 920

Query: 605  EKQILEENTMKKLSEMENALCKASGQVERANSAVRRLEVENTALRQEMEAAKLRAAESAA 664
            +KQ LEE     L EME  + +   + ++  +  ++++ +   L +++E  +    +   
Sbjct: 921  KKQELEE----ILHEMEARIEEEEERSQQLQAEKKKMQQQMLDLEEQLEEEEAARQKLQL 976

Query: 665  SCQEVSKREKKTQMKFQSWEKQKALFQEELVTEKRKVVQLLQELDQAKALQEQLEEMSNE 724
                   + KK +      E Q     +E    + +V  L   L + +   + L ++ N+
Sbjct: 977  EKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKNLTKLKNK 1036


>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 Back     alignment and structure
>4f61_I Stathmin-like domain R4; alpha-tubulin, beta-tubulin, GTPase, microtubule, RB3, stath tubulin, cell cycle; HET: GTP GDP; 4.17A {Artificial gene} Length = 240 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Length = 575 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Length = 120 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query753
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 97.36
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 97.29
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 97.22
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 96.95
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 96.92
4gkw_A167 Spindle assembly abnormal protein 6; double helix, 96.74
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 96.62
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 96.47
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 96.45
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 96.14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 95.62
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 95.06
3iox_A 497 AGI/II, PA; alpha helix, PPII helix, supersandwich 93.82
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 93.64
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 92.82
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 92.61
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 92.35
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 92.25
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 91.15
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 89.94
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 88.51
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 88.42
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 87.13
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 86.57
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 85.2
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 84.82
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 84.7
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 84.02
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 83.2
2xnx_M146 M protein, M1-BC1; cell adhesion, virulence factor 82.55
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 80.85
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 80.83
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
Probab=97.36  E-value=0.1  Score=49.25  Aligned_cols=10  Identities=30%  Similarity=0.458  Sum_probs=3.8

Q ss_pred             HHHHHHHHHh
Q 004449          586 KAELKTLRQE  595 (753)
Q Consensus       586 k~ELksLR~E  595 (753)
                      ..++..++.+
T Consensus        47 ~~~~~~~~~~   56 (284)
T 1c1g_A           47 QKKLKATEDE   56 (284)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHHHHH
Confidence            3333333333



>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 753
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 8e-06
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 3e-05
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query753
d2ap3a1185 Hypothetical protein MW0975 (SA0943) {Staphylococc 89.6
>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: All alpha proteins
fold: Four-helical up-and-down bundle
superfamily: MW0975(SA0943)-like
family: MW0975(SA0943)-like
domain: Hypothetical protein MW0975 (SA0943)
species: Staphylococcus aureus [TaxId: 1280]
Probab=89.60  E-value=4.5  Score=33.02  Aligned_cols=25  Identities=24%  Similarity=0.385  Sum_probs=8.9

Q ss_pred             HHHHHHHHHHhhhhhHhhhhHHHHH
Q 004449          617 LSEMENALCKASGQVERANSAVRRL  641 (753)
Q Consensus       617 LsEmEnAL~kasgQlerAns~vrrL  641 (753)
                      +.+....+..+..+++.+.....++
T Consensus        71 ~~~~~~~~~~~~~~~~~~~~~~~~~   95 (185)
T d2ap3a1          71 FEKEEDAIKKSEQDFKKAKSHVDNI   95 (185)
T ss_dssp             HHHHHHHHHHHHHHHTTC-----CC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3344444444444444444444433