Citrus Sinensis ID: 004504
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 748 | ||||||
| 147840488 | 829 | hypothetical protein VITISV_018267 [Viti | 0.998 | 0.901 | 0.775 | 0.0 | |
| 359488597 | 829 | PREDICTED: ankyrin repeat domain-contain | 0.998 | 0.901 | 0.774 | 0.0 | |
| 255536965 | 748 | ankyrin repeat-containing protein, putat | 0.995 | 0.995 | 0.761 | 0.0 | |
| 356560509 | 753 | PREDICTED: ankyrin repeat domain-contain | 0.994 | 0.988 | 0.729 | 0.0 | |
| 449441380 | 753 | PREDICTED: ankyrin-2-like [Cucumis sativ | 0.994 | 0.988 | 0.707 | 0.0 | |
| 356570113 | 754 | PREDICTED: putative ankyrin repeat prote | 0.995 | 0.988 | 0.717 | 0.0 | |
| 357503833 | 745 | Ankyrin repeat domain-containing protein | 0.991 | 0.995 | 0.708 | 0.0 | |
| 297738379 | 762 | unnamed protein product [Vitis vinifera] | 0.990 | 0.972 | 0.676 | 0.0 | |
| 359473567 | 761 | PREDICTED: ankyrin-2-like [Vitis vinifer | 0.990 | 0.973 | 0.676 | 0.0 | |
| 240256292 | 751 | uncharacterized protein [Arabidopsis tha | 0.991 | 0.988 | 0.673 | 0.0 |
| >gi|147840488|emb|CAN68422.1| hypothetical protein VITISV_018267 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1180 bits (3052), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 587/757 (77%), Positives = 665/757 (87%), Gaps = 10/757 (1%)
Query: 1 MTVF--------SVRQVVPVDYEAEVSQRLLEATLAGDLKSATECIADPYVDVNFVGAVS 52
MTVF + +QV PVD EAEVSQRLLEA+ +GDLKSA ECIADP+VDVNFVG V
Sbjct: 69 MTVFGHSGGGFLTGKQVFPVDCEAEVSQRLLEASHSGDLKSALECIADPFVDVNFVGVVC 128
Query: 53 LKTRKTEVVLREGKPSEVRVEFEEFKSDVTALFLAAHSGNVTLVKKLLSTGADVNQKLFR 112
LK ++TEV+LR+ EVRVE+EEFK++VTALFLA H+GNV LV+KLLS GADVNQKLFR
Sbjct: 129 LKAKRTEVLLRDESAGEVRVEYEEFKTEVTALFLAVHTGNVALVRKLLSIGADVNQKLFR 188
Query: 113 GFATTIAVREGHLEILEILLKAGASQPACEEALLEASCHGQARLAELLMGSDLIRPHVAV 172
GFATT AVREGHLEILEILLKAGASQPACEEALLEASCHG+ARLAELLM SDLIRPH+AV
Sbjct: 189 GFATTAAVREGHLEILEILLKAGASQPACEEALLEASCHGRARLAELLMASDLIRPHIAV 248
Query: 173 HSLVTACCRGFVDVVDTLMKCGVDINATDRLLLQSLKPSLHTNVDCSALVAAVVSRQVSV 232
H+LVTACCRGFVDVVDTLMKCGVD NATDR+LLQS KPSLHTN+DC+ALVAAVVSRQVSV
Sbjct: 249 HALVTACCRGFVDVVDTLMKCGVDANATDRVLLQSSKPSLHTNLDCTALVAAVVSRQVSV 308
Query: 233 VQLLLQAGANTDMKVRLGAWSWDTTTGEEFRVGAGLAEPYAITWCAVEYFEITGSILRML 292
V+LLLQAGA TD+KVRLGAWSWD +GEEFRVGAGLAEPY ITWCAVEYFE++G+ILRML
Sbjct: 309 VRLLLQAGARTDIKVRLGAWSWDMASGEEFRVGAGLAEPYTITWCAVEYFEVSGAILRML 368
Query: 293 LQHLSYNSPHYGRTLLHHAILCGCTGAVAVLLSCGADAQCPIRTQ-KTEFHPIHLAARLG 351
LQHLS N+ H+GRTLLHHAILCG TGA+ VLL+CGA + P++T KTEF PIH+AARLG
Sbjct: 369 LQHLSPNTLHFGRTLLHHAILCGNTGAINVLLNCGAHVESPVKTTGKTEFRPIHMAARLG 428
Query: 352 YSTIVQSLIDSGCDLNTKTESGETALMISAKYKQEECVKVLAKAGADFGLVSVSGQSASS 411
+T++QSLID GCDLN+KT+SGETALMI AKYKQE+C++VLA AGADFGLV+++GQSASS
Sbjct: 429 LATVLQSLIDFGCDLNSKTDSGETALMICAKYKQEDCLRVLAMAGADFGLVNITGQSASS 488
Query: 412 IAGSNWWSVGFQRAVLDIIRSGNIPKSSNVAVFSPLMFVAQAGDIAALKALIGREELNLD 471
IA SN W++GFQ+AVLD IR+ +P+SS+ VFSPLMFVA+ GDI ALK LIG+ E+ LD
Sbjct: 489 IAVSNRWTLGFQQAVLDAIRARKVPRSSSFQVFSPLMFVARVGDIYALKTLIGQPEIELD 548
Query: 472 YQDDNGFSAVMVAASKGHVEVFRELVYAGADVKLLNKSGKTAIMLSELNQNCDLFEKVML 531
YQDDNG SAVMV A +GHVE FR LV+AGADVKL NK G+TAI LSELNQN DLFEKVML
Sbjct: 549 YQDDNGLSAVMVTAIEGHVEAFRLLVFAGADVKLSNKYGETAITLSELNQNHDLFEKVML 608
Query: 532 EFALEKGNRNAGGFYALHCAARRGDLDAVRLLTSRGYGVNVPDGDGYTPLMLAAREGHGP 591
EF LEKGNRNAGGFYALHCAARRGDLDAVRLLTSRGY VNVPDGDGYTPLMLAAREGHG
Sbjct: 609 EFTLEKGNRNAGGFYALHCAARRGDLDAVRLLTSRGYDVNVPDGDGYTPLMLAAREGHGS 668
Query: 592 MCELLISNGAVCDIKNARGETALSLARKNSSMKNDAELVILDEVARMLVLGGGHVLKHTK 651
MCELLIS GA ++KNARGETALSLARKN MKNDAE VILD++AR LVLGG VLKHTK
Sbjct: 669 MCELLISCGANTEVKNARGETALSLARKN-GMKNDAECVILDQLARKLVLGGDWVLKHTK 727
Query: 652 GGKGTPHRKDIRMLGSEGVLRWGNSRRRNVICREAKLGPSPAFQKNRRGKGDVNEPGVFH 711
GGKGTPH K+++M+G+ GVLRWG S RRNVICREA++GPS AFQKNR+ +G +EPG+F
Sbjct: 728 GGKGTPHGKEMKMMGALGVLRWGKSSRRNVICREAEMGPSSAFQKNRQRQGGADEPGLFR 787
Query: 712 IVTTKNNEVHFVCQGGLEMAELWVRGIMLVTKAAMHG 748
+VTTKN EVHFVC+GGLE AELWVRGI L+T+ A+ G
Sbjct: 788 VVTTKNKEVHFVCEGGLEKAELWVRGIKLITREAIFG 824
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359488597|ref|XP_002270424.2| PREDICTED: ankyrin repeat domain-containing protein 17-like [Vitis vinifera] gi|296090241|emb|CBI40060.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255536965|ref|XP_002509549.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223549448|gb|EEF50936.1| ankyrin repeat-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356560509|ref|XP_003548534.1| PREDICTED: ankyrin repeat domain-containing protein 50-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449441380|ref|XP_004138460.1| PREDICTED: ankyrin-2-like [Cucumis sativus] gi|449495266|ref|XP_004159782.1| PREDICTED: ankyrin-2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356570113|ref|XP_003553235.1| PREDICTED: putative ankyrin repeat protein RF_0381-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357503833|ref|XP_003622205.1| Ankyrin repeat domain-containing protein [Medicago truncatula] gi|355497220|gb|AES78423.1| Ankyrin repeat domain-containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297738379|emb|CBI27580.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359473567|ref|XP_002265470.2| PREDICTED: ankyrin-2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|240256292|ref|NP_196927.4| uncharacterized protein [Arabidopsis thaliana] gi|332004620|gb|AED92003.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 748 | ||||||
| TAIR|locus:2145613 | 751 | AT5G14230 [Arabidopsis thalian | 0.991 | 0.988 | 0.653 | 6.7e-262 | |
| UNIPROTKB|F1M5N3 | 3838 | Ank2 "Protein Ank2" [Rattus no | 0.717 | 0.139 | 0.256 | 2.9e-31 | |
| UNIPROTKB|F1LM13 | 1783 | Ank3 "Protein Ank3" [Rattus no | 0.427 | 0.179 | 0.278 | 5e-31 | |
| UNIPROTKB|F1LPH6 | 1961 | Ank3 "Protein Ank3" [Rattus no | 0.427 | 0.163 | 0.278 | 6.3e-31 | |
| UNIPROTKB|F1PJ90 | 1782 | ANK3 "Uncharacterized protein" | 0.406 | 0.170 | 0.283 | 6.4e-31 | |
| UNIPROTKB|K7GLA8 | 1847 | ANK3 "Uncharacterized protein" | 0.406 | 0.164 | 0.283 | 8.8e-31 | |
| MGI|MGI:88026 | 1961 | Ank3 "ankyrin 3, epithelial" [ | 0.427 | 0.163 | 0.278 | 1.7e-30 | |
| UNIPROTKB|K7GSS3 | 2594 | ANK3 "Uncharacterized protein" | 0.406 | 0.117 | 0.283 | 2e-30 | |
| UNIPROTKB|E1BNC9 | 3342 | ANK3 "Uncharacterized protein" | 0.406 | 0.090 | 0.283 | 4.7e-30 | |
| UNIPROTKB|F1RG02 | 4363 | ANK3 "Uncharacterized protein" | 0.406 | 0.069 | 0.283 | 5.1e-30 |
| TAIR|locus:2145613 AT5G14230 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2520 (892.1 bits), Expect = 6.7e-262, P = 6.7e-262
Identities = 491/751 (65%), Positives = 583/751 (77%)
Query: 1 MTVFSVRQVVPVDYEAEVSQRLLEATLAGDLKSATECIADPYVDVNFVGAVSLKTRKTEV 60
MTVFS RQVVP+DYEAEVSQRLLEA L GD K+A++C++DP VDVNFVGAVSLKTR++EV
Sbjct: 1 MTVFSGRQVVPMDYEAEVSQRLLEAILDGDFKTASDCVSDPLVDVNFVGAVSLKTRRSEV 60
Query: 61 VLREGKPSEVRVEFEEFKSDVTALFLAAHSGNVTLVKKLLSTGADVNQKLFRGFATTIAV 120
VLR+ PSEVRVE+EEFK+DVTALFLA + GN LVK+LL+ GADVNQKLFRGFATT+AV
Sbjct: 61 VLRDESPSEVRVEYEEFKTDVTALFLAVNFGNAALVKELLNIGADVNQKLFRGFATTVAV 120
Query: 121 REGHLEILEILLKAGASQPACEEALLEASCHGQARLAELLMGSDLIRPHVAVHSLVTACC 180
REGH ++ EILLKAGASQPACEEAL+ ASCHG++R ELLMG+DLIRP VAVH+L TACC
Sbjct: 121 REGHFDVFEILLKAGASQPACEEALVGASCHGRSRFVELLMGTDLIRPQVAVHALATACC 180
Query: 181 RGFVDVVDTLMKCGVDINATDRLLLQSLKPSLHTNVDCXXXXXXXXXXXXXXXXXXXXXG 240
RGFVDVV TL+KCGVD N+TDRLLLQS KPSL+TNVDC G
Sbjct: 181 RGFVDVVGTLLKCGVDANSTDRLLLQSSKPSLYTNVDCTALVAAIVNRQVSAVRVLLQAG 240
Query: 241 ANTDMKVRLGAWSWDTTTGEEFRVGAGLAEPYAITWCAVEYFEITGSILRMLLQHLSYNS 300
TD+ VRLGAWSWDT TGEEFRVGAG+AEPY +TWCAVEYFE +G ILR+LL+ S N+
Sbjct: 241 VKTDIMVRLGAWSWDTNTGEEFRVGAGVAEPYPLTWCAVEYFETSGDILRLLLKLQSPNA 300
Query: 301 PHYGRTLLHHAILCGCTGAVAVLLSCGADAQCPIRTQK-TEFHPIHLAARLGYSTIVQSL 359
H GRTLLHHA+LCG AV+VLL CGAD + PI+T + E PIH+AAR G I+Q L
Sbjct: 301 LHNGRTLLHHAVLCGNKAAVSVLLDCGADPEAPIKTSRGIELRPIHIAARDGSVEIIQQL 360
Query: 360 IDSGCDLNTKTESGETALMISAKYKQEECVKVLAKAGADFGLVSVSGQSASSIAGSNWWS 419
+ GCD+N+K + G TAL+IS K+K ECVKVLA GADFGLV+ G SA SIA SN WS
Sbjct: 361 VGFGCDINSKNDVGNTALLISIKHKHPECVKVLALDGADFGLVNKFGHSAVSIAESNKWS 420
Query: 420 VGFQRAVLDIIRSGNIPKSSNVAVFSPLMFVAQAGDIAALKALIGREELNLDYQDDNGFS 479
+G +R +L++IR G +P SSN +VFSPL++ AQAGD ALKAL+ +++ LDYQD+ GFS
Sbjct: 421 LGLERVILELIRFGVVPHSSNASVFSPLLYGAQAGDAEALKALVKAQDIYLDYQDEEGFS 480
Query: 480 AVMVAASKGHVEVFRELVYAGADVKLLNKSGKTAIMLSELNQNCDLFEKVMLEFALEKGN 539
A M+AA GHVE FR LVYAGADVKL N SG T + LSE N N D+ EKVMLEFALEK +
Sbjct: 481 AAMLAAMNGHVEAFRVLVYAGADVKLYNNSGDTVVSLSEQNGNRDVIEKVMLEFALEKDS 540
Query: 540 RN-AGGFYALHCAARRGDLDAVRLLTSRGYGVNVPDGDGYTPLMLAAREGHGPMCELLIS 598
RN AGGFYALHCAARRGD+ AV+LL+ +GY +++PDGDGYTPLMLAAREGHG MCE LIS
Sbjct: 541 RNMAGGFYALHCAARRGDVKAVKLLSGKGYSLDIPDGDGYTPLMLAAREGHGHMCEYLIS 600
Query: 599 NGAVCDIKNARGETALSLARKNSSMKNDAELVILDEVARMLVLGGGHVLKHTKGGKGTPH 658
GA C+ KN RGE L LA DAE VI +E++R V+ G V+KHTKGGKG H
Sbjct: 601 CGANCNAKNGRGEKLLDLAT------GDAEKVIRNELSRRFVIEGSSVMKHTKGGKGKKH 654
Query: 659 RKDIRMLGSEGVLRWGNSRRRNVICREAKLGPSPAFQKNRRGKGD-VNEPGVFHIVTTKN 717
K +RML S GVL WG SR+R V+C+E ++G S F+KNR+GKGD E G+F +VTT+N
Sbjct: 655 GKGLRMLESSGVLSWGKSRKRTVVCKEVEIGMSQRFRKNRKGKGDGAEEEGIFRVVTTEN 714
Query: 718 NEVHFVCQGGLEMAELWVRGIMLVTKAAMHG 748
EVHFVC+GGL AE+WVRGI LVT+ + G
Sbjct: 715 KEVHFVCEGGLVCAEMWVRGIRLVTRETICG 745
|
|
| UNIPROTKB|F1M5N3 Ank2 "Protein Ank2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LM13 Ank3 "Protein Ank3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LPH6 Ank3 "Protein Ank3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PJ90 ANK3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GLA8 ANK3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:88026 Ank3 "ankyrin 3, epithelial" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GSS3 ANK3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BNC9 ANK3 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RG02 ANK3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00020545001 | SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (784 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 748 | |||
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 1e-26 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 4e-19 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 1e-18 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 4e-18 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 6e-17 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 7e-17 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 2e-16 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 9e-15 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 4e-14 | |
| PLN03192 | 823 | PLN03192, PLN03192, Voltage-dependent potassium ch | 5e-14 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 1e-13 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 2e-13 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 2e-10 | |
| PLN03192 | 823 | PLN03192, PLN03192, Voltage-dependent potassium ch | 2e-10 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 3e-10 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 5e-10 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 6e-10 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 6e-10 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 7e-10 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 8e-10 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 1e-09 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 1e-09 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 5e-09 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 6e-09 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 8e-09 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 1e-08 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 2e-08 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 3e-08 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 3e-08 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 3e-08 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 4e-08 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 4e-08 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 6e-08 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 1e-07 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 3e-07 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 3e-07 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 1e-06 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 1e-06 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 1e-06 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 2e-06 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 2e-06 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 2e-06 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 2e-06 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 3e-06 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 5e-06 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 9e-06 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 2e-05 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 2e-05 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 2e-05 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 2e-05 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 4e-05 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 9e-05 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 1e-04 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 1e-04 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 2e-04 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 2e-04 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 3e-04 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 4e-04 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 5e-04 | |
| TIGR00870 | 743 | TIGR00870, trp, transient-receptor-potential calci | 5e-04 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 6e-04 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 8e-04 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 0.001 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 0.001 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 0.001 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 0.001 | |
| PHA02989 | 494 | PHA02989, PHA02989, ankyrin repeat protein; Provis | 0.001 | |
| PLN03192 | 823 | PLN03192, PLN03192, Voltage-dependent potassium ch | 0.002 | |
| pfam13606 | 30 | pfam13606, Ank_3, Ankyrin repeat | 0.002 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 0.003 | |
| pfam13606 | 30 | pfam13606, Ank_3, Ankyrin repeat | 0.003 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 0.004 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 0.004 | |
| PHA02946 | 446 | PHA02946, PHA02946, ankyin-like protein; Provision | 0.004 |
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
Score = 104 bits (262), Expect = 1e-26
Identities = 51/131 (38%), Positives = 77/131 (58%), Gaps = 9/131 (6%)
Query: 471 DYQDDNGFSAVMVAASKGHVEVFRELVYAGADVKLLNKSGKTAIMLSELNQNCDLFEKVM 530
+ +D++G + + +AAS GH+EV + L+ GADV + G+T + L+ N + + +
Sbjct: 1 NARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLE-----I 55
Query: 531 LEFALEKGN----RNAGGFYALHCAARRGDLDAVRLLTSRGYGVNVPDGDGYTPLMLAAR 586
++ LEKG R+ G LH AAR G+LD V+LL G VN D DG TPL LAA+
Sbjct: 56 VKLLLEKGADVNARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAK 115
Query: 587 EGHGPMCELLI 597
GH + +LL+
Sbjct: 116 NGHLEVVKLLL 126
|
The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126 |
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 748 | |||
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 100.0 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 100.0 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 100.0 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 100.0 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 100.0 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 100.0 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 100.0 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 100.0 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 100.0 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 100.0 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 100.0 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 100.0 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 100.0 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 100.0 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 100.0 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 100.0 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 100.0 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 100.0 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 100.0 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.98 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.97 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.96 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.96 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.96 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.96 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.96 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.95 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.94 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.93 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.92 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.92 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.92 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.91 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.9 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.89 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.89 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.88 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.88 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.87 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.87 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.86 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.85 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.84 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.84 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.82 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.81 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.81 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.8 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.79 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.78 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.74 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.72 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.72 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.67 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.64 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.64 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.62 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.59 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.54 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.51 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.46 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.45 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.43 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.42 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.37 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.37 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.36 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.35 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.32 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.27 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 99.17 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.89 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.84 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.84 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.81 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.71 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.67 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.63 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.63 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 98.55 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 98.5 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.47 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.46 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 98.45 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.44 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 98.4 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 98.39 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.34 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.3 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 98.27 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 98.22 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 98.2 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 98.13 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.91 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 97.67 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 97.66 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 97.16 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 96.96 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.87 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.73 | |
| PF03158 | 192 | DUF249: Multigene family 530 protein; InterPro: IP | 96.59 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 96.52 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 96.45 | |
| PF03158 | 192 | DUF249: Multigene family 530 protein; InterPro: IP | 96.32 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 96.23 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 95.02 | |
| PF11929 | 76 | DUF3447: Domain of unknown function (DUF3447); Int | 94.97 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 94.46 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 93.77 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 92.82 | |
| PF11929 | 76 | DUF3447: Domain of unknown function (DUF3447); Int | 92.72 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 89.07 |
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.5e-62 Score=533.81 Aligned_cols=555 Identities=27% Similarity=0.380 Sum_probs=448.8
Q ss_pred hhHHHHHHHhcCCHHHHHHhhcCCC-CCcccc-c--ccccc----ch-hhhhhhccCCCcccchhhhcccCCchHHHHHH
Q 004504 18 VSQRLLEATLAGDLKSATECIADPY-VDVNFV-G--AVSLK----TR-KTEVVLREGKPSEVRVEFEEFKSDVTALFLAA 88 (748)
Q Consensus 18 ~~~~l~~A~~~G~~~~v~~ll~~~~-~d~n~~-~--~~~l~----~~-~~~~~l~~~~~~~~~~~~~~~~~g~t~L~~A~ 88 (748)
-...|+.|+++|+.+.+..+++... .|+... + ..+.+ .+ ..+++++.++... .....|.||||.|+
T Consensus 21 ~~~~l~~a~r~~~~~~~~~l~~~e~~~~~~sk~~~~pl~~aa~~~~~~v~~~ll~~~a~v~-----~~~~~~~~plh~a~ 95 (1143)
T KOG4177|consen 21 RLPALHIAARNDDTNAAKLLLQNEHNADVDSKSGFTPLHIAAHYGNENVAELLLNRGAIVN-----ATARNGITPLHVAS 95 (1143)
T ss_pred cchHHHHHHhccchhhcccccccccccchhcccccCHHHHHhhhhhhhhhhhhhccccccC-----cccccCccHHHHHH
Confidence 5568999999999999999998752 122111 0 11111 11 1566666665433 23377889999999
Q ss_pred hcCCHHHHHHHHHcCCCCCcccccCh-hHHHHHHhCcHHHHHHHHHcCCCCccch----hH-------------------
Q 004504 89 HSGNVTLVKKLLSTGADVNQKLFRGF-ATTIAVREGHLEILEILLKAGASQPACE----EA------------------- 144 (748)
Q Consensus 89 ~~g~~~iv~~Ll~~ga~~~~~~~~g~-~l~~A~~~g~~~iv~~Ll~~ga~~~~~~----~~------------------- 144 (748)
+.|+.++++.|+..|+.++..+.++. |||.|+..|+.+++.+|+.+|++.+..+ ++
T Consensus 96 ~~~~a~~v~~ll~~ga~~~~~~~~~lTpLh~aa~~g~~~~~~~ll~~~a~~~~k~~~g~t~l~~a~~~~~~~ll~~~~~~ 175 (1143)
T KOG4177|consen 96 KRGDAEMVKLLLCRGAQIDARDRDGLTPLHCAARKGHVQVIELLLQHGAPINIKTKNGLSPLHMAAQVACARLLLEYKAP 175 (1143)
T ss_pred hhcchhHHHHHHhccCchhhcccCCCcchhhhcccccHHHHHHHHHccCCCcccccCCCCchhhhcchhhhHHhhhcccc
Confidence 99999999999999999998888884 8899999999999999999987765421 22
Q ss_pred ----HHHHHhcCcHHHHHHHhcCCC---CCCCccccHHHHHhhcCCHHHHHHHHHCCCCCccchhhhhhhcCCcccCCCC
Q 004504 145 ----LLEASCHGQARLAELLMGSDL---IRPHVAVHSLVTACCRGFVDVVDTLMKCGVDINATDRLLLQSLKPSLHTNVD 217 (748)
Q Consensus 145 ----l~~A~~~g~~~~v~~Ll~~~~---~~~~~~~t~L~~A~~~g~~~~v~~Ll~~gad~n~~~~~~~~~~~~~~~~~~~ 217 (748)
++.|..+++.++++++..... ..+..+.||+|.||..+.+++++.++++|++++..+ +.|
T Consensus 176 d~l~~~~~~~~~~~~~~~ll~~~~~~~~a~~~~~~tpl~~a~~~nri~~~eLll~~gadv~a~d-------------~~g 242 (1143)
T KOG4177|consen 176 DYLRLHVAAHCGHARVAKLLLDKKADPNASALNGFTPLHIACKKNRIKVVELLLKHGADVSAKD-------------ESG 242 (1143)
T ss_pred hhhhhhHHhhcchHHHHhhhhcccCCccccccCCCCchhhhccccccceeeeeeeccCcCCccc-------------ccC
Confidence 255666677777777766544 344567888888888888888888888888888887 448
Q ss_pred CCHHHHHHHcCCHHHHHHHHHcCCCCCcccccCCccccCCCcchhhhhcccCCccccchhhHHHhhhhHHHHHHHhcccC
Q 004504 218 CSALVAAVVSRQVSVVQLLLQAGANTDMKVRLGAWSWDTTTGEEFRVGAGLAEPYAITWCAVEYFEITGSILRMLLQHLS 297 (748)
Q Consensus 218 ~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~Ll~~~~ 297 (748)
.||||.|+..|+.+++++|+.+|+.++..
T Consensus 243 l~~lh~a~~~g~~~i~~~l~~~ga~~~~~--------------------------------------------------- 271 (1143)
T KOG4177|consen 243 LTPLHVAAFMGHLDIVKLLLQHGASVNVS--------------------------------------------------- 271 (1143)
T ss_pred ccHHHHHHhccchhHHHHHHhcccccCcc---------------------------------------------------
Confidence 88888888888888888888888888765
Q ss_pred CCCCCCCchHHHHHHHcCCHHHHHHHHhCCCCCCCCccCCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCcHH
Q 004504 298 YNSPHYGRTLLHHAILCGCTGAVAVLLSCGADAQCPIRTQKTEFHPIHLAARLGYSTIVQSLIDSGCDLNTKTESGETAL 377 (748)
Q Consensus 298 ~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~~~~~~t~L~~A~~~g~~~iv~~Ll~~g~~~~~~~~~g~t~L 377 (748)
+..|.||+|.|+..+..+++++|+++|+++... .....||+|.|.+.|..++++++++.++.++..+..|.|||
T Consensus 272 ---~vr~~tplh~AA~~~~~e~~~~ll~~ga~~~~~---~~~~kt~l~~a~~~g~~~i~~~~l~~~~~~~aar~~g~t~l 345 (1143)
T KOG4177|consen 272 ---TVRGETPLHMAARAGQVEVCKLLLQNGADVLAK---ARDDQTPLHIASRLGHEEIVHLLLQAGATPNAARTAGYTPL 345 (1143)
T ss_pred ---cccccCcchhhhccchhhhHhhhhccCcccccc---cccccChhhhhcccchHHHHHHHhhccCCccccCcCCcccc
Confidence 456778889999888888889999888888753 47778888888888888888888888888888888888899
Q ss_pred HHHHHcCCHHHHHHHHHcCCCCCccccCCCChhhhhhccccccchHHHHHHHHHcCCCCCCCCCCCCcHHHHHHHcCCHH
Q 004504 378 MISAKYKQEECVKVLAKAGADFGLVSVSGQSASSIAGSNWWSVGFQRAVLDIIRSGNIPKSSNVAVFSPLMFVAQAGDIA 457 (748)
Q Consensus 378 ~~A~~~~~~~~v~~Ll~~ga~~~~~~~~g~t~l~~a~~~~~~~~~~~~~~~l~~~~~~~~~~~~~g~t~L~~a~~~~~~~ 457 (748)
|+++..++.++..+|...+..-...+..+.+|++.++.. +..+.++.+++.|.+++.....|.||||.++..++..
T Consensus 346 Hlaa~~~~~~~~~~l~~~~~~~~~a~~k~~~pl~la~~~----g~~~~v~Lll~~ga~~~~~gk~gvTplh~aa~~~~~~ 421 (1143)
T KOG4177|consen 346 HLAAKEGQVEVAGALLEHGAQRRQAEEKGFTPLHLAVKS----GRVSVVELLLEAGADPNSAGKNGVTPLHVAAHYGNPR 421 (1143)
T ss_pred cHhhhhhhHHHHHHhhccccccCcccccCCcchhhhccc----CchhHHHhhhhccCCcccCCCCCcceeeehhhccCcc
Confidence 988888888888888888888888888888888888665 7788888888888888888888899999999999999
Q ss_pred HHHHHHhcCCCCccccCCCCChHHHHHHHcC-CHHHHHHHHHCCCCCccCCCCCCcHHHHHHHcCChhHHHHHHHHHhhh
Q 004504 458 ALKALIGREELNLDYQDDNGFSAVMVAASKG-HVEVFRELVYAGADVKLLNKSGKTAIMLSELNQNCDLFEKVMLEFALE 536 (748)
Q Consensus 458 ~v~~Ll~~~~~~~~~~~~~g~t~L~~A~~~~-~~~~v~~Ll~~gad~~~~~~~g~t~L~~A~~~~~~~~~~~ll~~~~~~ 536 (748)
+++.+++++ ++.+..+..|.||+|.|+..| ..++...+++.|+++|.....|.||||+|+..|+.+++..++... ..
T Consensus 422 ~v~l~l~~g-A~~~~~~~lG~T~lhvaa~~g~~~~~~~~l~~~g~~~n~~s~~G~T~Lhlaaq~Gh~~~~~llle~~-~~ 499 (1143)
T KOG4177|consen 422 VVKLLLKRG-ASPNAKAKLGYTPLHVAAKKGRYLQIARLLLQYGADPNAVSKQGFTPLHLAAQEGHTEVVQLLLEGG-AN 499 (1143)
T ss_pred eEEEEeccC-CChhhHhhcCCChhhhhhhcccHhhhhhhHhhcCCCcchhccccCcchhhhhccCCchHHHHhhhcC-Cc
Confidence 888888876 788888888899999998888 788888888889999888888999999999998888876555444 55
Q ss_pred cCCCCCCCchHHHHHHhcCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCcHHHH
Q 004504 537 KGNRNAGGFYALHCAARRGDLDAVRLLTSRGYGVNVPDGDGYTPLMLAAREGHGPMCELLISNGAVCDIKNARGETALSL 616 (748)
Q Consensus 537 ~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~d~n~~d~~g~tpL~~A~~~~~~~~v~~Ll~~gad~~~~~~~g~t~L~~ 616 (748)
.+.....|.|++|.|...+...+++.++++|++++.++..|+||||.|+.+|+.++|++||++|||++.+++.|+||||.
T Consensus 500 ~~~~~~~~l~~lhla~~~~~v~~~~~l~~~ga~v~~~~~r~~TpLh~A~~~g~v~~VkfLLe~gAdv~ak~~~G~TPLH~ 579 (1143)
T KOG4177|consen 500 DNLDAKKGLTPLHLAADEDTVKVAKILLEHGANVDLRTGRGYTPLHVAVHYGNVDLVKFLLEHGADVNAKDKLGYTPLHQ 579 (1143)
T ss_pred cCccchhccchhhhhhhhhhHHHHHHHhhcCCceehhcccccchHHHHHhcCCchHHHHhhhCCccccccCCCCCChhhH
Confidence 56666778888888888888888888888888888888888888888888888888888888888888888888888888
Q ss_pred HHhcCCCCchhHHHHHHHHHHHHHhCCCCcccccCCCCCCCchhhhh
Q 004504 617 ARKNSSMKNDAELVILDEVARMLVLGGGHVLKHTKGGKGTPHRKDIR 663 (748)
Q Consensus 617 A~~~~~~~~~~~~~~~~~~~~~Ll~~ga~~~~~d~~g~t~l~~a~~~ 663 (748)
|+..|.. +|+++|+++||++|..|.+|.||+++|...
T Consensus 580 Aa~~G~~----------~i~~LLlk~GA~vna~d~~g~TpL~iA~~l 616 (1143)
T KOG4177|consen 580 AAQQGHN----------DIAELLLKHGASVNAADLDGFTPLHIAVRL 616 (1143)
T ss_pred HHHcChH----------HHHHHHHHcCCCCCcccccCcchhHHHHHh
Confidence 8888644 788888888888888888888888888754
|
|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 748 | ||||
| 1n11_A | 437 | D34 Region Of Human Ankyrin-R And Linker Length = 4 | 5e-21 | ||
| 1n11_A | 437 | D34 Region Of Human Ankyrin-R And Linker Length = 4 | 6e-04 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 3e-17 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 2e-16 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 4e-13 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-16 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 3e-16 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 1e-12 | ||
| 4hqd_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 3e-16 | ||
| 4gpm_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-15 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 6e-15 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 3e-13 | ||
| 4hb5_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 5e-14 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 8e-14 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 1e-09 | ||
| 2bkk_B | 169 | Crystal Structure Of Aminoglycoside Phosphotransfer | 3e-13 | ||
| 2bkk_B | 169 | Crystal Structure Of Aminoglycoside Phosphotransfer | 6e-06 | ||
| 3b7b_A | 237 | Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le | 3e-13 | ||
| 3b7b_A | 237 | Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le | 5e-11 | ||
| 1mj0_A | 166 | Sank E3_5: An Artificial Ankyrin Repeat Protein Len | 4e-13 | ||
| 4atz_D | 154 | Ad5 Knob In Complex With A Designed Ankyrin Repeat | 5e-13 | ||
| 4atz_D | 154 | Ad5 Knob In Complex With A Designed Ankyrin Repeat | 3e-09 | ||
| 2v5q_C | 167 | Crystal Structure Of Wild-type Plk-1 Kinase Domain | 2e-12 | ||
| 1svx_A | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 3e-12 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 4e-12 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 1e-07 | ||
| 1s70_B | 299 | Complex Between Protein Ser/thr Phosphatase-1 (delt | 4e-12 | ||
| 4f6r_D | 169 | Tubulin:stathmin-Like Domain Complex Length = 169 | 1e-11 | ||
| 4g8k_A | 337 | Intact Sensor Domain Of Human Rnase L In The Inacti | 1e-11 | ||
| 1wdy_A | 285 | Crystal Structure Of Ribonuclease Length = 285 | 2e-11 | ||
| 3nog_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 2e-11 | ||
| 2p2c_P | 169 | Inhibition Of Caspase-2 By A Designed Ankyrin Repea | 2e-11 | ||
| 2p2c_P | 169 | Inhibition Of Caspase-2 By A Designed Ankyrin Repea | 2e-07 | ||
| 1qym_A | 227 | X-Ray Structure Of Human Gankyrin Length = 227 | 2e-11 | ||
| 1uoh_A | 226 | Human Gankyrin Length = 226 | 3e-11 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 3e-11 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 5e-11 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 1e-10 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 4e-04 | ||
| 3q9u_C | 158 | In Silico And In Vitro Co-Evolution Of A High Affin | 3e-11 | ||
| 3q9u_C | 158 | In Silico And In Vitro Co-Evolution Of A High Affin | 4e-07 | ||
| 2y1l_E | 169 | Caspase-8 In Complex With Darpin-8.4 Length = 169 | 4e-11 | ||
| 2dvw_A | 231 | Structure Of The Oncoprotein Gankyrin In Complex Wi | 7e-11 | ||
| 1bi8_B | 166 | Mechanism Of G1 Cyclin Dependent Kinase Inhibition | 7e-11 | ||
| 1bd8_A | 156 | Structure Of Cdk Inhibitor P19ink4d Length = 156 | 8e-11 | ||
| 3aji_A | 231 | Structure Of Gankyrin-S6atpase Photo-Cross-Linked S | 9e-11 | ||
| 2j8s_D | 169 | Drug Export Pathway Of Multidrug Exporter Acrb Reve | 2e-10 | ||
| 2j8s_D | 169 | Drug Export Pathway Of Multidrug Exporter Acrb Reve | 1e-09 | ||
| 2bkg_A | 166 | Crystal Structure Of E3_19 An Designed Ankyrin Repe | 4e-10 | ||
| 2bkg_A | 166 | Crystal Structure Of E3_19 An Designed Ankyrin Repe | 8e-08 | ||
| 2xen_A | 91 | Structural Determinants For Improved Thermal Stabil | 7e-10 | ||
| 2l6b_A | 115 | Nrc Consensus Ankyrin Repeat Protein Solution Struc | 1e-09 | ||
| 2l6b_A | 115 | Nrc Consensus Ankyrin Repeat Protein Solution Struc | 3e-09 | ||
| 4dui_A | 169 | Darpin D1 Binding To Tubulin Beta Chain (not In Com | 1e-09 | ||
| 4drx_E | 169 | Gtp-Tubulin In Complex With A Darpin Length = 169 | 2e-09 | ||
| 1blx_B | 166 | P19ink4dCDK6 COMPLEX Length = 166 | 4e-09 | ||
| 1ap7_A | 168 | P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 | 4e-09 | ||
| 1mx4_A | 168 | Structure Of P18ink4c (F82q) Length = 168 | 5e-09 | ||
| 1mx6_A | 168 | Structure Of P18ink4c (F92n) Length = 168 | 7e-09 | ||
| 4hbd_A | 276 | Crystal Structure Of Kank2 Ankyrin Repeats Length = | 1e-08 | ||
| 2v4h_C | 136 | Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 | 1e-08 | ||
| 2v4h_C | 136 | Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 | 9e-07 | ||
| 1ihb_A | 162 | Crystal Structure Of P18-Ink4c(Ink6) Length = 162 | 1e-08 | ||
| 1bu9_A | 168 | Solution Structure Of P18-Ink4c, 21 Structures Leng | 1e-08 | ||
| 2dzn_A | 228 | Crystal Structure Analysis Of Yeast Nas6p Complexed | 2e-08 | ||
| 1ixv_A | 231 | Crystal Structure Analysis Of Homolog Of Oncoprotei | 2e-08 | ||
| 3eu9_A | 240 | The Ankyrin Repeat Domain Of Huntingtin Interacting | 2e-08 | ||
| 1wg0_A | 243 | Structural Comparison Of Nas6p Protein Structures I | 2e-08 | ||
| 4grg_A | 135 | Crystal Structure Of Ige Complexed With E2_79, An A | 3e-08 | ||
| 4grg_A | 135 | Crystal Structure Of Ige Complexed With E2_79, An A | 2e-07 | ||
| 3hra_A | 201 | Crystal Structure Of Ef0377 An Ankyrin Repeat Prote | 4e-08 | ||
| 3hg0_D | 136 | Crystal Structure Of A Darpin In Complex With Orf49 | 5e-08 | ||
| 3hg0_D | 136 | Crystal Structure Of A Darpin In Complex With Orf49 | 5e-07 | ||
| 3zuv_B | 136 | Crystal Structure Of A Designed Selected Ankyrin Re | 1e-07 | ||
| 3zuv_B | 136 | Crystal Structure Of A Designed Selected Ankyrin Re | 3e-07 | ||
| 2xzt_G | 136 | Caspase-3 In Complex With Darpin-3.4_i78s Length = | 1e-07 | ||
| 4b93_B | 269 | Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri | 2e-07 | ||
| 1mx2_A | 168 | Structure Of F71n Mutant Of P18ink4c Length = 168 | 2e-07 | ||
| 1awc_B | 153 | Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 | 2e-07 | ||
| 2xzd_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4 | 3e-07 | ||
| 3utm_A | 351 | Crystal Structure Of A Mouse Tankyrase-Axin Complex | 3e-07 | ||
| 3utm_A | 351 | Crystal Structure Of A Mouse Tankyrase-Axin Complex | 5e-05 | ||
| 2y0b_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4_ | 4e-07 | ||
| 3v2o_A | 183 | Crystal Structure Of The Peptide Bound Complex Of T | 5e-07 | ||
| 3so8_A | 162 | Crystal Structure Of Ankra Length = 162 | 5e-07 | ||
| 3v2x_A | 167 | Crystal Structure Of The Peptide Bound Complex Of T | 5e-07 | ||
| 3twu_A | 167 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 6e-07 | ||
| 2fo1_E | 373 | Crystal Structure Of The Csl-Notch-Mastermind Terna | 6e-07 | ||
| 2fo1_E | 373 | Crystal Structure Of The Csl-Notch-Mastermind Terna | 2e-06 | ||
| 2rfm_A | 192 | Structure Of A Thermophilic Ankyrin Repeat Protein | 7e-07 | ||
| 2rfm_A | 192 | Structure Of A Thermophilic Ankyrin Repeat Protein | 9e-05 | ||
| 2zgg_A | 92 | Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom | 8e-07 | ||
| 2jab_A | 136 | A Designed Ankyrin Repeat Protein Evolved To Picomo | 8e-07 | ||
| 2jab_A | 136 | A Designed Ankyrin Repeat Protein Evolved To Picomo | 1e-06 | ||
| 3twr_A | 165 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 1e-06 | ||
| 3twq_A | 175 | Crystal Structure Of Arc4 From Human Tankyrase 2 (A | 1e-06 | ||
| 1myo_A | 118 | Solution Structure Of Myotrophin, Nmr, 44 Structure | 1e-06 | ||
| 3v30_A | 172 | Crystal Structure Of The Peptide Bound Complex Of T | 3e-06 | ||
| 2zgd_A | 110 | Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom | 3e-06 | ||
| 3aaa_C | 123 | Crystal Structure Of Actin Capping Protein In Compl | 4e-06 | ||
| 3f6q_A | 179 | Crystal Structure Of Integrin-Linked Kinase Ankyrin | 6e-06 | ||
| 2kbx_A | 171 | Solution Structure Of Ilk-Pinch Complex Length = 17 | 6e-06 | ||
| 1d9s_A | 136 | Tumor Suppressor P15(Ink4b) Structure By Comparativ | 8e-06 | ||
| 1k1b_A | 241 | Crystal Structure Of The Ankyrin Repeat Domain Of B | 1e-05 | ||
| 1k1b_A | 241 | Crystal Structure Of The Ankyrin Repeat Domain Of B | 8e-04 | ||
| 3uxg_A | 172 | Crystal Structure Of Rfxank Length = 172 | 1e-05 | ||
| 1ikn_D | 236 | IkappabalphaNF-Kappab Complex Length = 236 | 2e-05 | ||
| 1nfi_E | 213 | I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 | 2e-05 | ||
| 3c5r_A | 137 | Crystal Structure Of The Bard1 Ankyrin Repeat Domai | 3e-05 | ||
| 3lvq_E | 497 | The Crystal Structure Of Asap3 In Complex With Arf6 | 4e-05 | ||
| 4a63_B | 239 | Crystal Structure Of The P73-Aspp2 Complex At 2.6a | 4e-05 | ||
| 2b0o_E | 301 | Crystal Structure Of Uplc1 Gap Domain Length = 301 | 6e-05 | ||
| 1ycs_B | 239 | P53-53bp2 Complex Length = 239 | 6e-05 | ||
| 3d9h_A | 285 | Crystal Structure Of The Splice Variant Of Human As | 6e-05 | ||
| 1ot8_A | 239 | Structure Of The Ankyrin Domain Of The Drosophila N | 1e-04 | ||
| 1ot8_A | 239 | Structure Of The Ankyrin Domain Of The Drosophila N | 2e-04 | ||
| 3zkj_A | 261 | Crystal Structure Of Ankyrin Repeat And Socs Box-co | 1e-04 | ||
| 3zkj_A | 261 | Crystal Structure Of Ankyrin Repeat And Socs Box-co | 8e-04 | ||
| 2rfa_A | 232 | Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat | 3e-04 |
| >pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 | Back alignment and structure |
|
| >pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 | Back alignment and structure |
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 | Back alignment and structure |
| >pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 | Back alignment and structure |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 | Back alignment and structure |
| >pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 | Back alignment and structure |
| >pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 | Back alignment and structure |
| >pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 | Back alignment and structure |
| >pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 | Back alignment and structure |
| >pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 | Back alignment and structure |
| >pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 | Back alignment and structure |
| >pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 | Back alignment and structure |
| >pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 | Back alignment and structure |
| >pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 | Back alignment and structure |
| >pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 | Back alignment and structure |
| >pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 | Back alignment and structure |
| >pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 | Back alignment and structure |
| >pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 | Back alignment and structure |
| >pdb|1UOH|A Chain A, Human Gankyrin Length = 226 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 | Back alignment and structure |
| >pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 | Back alignment and structure |
| >pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 | Back alignment and structure |
| >pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 | Back alignment and structure |
| >pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 | Back alignment and structure |
| >pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 | Back alignment and structure |
| >pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 | Back alignment and structure |
| >pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 | Back alignment and structure |
| >pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 | Back alignment and structure |
| >pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 | Back alignment and structure |
| >pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 | Back alignment and structure |
| >pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 | Back alignment and structure |
| >pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 | Back alignment and structure |
| >pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 | Back alignment and structure |
| >pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 | Back alignment and structure |
| >pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 | Back alignment and structure |
| >pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 | Back alignment and structure |
| >pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 | Back alignment and structure |
| >pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 | Back alignment and structure |
| >pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 | Back alignment and structure |
| >pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 | Back alignment and structure |
| >pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 | Back alignment and structure |
| >pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 | Back alignment and structure |
| >pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 | Back alignment and structure |
| >pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 | Back alignment and structure |
| >pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 | Back alignment and structure |
| >pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 | Back alignment and structure |
| >pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 | Back alignment and structure |
| >pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 | Back alignment and structure |
| >pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 | Back alignment and structure |
| >pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 | Back alignment and structure |
| >pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 | Back alignment and structure |
| >pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 | Back alignment and structure |
| >pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 | Back alignment and structure |
| >pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 | Back alignment and structure |
| >pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 | Back alignment and structure |
| >pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 | Back alignment and structure |
| >pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 | Back alignment and structure |
| >pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 | Back alignment and structure |
| >pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 | Back alignment and structure |
| >pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 | Back alignment and structure |
| >pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 | Back alignment and structure |
| >pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 | Back alignment and structure |
| >pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 | Back alignment and structure |
| >pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 | Back alignment and structure |
| >pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 | Back alignment and structure |
| >pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 | Back alignment and structure |
| >pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 | Back alignment and structure |
| >pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 | Back alignment and structure |
| >pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 | Back alignment and structure |
| >pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 | Back alignment and structure |
| >pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 | Back alignment and structure |
| >pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 | Back alignment and structure |
| >pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 | Back alignment and structure |
| >pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 | Back alignment and structure |
| >pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 | Back alignment and structure |
| >pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 | Back alignment and structure |
| >pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 | Back alignment and structure |
| >pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 | Back alignment and structure |
| >pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 | Back alignment and structure |
| >pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 | Back alignment and structure |
| >pdb|1D9S|A Chain A, Tumor Suppressor P15(Ink4b) Structure By Comparative Modeling And Nmr Data Length = 136 | Back alignment and structure |
| >pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 | Back alignment and structure |
| >pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 | Back alignment and structure |
| >pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 | Back alignment and structure |
| >pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 | Back alignment and structure |
| >pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 | Back alignment and structure |
| >pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 | Back alignment and structure |
| >pdb|3LVQ|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Length = 497 | Back alignment and structure |
| >pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 | Back alignment and structure |
| >pdb|2B0O|E Chain E, Crystal Structure Of Uplc1 Gap Domain Length = 301 | Back alignment and structure |
| >pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 | Back alignment and structure |
| >pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 | Back alignment and structure |
| >pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 | Back alignment and structure |
| >pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 | Back alignment and structure |
| >pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 | Back alignment and structure |
| >pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 | Back alignment and structure |
| >pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 748 | |||
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-61 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 8e-57 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-55 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 7e-54 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-50 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-49 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 6e-21 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 2e-47 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 1e-30 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 5e-25 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 5e-19 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 1e-46 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 3e-45 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 1e-35 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 1e-30 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-28 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 4e-26 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 5e-26 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 4e-20 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-15 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 3e-10 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-09 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 6e-04 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 5e-46 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 1e-29 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 2e-26 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 1e-16 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 1e-08 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 6e-46 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 9e-38 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 2e-32 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 5e-26 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 4e-24 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 4e-21 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-18 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-07 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 4e-07 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 6e-46 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 2e-37 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 4e-31 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 8e-28 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 1e-24 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 4e-18 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 1e-14 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 2e-10 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 1e-44 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 5e-39 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 7e-31 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 3e-21 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 4e-20 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 3e-17 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 4e-17 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 1e-16 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 2e-14 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 2e-09 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 2e-44 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 4e-44 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 3e-27 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 8e-22 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 9e-18 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 3e-15 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 1e-11 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 5e-08 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 7e-43 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 8e-34 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 4e-29 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 5e-24 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 2e-21 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 6e-15 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 9e-43 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-38 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 5e-32 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 1e-29 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 6e-25 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 1e-24 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-24 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 6e-14 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-10 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 8e-04 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 4e-41 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 1e-30 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 3e-24 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 1e-23 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 5e-23 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 2e-22 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 2e-18 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 3e-18 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 5e-17 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 1e-15 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 3e-11 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 6e-41 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 1e-34 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 6e-28 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 1e-26 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 1e-18 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 2e-16 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 8e-07 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 3e-39 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 5e-38 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 8e-27 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 5e-24 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 1e-21 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 3e-19 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 4e-17 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 1e-15 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 6e-14 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 8e-39 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-27 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-26 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-21 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 2e-20 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 8e-18 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 2e-15 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 2e-12 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 6e-38 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 8e-27 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 9e-27 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 7e-26 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 1e-23 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 2e-16 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 4e-16 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 6e-16 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 3e-15 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 1e-11 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 2e-11 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 3e-10 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 5e-35 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 3e-33 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 9e-26 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 6e-22 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 2e-18 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 4e-18 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 7e-18 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 1e-14 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 1e-11 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 2e-11 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 1e-33 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 1e-25 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 6e-20 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 2e-17 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 4e-17 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 1e-16 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 6e-12 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 2e-11 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 3e-33 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 1e-30 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 2e-18 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 8e-14 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 1e-12 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 7e-12 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 6e-07 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 6e-33 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 3e-27 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 7e-26 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 7e-24 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 6e-23 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 3e-20 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 2e-16 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 8e-16 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 2e-12 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 5e-06 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 4e-05 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 2e-32 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 7e-26 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 2e-21 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 9e-21 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 5e-16 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 1e-15 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 5e-13 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 5e-32 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 2e-27 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 2e-24 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 8e-23 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 4e-19 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 1e-17 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 8e-17 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 2e-11 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 2e-11 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 3e-10 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 2e-31 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 4e-21 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 3e-18 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 3e-17 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 3e-16 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 3e-16 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 6e-13 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 1e-10 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 4e-08 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 1e-05 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 4e-31 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 4e-30 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 2e-23 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 3e-23 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 5e-22 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 3e-18 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 1e-15 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 3e-04 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 5e-30 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 1e-23 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 1e-18 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 1e-11 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 1e-06 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 8e-30 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 8e-25 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 1e-17 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 3e-13 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 5e-13 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 1e-11 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 6e-10 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 8e-30 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 3e-27 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 5e-26 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 1e-25 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 2e-18 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 7e-14 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 2e-13 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 2e-13 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 6e-09 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 4e-29 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 2e-26 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 2e-18 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 2e-18 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 5e-17 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 7e-13 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 3e-09 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 8e-29 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 3e-24 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 5e-19 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 1e-16 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 6e-15 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 1e-13 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 2e-13 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 1e-09 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 2e-05 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 4e-28 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 1e-24 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 3e-19 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 5e-19 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 2e-17 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 1e-13 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 1e-10 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 2e-07 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 1e-27 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 1e-19 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 1e-18 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 2e-14 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 1e-13 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 2e-13 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 3e-13 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 8e-11 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 4e-07 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 1e-27 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 8e-23 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 1e-16 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 4e-13 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 2e-12 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 4e-12 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 2e-09 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 4e-06 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 1e-27 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 6e-21 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 7e-16 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 1e-15 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 1e-14 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 3e-13 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 3e-08 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 2e-04 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 4e-27 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 8e-17 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 4e-16 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 3e-15 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 3e-14 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 5e-13 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 2e-07 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 1e-04 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 6e-27 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 5e-26 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 2e-25 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 3e-18 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 2e-12 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 7e-27 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 3e-18 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 3e-16 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 3e-16 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 1e-14 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-14 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-11 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-07 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 7e-05 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 2e-26 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 2e-20 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 5e-20 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 3e-16 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 4e-13 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 1e-12 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 2e-11 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 2e-10 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 5e-10 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 3e-06 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 4e-26 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 4e-21 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 1e-16 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 4e-15 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 3e-12 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 1e-10 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 2e-10 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 1e-09 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 1e-08 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 3e-05 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 5e-26 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 5e-21 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 1e-18 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 4e-15 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 4e-14 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 5e-12 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 1e-05 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 5e-26 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 8e-25 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 5e-20 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 2e-16 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 3e-16 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 6e-15 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 3e-12 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 4e-12 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 9e-11 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 2e-09 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 6e-06 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 9e-26 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 7e-21 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 1e-16 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 4e-16 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 5e-15 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 3e-14 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 4e-13 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 7e-10 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 3e-04 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 1e-25 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 3e-25 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 1e-19 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 2e-16 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 5e-14 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 7e-12 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 2e-10 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 2e-09 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 8e-25 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 6e-22 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-17 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-16 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 3e-13 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 4e-13 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 4e-11 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-10 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 1e-08 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 5e-07 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-04 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 7e-24 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 6e-23 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 1e-22 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 5e-20 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 1e-18 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 2e-14 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 1e-12 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 2e-10 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 2e-07 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 9e-24 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 8e-23 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 2e-15 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 2e-10 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 5e-10 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 8e-10 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 2e-07 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 9e-24 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 9e-18 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 1e-17 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 1e-13 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 5e-12 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 2e-22 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 3e-18 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 3e-14 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 1e-13 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 7e-10 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 6e-09 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 4e-07 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 1e-06 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 1e-05 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 5e-22 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 2e-20 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 5e-16 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 3e-11 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 3e-11 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 7e-11 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 1e-10 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 1e-10 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 2e-05 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 1e-04 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 7e-22 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 4e-14 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 1e-13 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 3e-11 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 4e-11 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 9e-09 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 5e-08 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 2e-07 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 7e-06 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 5e-04 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 1e-17 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 2e-17 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 5e-16 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 4e-13 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 6e-11 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 1e-14 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 1e-10 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 1e-10 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 2e-07 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 8e-06 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 2e-05 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 9e-13 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 1e-11 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 1e-08 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 3e-07 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 6e-07 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 8e-06 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 3e-05 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 2e-12 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 4e-12 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 5e-09 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 2e-06 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 3e-05 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 9e-05 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 1e-11 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 4e-08 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 3e-05 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 |
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
Score = 212 bits (543), Expect = 1e-61
Identities = 98/491 (19%), Positives = 177/491 (36%), Gaps = 103/491 (20%)
Query: 178 ACCRGFVDVVDTLMKCGVDINATDRLLLQSLKPSLHTNVDCSALVAAVVSRQVSVVQLLL 237
A G + +V L++ G N ++ + L A + V + LL
Sbjct: 21 ASFMGHLPIVKNLLQRGASPNVSN-------------VKVETPLHMAARAGHTEVAKYLL 67
Query: 238 QAGANTDMKVRLGAWSWDTTTGEEFRVGAGLAEPYAITWCAVE-YFEITGSILRMLLQHL 296
Q A + K + T + A + + ++LL++
Sbjct: 68 QNKAKVNAKAKDD----QT----------------PLHCAARIGHTNMV----KLLLENN 103
Query: 297 SY-NSP-HYGRTLLHHAILCGCTGAVAVLLSCGADAQCPIRTQKTEFHPIHLAARLGYST 354
+ N G T LH A G V LL A C + T P+H+AA+ G
Sbjct: 104 ANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFT---PLHVAAKYGKVR 160
Query: 355 IVQSLIDSGCDLNTKTESGETALMISAKYKQEECVKVLAKAGADFGLVSVSGQSASSIAG 414
+ + L++ N ++G T L ++ + + VK+L G + +G
Sbjct: 161 VAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNG-------- 212
Query: 415 SNWWSVGFQRAVLDIIRSGNIPKSSNVAVFSPLMFVAQAGDIAALKALIGREELNLDYQD 474
++PL A+ + ++L+ + + +
Sbjct: 213 -----------------------------YTPLHIAAKQNQVEVARSLLQYG-GSANAES 242
Query: 475 DNGFSAVMVAASKGHVEVFRELVYAGADVKLLNKSGKTAIMLSELNQNCDLFEKVMLEFA 534
G + + +AA +GH E+ L+ A+ L NKSG T + L + + +
Sbjct: 243 VQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVP-----VADVL 297
Query: 535 LEKG----NRNAGGFYALHCAARRGDLDAVRLLTSRGYGVNVPDGDGYTPLMLAAREGHG 590
++ G G+ LH A+ G++ V+ L VN GY+PL AA++GH
Sbjct: 298 IKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHT 357
Query: 591 PMCELLISNGAVCDIKNARGETALSLARKNSSMKNDAELVILDEVARMLVLGGGH---VL 647
+ LL+ NGA + ++ G T L++A++ + V +L + VL
Sbjct: 358 DIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYI----------SVTDVLKVVTDETSFVL 407
Query: 648 KHTKGGKGTPH 658
K P
Sbjct: 408 VSDKHRMSFPE 418
|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 748 | ||||
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 4e-42 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 5e-40 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-38 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 1e-19 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-19 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-19 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-08 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 4e-33 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 6e-25 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 4e-22 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-21 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 6e-12 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 6e-10 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-06 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 1e-27 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 2e-17 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 2e-15 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 2e-13 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 5e-10 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 4e-24 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 5e-15 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 8e-09 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 7e-07 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 1e-06 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 2e-22 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 9e-14 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 2e-12 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 9e-11 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 6e-08 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 4e-07 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 3e-20 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 7e-20 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 4e-16 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 1e-10 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 9e-08 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 2e-07 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 5e-20 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 2e-19 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 3e-15 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 5e-13 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 2e-06 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 6e-06 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 2e-04 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-19 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-18 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 5e-14 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 3e-09 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 6e-08 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 3e-05 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-18 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 9e-12 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-11 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 3e-06 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 1e-04 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-04 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 1e-16 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 5e-13 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 9e-12 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 7e-08 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 8e-07 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 1e-05 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 3e-05 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 8e-04 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 2e-15 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 6e-11 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 1e-08 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 6e-05 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 5e-04 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 2e-09 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 6e-05 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 2e-09 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 4e-08 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 3e-06 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 4e-06 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 2e-05 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 0.003 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 2e-09 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 4e-09 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 5e-09 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 6e-09 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 2e-06 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 7e-06 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 2e-04 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 4e-09 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 4e-08 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 6e-06 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 8e-06 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 4e-05 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 2e-04 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 0.004 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 1e-08 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 1e-07 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 2e-04 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 7e-04 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 8e-04 | |
| d1ycsb1 | 130 | d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) | 2e-07 | |
| d1ycsb1 | 130 | d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) | 6e-04 | |
| d1ycsb1 | 130 | d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) | 9e-04 | |
| d1ycsb1 | 130 | d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) | 0.001 | |
| d1bi7b_ | 125 | d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma | 3e-06 |
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Ankyrin-R species: Human (Homo sapiens) [TaxId: 9606]
Score = 156 bits (394), Expect = 4e-42
Identities = 92/468 (19%), Positives = 171/468 (36%), Gaps = 79/468 (16%)
Query: 175 LVTACCRGFVDVVDTLMKCGVDINATDRLLLQSLKPSLHTNVDCSALVAAVVSRQVSVVQ 234
L A G + +V L++ G N ++ + L A + V +
Sbjct: 4 LHVASFMGHLPIVKNLLQRGASPNVSN-------------VKVETPLHMAARAGHTEVAK 50
Query: 235 LLLQAGANTDMKVRLGAWSWDTTTGEEFRVGAGLAEPYAITWCAVEYFEITGSILRMLLQ 294
LLQ A + K + CA +++++LL+
Sbjct: 51 YLLQNKAKVNAKAKDDQTPL---------------------HCAARIGHT--NMVKLLLE 87
Query: 295 HLSYNSPHYGRTLLHHAILCGCTGAVAVLLSCGADAQCPIRTQKTEFHPIHLAARLGYST 354
+ + + I VL +A T K F P+H+AA+ G
Sbjct: 88 NNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMT-KKGFTPLHVAAKYGKVR 146
Query: 355 IVQSLIDSGCDLNTKTESGETALMISAKYKQEECVKVLAKAGADFGLVSVSGQSASSIAG 414
+ + L++ N ++G T L ++ + + VK+L G + +G + I
Sbjct: 147 VAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHI-- 204
Query: 415 SNWWSVGFQRAVLDIIRSGNIPKSSNVAVFSPLMFVAQAGDIAALKALIGREELNLDYQD 474
+++ G + +V +PL AQ G + L+ ++ N + +
Sbjct: 205 --AAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQA-NGNLGN 261
Query: 475 DNGFSAVMVAASKGHVEVFRELVYAGADVKLLNKSGKTAIMLSELNQNCDLFEKVMLEFA 534
+G + + + A +GHV V L+ G V + G T
Sbjct: 262 KSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTP--------------------- 300
Query: 535 LEKGNRNAGGFYALHCAARRGDLDAVRLLTSRGYGVNVPDGDGYTPLMLAAREGHGPMCE 594
LH A+ G++ V+ L VN GY+PL AA++GH +
Sbjct: 301 -------------LHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVT 347
Query: 595 LLISNGAVCDIKNARGETALSLARKNSSMKNDAEL--VILDEVARMLV 640
LL+ NGA + ++ G T L++A++ + ++ V+ DE + +LV
Sbjct: 348 LLLKNGASPNEVSSDGTTPLAIAKRLGY-ISVTDVLKVVTDETSFVLV 394
|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 748 | |||
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 100.0 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 100.0 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 100.0 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 100.0 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 100.0 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 100.0 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 100.0 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 100.0 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 100.0 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 100.0 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 100.0 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 100.0 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 100.0 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 100.0 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 100.0 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 100.0 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 100.0 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.98 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.97 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.96 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.96 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.96 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.96 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.96 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.96 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.94 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.92 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.91 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.91 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.91 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.9 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.89 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 83.08 |
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Ankyrin-R species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=0 Score=384.70 Aligned_cols=398 Identities=27% Similarity=0.363 Sum_probs=296.4
Q ss_pred CHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCH-HHHHHHHHCCHHHHHHHHHCCCCCCCCHHHHHHHHHCCCHHHHHH
Q ss_conf 1499999960999999999976999875655672-678999809499999999769998531129999994086999999
Q 004504 81 VTALFLAAHSGNVTLVKKLLSTGADVNQKLFRGF-ATTIAVREGHLEILEILLKAGASQPACEEALLEASCHGQARLAEL 159 (748)
Q Consensus 81 ~t~L~~A~~~g~~~iv~~Ll~~ga~~n~~~~~g~-~l~~A~~~g~~~iv~~Ll~~ga~~~~~~~~l~~A~~~g~~~~v~~ 159 (748)
.||||.||..|+.++|++|+++|+++|..+..|. |||+|+..|+.+++++|+++|++++.
T Consensus 1 ~TpL~~Aa~~g~~~~v~~Ll~~g~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gadi~~------------------- 61 (408)
T d1n11a_ 1 LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA------------------- 61 (408)
T ss_dssp CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSC-------------------
T ss_pred CCHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHCCCCCCC-------------------
T ss_conf 9869999988489999999978789998899998899999986889999999988599887-------------------
Q ss_pred HHCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHCCCCCCCCHHHHHHHCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHC
Q ss_conf 83089888776651789976119987999999879997621035642028765578899878999983999999999986
Q 004504 160 LMGSDLIRPHVAVHSLVTACCRGFVDVVDTLMKCGVDINATDRLLLQSLKPSLHTNVDCSALVAAVVSRQVSVVQLLLQA 239 (748)
Q Consensus 160 L~~~~~~~~~~~~~~L~~A~~~g~~~~v~~Ll~~g~d~n~~~~~~~~~~~~~~~~~~~~t~L~~A~~~g~~~iv~~Ll~~ 239 (748)
.+..+.+||++|+..|+.+++++|+..+.+..... ....+++..+...+...........
T Consensus 62 -------~~~~g~t~L~~A~~~g~~~~~~~Ll~~~~~~~~~~-------------~~~~~~~~~~~~~~~~~~~~~~~~~ 121 (408)
T d1n11a_ 62 -------KAKDDQTPLHCAARIGHTNMVKLLLENNANPNLAT-------------TAGHTPLHIAAREGHVETVLALLEK 121 (408)
T ss_dssp -------CCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCC-------------TTCCCHHHHHHHHTCHHHHHHHHHT
T ss_pred -------CCCCCCCHHHHHHHCCCHHHHHHHHHHHHCCCCCC-------------CCCCCHHHHHHHHCCCCCCCCCCCC
T ss_conf -------79998999999998699779999987410012321-------------1122024555430332222222211
Q ss_pred CCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCHHH
Q ss_conf 99987211258764567774013540356775311013579745019899999603389999987419999998499999
Q 004504 240 GANTDMKVRLGAWSWDTTTGEEFRVGAGLAEPYAITWCAVEYFEITGSILRMLLQHLSYNSPHYGRTLLHHAILCGCTGA 319 (748)
Q Consensus 240 ga~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~Ll~~~~~~~~~~g~t~L~~A~~~g~~~~ 319 (748)
+...... +..+.++++.|+..++.++
T Consensus 122 ~~~~~~~------------------------------------------------------~~~~~~~l~~a~~~~~~~~ 147 (408)
T d1n11a_ 122 EASQACM------------------------------------------------------TKKGFTPLHVAAKYGKVRV 147 (408)
T ss_dssp TCCSCCC------------------------------------------------------CTTSCCHHHHHHHTTCHHH
T ss_pred CCCCCCC------------------------------------------------------CCCCCHHHHHHHHCCCHHH
T ss_conf 0010014------------------------------------------------------5646428999987598999
Q ss_pred HHHHHHCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHCCCCC
Q ss_conf 99999689998898668889881899999749999999999769998888999973889999759988999999849998
Q 004504 320 VAVLLSCGADAQCPIRTQKTEFHPIHLAARLGYSTIVQSLIDSGCDLNTKTESGETALMISAKYKQEECVKVLAKAGADF 399 (748)
Q Consensus 320 v~~Ll~~g~~~~~~~~~~~~~~t~L~~A~~~g~~~iv~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~ 399 (748)
+++|++.|++++. .+..+.+||+.|+..|+.+++++|+++|++++..+..|.||++.+....+.+....++..+...
T Consensus 148 v~~ll~~~~~~~~---~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~ 224 (408)
T d1n11a_ 148 AELLLERDAHPNA---AGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSA 224 (408)
T ss_dssp HHHHHHTTCCTTC---CCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCT
T ss_pred HHHHHHCCCCCCC---CCCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCCCHHHHCCCHHHHHHHHHHCCCCC
T ss_conf 9999976998886---7876740999999859999999998658840045778997102432021045555543200122
Q ss_pred CCCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCH
Q ss_conf 75335899832331105654046999999998399999998778718999997099999999984489886446999971
Q 004504 400 GLVSVSGQSASSIAGSNWWSVGFQRAVLDIIRSGNIPKSSNVAVFSPLMFVAQAGDIAALKALIGREELNLDYQDDNGFS 479 (748)
Q Consensus 400 ~~~~~~~~t~l~~a~~~~~~~~~~~~~~~l~~~~~~~~~~~~~g~t~L~~a~~~~~~~~v~~Ll~~~~~~~~~~~~~g~t 479 (748)
...+. .+.+|++.|+..++.+++++++... ...+..+..|.+
T Consensus 225 ~~~~~-------------------------------------~~~t~l~~a~~~~~~~~~~~~~~~~-~~~~~~~~~g~~ 266 (408)
T d1n11a_ 225 NAESV-------------------------------------QGVTPLHLAAQEGHAEMVALLLSKQ-ANGNLGNKSGLT 266 (408)
T ss_dssp TCCCT-------------------------------------TCCCHHHHHHHTTCHHHHHHHHTTT-CCTTCCCTTCCC
T ss_pred CCCCC-------------------------------------CCCCHHHHHHHHCCHHHHHHHHCCC-CCCCCCCCCCCC
T ss_conf 12477-------------------------------------8999999999808676754420022-111112478997
Q ss_pred HHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHCCCHHH
Q ss_conf 99999981979999999987999766777898387799971790699999999755208988998539999996499999
Q 004504 480 AVMVAASKGHVEVFRELVYAGADVKLLNKSGKTAIMLSELNQNCDLFEKVMLEFALEKGNRNAGGFYALHCAARRGDLDA 559 (748)
Q Consensus 480 ~L~~A~~~g~~~~v~~Ll~~ga~~~~~~~~g~t~L~~a~~~~~~~~~~~ll~~~~~~~~~~~~~g~t~Lh~A~~~~~~~~ 559 (748)
|++.++..++.+++++|+++|++++..+.. +.||||.++..++.++
T Consensus 267 ~l~~a~~~~~~~i~~~Ll~~g~~~~~~~~~----------------------------------~~t~L~~~~~~~~~~~ 312 (408)
T d1n11a_ 267 PLHLVAQEGHVPVADVLIKHGVMVDATTRM----------------------------------GYTPLHVASHYGNIKL 312 (408)
T ss_dssp HHHHHHHHTCHHHHHHHHHHTCCTTCCCSS----------------------------------CCCHHHHHHHSSCSHH
T ss_pred HHHHHHHCCCHHHHHHHHHCCCCCCCCCCC----------------------------------CCCCCHHHCCCCCCEE
T ss_conf 334543028489999999779965621023----------------------------------4453022100586213
Q ss_pred HHHHHHCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHHHH
Q ss_conf 99999699999999999994989999819989999999599998999899985899998669997414787799999999
Q 004504 560 VRLLTSRGYGVNVPDGDGYTPLMLAAREGHGPMCELLISNGAVCDIKNARGETALSLARKNSSMKNDAELVILDEVARML 639 (748)
Q Consensus 560 v~~Ll~~g~~~n~~d~~g~tpL~~A~~~~~~~~v~~Ll~~ga~~~~~d~~g~t~L~~a~~~~~~~~~~~~~~~~~~~~~L 639 (748)
++++++.|+++|.+|..|.||||+|++.|+.++|++|+++|||+|++|+.|+||||+|+..+.. +.. ++.+.+
T Consensus 313 ~~~ll~~g~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GAd~n~~d~~G~t~L~~A~~~~~~-~iv------~~L~~~ 385 (408)
T d1n11a_ 313 VKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYI-SVT------DVLKVV 385 (408)
T ss_dssp HHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHTTCH-HHH------HHHHHH
T ss_pred EEEECCCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCH-HHH------HHHHHH
T ss_conf 5530133332234689999999999986889999999987889988799998999999983999-999------999998
Q ss_pred HHCCCCCCCCCCCC
Q ss_conf 93999865446899
Q 004504 640 VLGGGHVLKHTKGG 653 (748)
Q Consensus 640 ~~~ga~~~~~~~~g 653 (748)
+.++++....++..
T Consensus 386 ~~~~~~~~~~~~~~ 399 (408)
T d1n11a_ 386 TDETSFVLVSDKHR 399 (408)
T ss_dssp CCCCSSCC----CC
T ss_pred HHCCCCCCCCCCCC
T ss_conf 73656456000366
|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|