Citrus Sinensis ID: 004573

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740----
MLKERKRYVLILDDVWKRFSLDEVGIPEPTVDNGCKLVLTTRLKEVARSMGCEVIPVDLLSEDEALRLFSKHVGDYLLRIPTIEPILKQVVEQCAGLPLAIVTVASSMKSEDDVDLWKNALNELKENSTSVEGMGDEVIPRLKFSYDRLMDPKIKRCFLYCALFPEDFDIPKEELIEYWIVEGLIDVMETRQAMHYKGLAILHKLKENCLLESAEDGKCVKMHDLVREMALDITTGSPRYLVEAGKFGALLLEEEWKDDVEKVSLMRCRITRIPSNFPSSGCRSLSTLLLQHNYIEEIPEFFFEHLTGLKILDLSGNSNLLRLPDSISGLINLTALMVHGCFRLRHVPSLAKLSALKKLDLGGTEIDVVPQGLEMLAHLTYLDLNWTRILQIPDGMLSNLSRIQHLRLDRVAFENAEDILRLMKLEIFGVRFDHLQDYHRYLSLQSRRRLSKYYFTVEKNAYTYARGEWDKYVSLVELRICENSVVLPRDIQQLHFNVCGGMRSLRDVPSLKDTTDLRECVIYRCYEMEFVFCLSSCYGILETLEYLLLQRLVDLKAIFQIAEDEVNASSLRTQTPSPPNIVFRLKRLIMSDCGKIRKLFSPELLPSLQNLEEIQVKYCGGLEEIIAASDDDEEGENNEAAGNNSIKSLALPKLRVLYLKELPNLMSICSRRSTLVCNSLETIVVLRCPEIKRLPVLLPHLVNGQPLNPRSLRIDIDKDCWDALEWDDPNTKSLLALVRGYWWS
ccccccEEEEEEcccccccccccccccccccccccEEEEEcccHHHHHHccccEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccHHHHcccccccccHHHHHHHHHccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEcccHHHHHHHHHHccccEEEEEccccccccccccccccEEEEEEEccccEEccccccccccccEEEEEccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEccccEEEEcccccccccccccEEEEcccccccHHHHccccccccccEEccccccHHHHcccccccccccEEEEEcccccccccccccccccEEEEEEcccccccccccccEEEEEccccccccccccccccccccEEEEEEccccEEEEcccccccccccccEEEccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccEEEEEccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccc
ccccccEEEEEEEcccccccHHHHcccccccccccEEEEEEccHHHHHHcccccEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccHHHHHEcHHccccHHHHHHHHHHHcccccccEcHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccccccEEEHHHHHHHHHHHHHcccEEEEEEccccccccccccccccEEEEEEEccccccccccccccccccEEEEEccccccccccHHHHHcccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccccccccHcccccccEEEEcccccccccccHHccccccEEEEEccccccccccHcccccccEEEEccccccccccHccccccccccEEEEEccccccccccccccccccEEEcccccccccccccccEEEEEcccccccccccccccccccccEEEEccccccEEcccccccccccccccEEEEcccccHHccccccHcccccccccccccccccccccccEEEEcccccHccccccccccccccccEEEEcccccHHccccccccccHccEEEccccccccccccccccEEEEcccccHccccccccccccccccEEEEcccccHccccccccccccccccccccccccccHHHHHcccccccccccccccccEEEcc
MLKERKRYVLILDDVwkrfsldevgipeptvdngckLVLTTRLKEVARSmgcevipvdllSEDEALRLFSKHVGdyllriptiePILKQVVEQCAGLPLAIVTVAssmkseddVDLWKNALNELkenstsvegmgdeviprlkfsydrlmdpkikRCFLYCalfpedfdipkeELIEYWIVEGLIDVMETRQAMHYKGLAILHKLKENcllesaedgkcvkmHDLVREMALDittgsprylvEAGKFGALLLEEEWKDDVEKVSLMRcritripsnfpssgcrslSTLLLQHNYIEEIPEFFFEHLTglkildlsgnsnllrlpdsiSGLINLTALMVhgcfrlrhvpslaKLSAlkkldlggteidvVPQGLEMLAHLTYldlnwtrilqipdgmlsnlsrIQHLRLDRVAFENAEDILRLMKLEIFGVRFDHLQDYHRYLSLQSRRRLSKYYFTVEKNAYTYARGEWDKYVSLVELRIcensvvlprdIQQLHFNVcggmrslrdvpslkdttdlrecVIYRCYEMEFVFCLSSCYGILETLEYLLLQRLVDLKAIFQIAEdevnasslrtqtpsppniVFRLKRLIMSDCgkirklfspellpslqnLEEIQVKYCGGLEEiiaasdddeegenneaagnnsikslalPKLRVLYLKELPNlmsicsrrstlvcnsletivvlrcpeikrlpvllphlvngqplnprslrididkdcwdalewddpntKSLLALVRGYWWS
MLKERKRYVLilddvwkrfsldevgipeptvdngcklVLTTRLKEVARSMGCEVIPVDLLSEDEALRLFSKHVGDYLLRIPTIEPILKQVVEQCAGLPLAIVTVASSMKSEDDVDLWKNALNElkenstsvegmgdeviPRLKFSYDRLMDPKIKRCFLYCALFPEDFDIPKEELIEYWIVEGLIDVMETRQAMHYKGLAILHKLKENCLLESAEDGKCVKMHDLVREMALdittgspryLVEAGKFGALLLEEEWKDDVEKVSLMRCRItripsnfpssgcRSLSTLLLQHNYIEEIPEFFFEHLTGLKILDLSGNSNLLRLPDSISGLINLTALMVHGCFRLRHVPSLAKLSALKKLDLGGTEIDVVPQGLEMLAHLTYLDLNWTRILQIPDGMLSNLSRIQHLRLDRVAFENAEDILRLMKLEIFGVRFDHLQDYHRYlslqsrrrlSKYYFTVEKNAYTYARGEWDKYVSLVELRICENSVVLPRDIQQLHFNvcggmrslrdvpslkdttdLRECVIYRCYEMEFVFCLSSCYGILETLEYLLLQRLVDLKAIFQIAEDevnasslrtqtpsppniVFRLKRLIMSDCGKIRKLFspellpslqnLEEIQVKYCGGLEEIIAASDDDEEGENNeaagnnsikslalPKLRVLYLKELPNLMSICSRRSTLVCNSLETIVVLRCPEIKRLPVLlphlvngqplnprslRIDIDKDCWDAlewddpntkSLLALVRGYWWS
MLKERKRYVLILDDVWKRFSLDEVGIPEPTVDNGCKLVLTTRLKEVARSMGCEVIPVDLLSEDEALRLFSKHVGDYLLRIPTIEPILKQVVEQCAGLPLAIVTVASSMKSEDDVDLWKNALNELKENSTSVEGMGDEVIPRLKFSYDRLMDPKIKRCFLYCALFPEDFDIPKEELIEYWIVEGLIDVMETRQAMHYKGLAILHKLKENCLLESAEDGKCVKMHDLVREMALDITTGSPRYLVEAGKFGALLLEEEWKDDVEKVSLMRCRITRIPSNFPSSGCRSLSTLLLQHNYIEEIPEFFFEHLTGLKILDLSGNSNLLRLPDSISGLINLTALMVHGCFRLRHVPslaklsalkklDLGGTEIDVVPQGLEMLAHLTYLDLNWTRILQIPDGMLSNLSRIQHLRLDRVAFENAEDILRLMKLEIFGVRFDHLQDYHrylslqsrrrlskyyFTVEKNAYTYARGEWDKYVSLVELRICENSVVLPRDIQQLHFNVCGGMRSLRDVPSLKDTTDLRECVIYRCYEMEFVFCLSSCYGIletleylllqrlVDLKAIFQIAEDEVNASSLRTQTPSPPNIVFRLKRLIMSDCGKIRKLFSPELLPSLQNLEEIQVKYCGGLeeiiaasdddeegenneaagnnsIKSLALPKLRVLYLKELPNLMSICSRRSTLVCNSLETIVVLRCPEIKRLPVLLPHLVNGQPLNPRSLRIDIDKDCWDALEWDDPNTKSLLALVRGYWWS
******RYVLILDDVWKRFSLDEVGIPEPTVDNGCKLVLTTRLKEVARSMGCEVIPVDLLSEDEALRLFSKHVGDYLLRIPTIEPILKQVVEQCAGLPLAIVTVASSM***DDVDLWKNALN************GDEVIPRLKFSYDRLMDPKIKRCFLYCALFPEDFDIPKEELIEYWIVEGLIDVMETRQAMHYKGLAILHKLKENCLLESAEDGKCVKMHDLVREMALDITTGSPRYLVEAGKFGALLLEEEWKDDVEKVSLMRCRITRIPSNFPSSGCRSLSTLLLQHNYIEEIPEFFFEHLTGLKILDLSGNSNLLRLPDSISGLINLTALMVHGCFRLRHVPSLAKLSALKKLDLGGTEIDVVPQGLEMLAHLTYLDLNWTRILQIPDGMLSNLSRIQHLRLDRVAFENAEDILRLMKLEIFGVRFDHLQDYHRYLSLQSRRRLSKYYFTVEKNAYTYARGEWDKYVSLVELRICENSVVLPRDIQQLHFNVCGGMRSLRDVPSLKDTTDLRECVIYRCYEMEFVFCLSSCYGILETLEYLLLQRLVDLKAIFQIAEDEV*************NIVFRLKRLIMSDCGKIRKLFSPELLPSLQNLEEIQVKYCGGLEEIIA********************SLALPKLRVLYLKELPNLMSICSRRSTLVCNSLETIVVLRCPEIKRLPVLLPHLVNGQPLNPRSLRIDIDKDCWDALEWDDPNTKSLLALVRGYWW*
*LKERKRYVLILDDVWKRFSLDEVGIPEPTVDNGCKLVLTTRLKEVARSMGCEVIPVDLLSEDEALRLFSKHVGDYLLRIPTIEPILKQVVEQCAGLPLAIVTVASSMKSEDDVDLWKNALNELKE**********EVIPRLKFSYDRLMDPKIKRCFLYCALFPEDFDIPKEELIEYWIVEGLIDVMETRQAMHYKGLAILHKLKENCLLESAEDGKCVKMHDLVREMALDITTGSPRYLVEAGKFGALLLEEEWKDDVEKVSLMRCRITRIPSNFPSSGCRSLSTLLLQHNYIEEIPEFFFEHLTGLKILDLSGNSNLLRLPDSISGLINLTALMVHGCFRLRHVPSLAKLSALKKLDLGGTEIDVVPQGLEMLAHLTYLDLNWTRIL*********LSRIQHLRLDRVAFENAEDILRLMKLEIFGVRFDHLQDYHRYLSLQSRRRLSKYYFTVEKNAYTYARGEWDKYVSLVELRICENSVVLPRDIQQLHFNVCGGMRSLRDVPSLKDTTDLRECVIYRCYEMEFVFCLSSCYGILETLEYLLLQRLVDLKAIFQIAEDEVNASSL***TPSPPNIVFRLKRLIMSDCGKIRKLFSPELLPSLQNLEEIQVKYCGGLEEIIAASDDDEEG******GNNSIKSLALPKLRVLYLKELPNLMSICSRRSTLVCNSLETIVVLRCPEIKRLPVLL*************LRIDIDKDCWDALEWDDPNTKSLLALVRGYWWS
MLKERKRYVLILDDVWKRFSLDEVGIPEPTVDNGCKLVLTTRLKEVARSMGCEVIPVDLLSEDEALRLFSKHVGDYLLRIPTIEPILKQVVEQCAGLPLAIVTVASSMKSEDDVDLWKNALNELKENSTSVEGMGDEVIPRLKFSYDRLMDPKIKRCFLYCALFPEDFDIPKEELIEYWIVEGLIDVMETRQAMHYKGLAILHKLKENCLLESAEDGKCVKMHDLVREMALDITTGSPRYLVEAGKFGALLLEEEWKDDVEKVSLMRCRITRIPSNFPSSGCRSLSTLLLQHNYIEEIPEFFFEHLTGLKILDLSGNSNLLRLPDSISGLINLTALMVHGCFRLRHVPSLAKLSALKKLDLGGTEIDVVPQGLEMLAHLTYLDLNWTRILQIPDGMLSNLSRIQHLRLDRVAFENAEDILRLMKLEIFGVRFDHLQDYHRYLSLQSRRRLSKYYFTVEKNAYTYARGEWDKYVSLVELRICENSVVLPRDIQQLHFNVCGGMRSLRDVPSLKDTTDLRECVIYRCYEMEFVFCLSSCYGILETLEYLLLQRLVDLKAIFQIAEDEVNASSLRTQTPSPPNIVFRLKRLIMSDCGKIRKLFSPELLPSLQNLEEIQVKYCGGLEEIIAASD**********AGNNSIKSLALPKLRVLYLKELPNLMSICSRRSTLVCNSLETIVVLRCPEIKRLPVLLPHLVNGQPLNPRSLRIDIDKDCWDALEWDDPNTKSLLALVRGYWWS
**KERKRYVLILDDVWKRFSLDEVGIPEPTVDNGCKLVLTTRLKEVARSMGCEVIPVDLLSEDEALRLFSKHVGDYLLRIPTIEPILKQVVEQCAGLPLAIVTVASSMKSEDDVDLWKNALNELKENSTSVEGMGDEVIPRLKFSYDRLMDPKIKRCFLYCALFPEDFDIPKEELIEYWIVEGLIDVMETRQAMHYKGLAILHKLKENCLLESAEDGKCVKMHDLVREMALDITTGSPRYLVEAGKFGALLLEEEWKDDVEKVSLMRCRITRIPSNFPSSGCRSLSTLLLQHNYIEEIPEFFFEHLTGLKILDLSGNSNLLRLPDSISGLINLTALMVHGCFRLRHVPSLAKLSALKKLDLGGTEIDVVPQGLEMLAHLTYLDLNWTRILQIPDGMLSNLSRIQHLRLDRVAFENAEDILRLMKLEIFGVRFDHLQDYHRYLSLQSRRRLSKYYFTVEKNAYTYARGEWDKYVSLVELRICENSVVLPRDIQQLHFNVCGGMRSLRDVPSLKDTTDLRECVIYRCYEMEFVFCLSSCYGILETLEYLLLQRLVDLKAIFQIAEDEVNASSLRTQTPSPPNIVFRLKRLIMSDCGKIRKLFSPELLPSLQNLEEIQVKYCGGLEEIIAASDDDEEGENNEAAGNNSIKSLALPKLRVLYLKELPNLMSICSRRSTLVCNSLETIVVLRCPEIKRLPVLLPHLVNGQPLNPRSLRIDIDKDCWDALEWDDPNTKSLLALVRGYWWS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKERKRYVLILDDVWKRFSLDEVGIPEPTVDNGCKLVLTTRLKEVARSMGCEVIPVDLLSEDEALRLFSKHVGDYLLRIPTIEPILKQVVEQCAGLPLAIVTVASxxxxxxxxxxxxxxxxxxxxxSTSVEGMGDEVIPRLKFSYDRLMDPKIKRCFLYCALFPEDFDIPKEELIEYWIVEGLIDVMETRQAMHYKGLAILHKLKENCLLESAEDGKCVKMHDLVREMALDITTGSPRYLVEAGKFGALLLEEEWKDDVEKVSLMRCRITRIPSNFPSSGCRSLSTLLLQHNYIEEIPEFFFEHLTGLKILDLSGNSNLLRLPDSISGLINLTALMVHGCFRLRHVPSLAKLSALKKLDLGGTEIDVVPQGLEMLAHLTYLDLNWTRILQIPDGMLSNLSRIQHLRLDRVAFENAEDILRLMKLEIFGVRFDHLQDYHRYLSLQSRRRLSKYYFTVEKNAYTYARGEWDKYVSLVELRICENSVVLPRDIQQLHFNVCGGMRSLRDVPSLKDTTDLRECVIYRCYEMEFVFCLSSCYGILETLEYLLLQRLVDLKAIFQIAEDEVNASSLRTQTPSPPNIVFRLKRLIMSDCGKIRKLFSPELLPSLQNLEEIQVKYCGGLEEIIAASDDDEEGENNEAAGNNSIKSLALPKLRVLYLKELPNLMSICSRRSTLVCNSLETIVVLRCPEIKRLPVLLPHLVNGQPLNPRSLRIDIDKDCWDALEWDDPNTKSLLALVRGYWWS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query744 2.2.26 [Sep-21-2011]
O81825919 Probable disease resistan yes no 0.887 0.718 0.321 7e-80
Q9T048985 Disease resistance protei no no 0.912 0.689 0.312 2e-77
Q8L3R3885 Disease resistance protei no no 0.504 0.423 0.389 2e-62
Q8RXS5888 Probable disease resistan no no 0.509 0.426 0.381 3e-62
Q9FG91848 Probable disease resistan no no 0.509 0.446 0.377 8e-62
Q42484909 Disease resistance protei no no 0.840 0.687 0.293 3e-61
Q940K0889 Probable disease resistan no no 0.475 0.398 0.375 7e-60
Q9C8T9898 Putative disease resistan no no 0.467 0.387 0.397 8e-58
Q9C8K0854 Probable disease resistan no no 0.509 0.443 0.364 2e-57
P60838894 Probable disease resistan no no 0.483 0.402 0.374 4e-57
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score =  299 bits (765), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 230/715 (32%), Positives = 376/715 (52%), Gaps = 55/715 (7%)

Query: 6   KRYVLILDDVWKRFSLDEVGIP---EPTVDNGCKLVLTTRLKEVARSMGC-EVIPVDLLS 61
           K ++LILDDVW    LD++GIP   E + D+  K+VLT+R  EV + M   E I V  L 
Sbjct: 216 KNFLLILDDVWHPIDLDQLGIPLALERSKDS--KVVLTSRRLEVCQQMMTNENIKVACLQ 273

Query: 62  EDEALRLFSKHVGDYLLRIPTIEPILKQVVEQCAGLPLAIVTVASSMKSEDDVDLWKNAL 121
           E EA  LF  +VG+ +     ++PI K V  +C GLPLAI+T+  +++ +  V++WK+ L
Sbjct: 274 EKEAWELFCHNVGE-VANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHTL 332

Query: 122 NELKENSTSVEGMGDEVIPRLKFSYDRLMDPKIKRCFLYCALFPEDFDIPKEELIEYWIV 181
           N LK ++ S++   +++   LK SYD L D  +K CFL+CALFPED+ I   ELI YW+ 
Sbjct: 333 NLLKRSAPSID-TEEKIFGTLKLSYDFLQD-NMKSCFLFCALFPEDYSIKVSELIMYWVA 390

Query: 182 EGLIDVMETRQAMHYKGLAILHKLKENCLLESAEDGKCVKMHDLVREMALDITTGSP--- 238
           EGL+D     + M  +G+ ++ +LK++CLLE  +    VKMHD+VR+ A+   +      
Sbjct: 391 EGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEGF 450

Query: 239 RYLVEAGKFGALLLEEEWKDDVEKVSLMRCRITRIPSNFPSSGCRSLSTLLLQHNYIEEI 298
             LV AG+      ++++   V++VSLM  ++ R+P+N    G  +L  LL  +++++E+
Sbjct: 451 HSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVI-EGVETLVLLLQGNSHVKEV 509

Query: 299 PEFFFEHLTGLKILDLSGNSNLLRLPDSISGLINLTALMVHGCFRLRHVPSLAKLSALKK 358
           P  F +    L+ILDLSG   +  LPDS S L +L +L++  C +LR++PSL  L  L+ 
Sbjct: 510 PNGFLQAFPNLRILDLSG-VRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQF 568

Query: 359 LDLGGTEIDVVPQGLEMLAHLTYLDLNWTRILQ-IPDGMLSNLSRIQHLRLDRVAFE--- 414
           LDL  + I  +P+GLE L+ L Y+ ++ T  LQ IP G +  LS ++ L +   A+    
Sbjct: 569 LDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSWGI 628

Query: 415 ---------NAEDILRLMKLEIFGVR-FDHLQDYHRYLSLQSRRRLSKYYFTVEKNAYTY 464
                      +++  L  L+   ++  D L   + + SL   +RL+K+ F         
Sbjct: 629 KGEEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLT--KRLTKFQFLFSPIRSVS 686

Query: 465 ARGEWDKYVSLVELRICENSVV-LPRDIQQLHFNVCGGMRSLRDVPSLKDTTDLRECVIY 523
             G  +  +++ ++ +   S+  L + +  L  N C G+  + +    K  +     V  
Sbjct: 687 PPGTGEGCLAISDVNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSF---VAM 743

Query: 524 RCYEMEFVFCLSSCYGILETLEYLLLQRLVDLKAIFQIAEDEVNASSLRTQTPSPPNIVF 583
           +   + +   LS   G    L+            + +++ D VN  S+          + 
Sbjct: 744 KALSIHYFPSLSLASGCESQLDL--------FPNLEELSLDNVNLESIGELNGFLGMRLQ 795

Query: 584 RLKRLIMSDCGKIRKLFSPELLP-SLQNLEEIQVKYCGGLEEIIAASDDDEEGENNEAAG 642
           +LK L +S C ++++LFS ++L  +L NL+EI+V  C  LEE+           N  +  
Sbjct: 796 KLKLLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELF----------NFSSVP 845

Query: 643 NNSIKSLALPKLRVLYLKELPNLMSICSRRSTLVCNSLETIVVLRCPEIKRLPVL 697
            +      LPKL V+ LK LP L S+C+ R  +V  SLE + V  C  +K LP +
Sbjct: 846 VDFCAESLLPKLTVIKLKYLPQLRSLCNDR--VVLESLEHLEVESCESLKNLPFV 898
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|Q9FG91|DRL32_ARATH Probable disease resistance protein At5g43730 OS=Arabidopsis thaliana GN=At5g43730 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8K0|DRL5_ARATH Probable disease resistance protein At1g51480 OS=Arabidopsis thaliana GN=At1g51480 PE=2 SV=2 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query744
224128410 1075 BED finger-nbs-lrr resistance protein [P 0.977 0.676 0.392 1e-120
224109372 1077 BED finger-nbs-lrr resistance protein [P 0.927 0.640 0.400 1e-120
225461744 1016 PREDICTED: probable disease resistance p 0.952 0.697 0.379 1e-119
105922577 1183 NBS-LRR type disease resistance protein 0.897 0.564 0.402 1e-117
224117250 958 nbs-lrr resistance protein [Populus tric 0.959 0.745 0.401 1e-117
224145639 1010 BED finger-nbs-lrr resistance protein [P 0.931 0.686 0.379 1e-113
224144510 1199 nbs-lrr resistance protein [Populus tric 0.908 0.563 0.376 1e-112
224112395 1062 nbs-lrr resistance protein [Populus tric 0.927 0.649 0.381 1e-112
224115986 1093 BED finger-nbs-lrr resistance protein [P 0.908 0.618 0.386 1e-111
224128424 954 BED finger-nbs-lrr resistance protein [P 0.954 0.744 0.383 1e-110
>gi|224128410|ref|XP_002329155.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222869824|gb|EEF06955.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  440 bits (1131), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 301/767 (39%), Positives = 448/767 (58%), Gaps = 40/767 (5%)

Query: 2    LKERKRYVLILDDVWKRFSLDEVGIPEPTVDNGCKLVLTTRLKEVARSMGCE-VIPVDLL 60
            L  + + VLILDD+W  F L+ VGIP     N CKL+LT+R  EV R MGC+  I V+LL
Sbjct: 323  LVAKGKSVLILDDLWNHFLLEMVGIPVEV--NACKLILTSRSLEVCRRMGCQKSIKVELL 380

Query: 61   SEDEALRLFSKHVGDYLLRIPTIEPILKQVVEQCAGLPLAIVTVASSMKSEDDVDLWKNA 120
            +++EA  LF + +G+Y    P +  I K V  +CA LPL I+ +A SM+  +D+  W+NA
Sbjct: 381  TKEEAWTLFVEKLGNYADLSPEVADIAKSVAAECACLPLGIIAMAGSMREVNDLYEWRNA 440

Query: 121  LNELKENSTSVEGMGDEVIPRLKFSYDRLMDPKIKRCFLYCALFPEDFDIPKEELIEYWI 180
            L ELK++   VE M  EV   L+FSY  L D  +++C LYCA FPEDF + +E+LI Y I
Sbjct: 441  LTELKQSEVGVEDMEPEVFHILRFSYMHLNDSALQQCLLYCAFFPEDFTVDREDLIGYLI 500

Query: 181  VEGLIDVMETRQAMHYKGLAILHKLKENCLLE---SAEDGKCVKMHDLVREMALD-ITTG 236
             EG+I  M++RQA + +G A+L+KL+  CLLE   S ED +C KMHDL+R+MAL  +   
Sbjct: 501  DEGIIQPMKSRQAEYDRGQAMLNKLENACLLESYISKEDYRCFKMHDLIRDMALQKLREK 560

Query: 237  SPRYLVEAGKFGALLLEEEWKDDVEKVSLMRCRITRIPSNFPSSGCRSLSTLLLQHNY-I 295
            SP  +    +   L  E+EWK DV +VSLM+  +  IPS   S  C  LSTL L  N+ +
Sbjct: 561  SPIMVEVEEQLKELPDEDEWKVDVMRVSLMKNHLKEIPSGC-SPMCPKLSTLFLFSNFKL 619

Query: 296  EEIPEFFFEHLTGLKILDLSGNSNLLRLPDSISGLINLTALMVHGCFRLRHVPSLAKLSA 355
            E I + FF+HL GLK+LDLS  + +  LP S S L+NLTAL +  C  LR++PSLAKL  
Sbjct: 620  EMIADSFFKHLQGLKVLDLSATA-IRELPSSFSDLVNLTALYLRRCHNLRYIPSLAKLRG 678

Query: 356  LKKLDLGGTEIDVVPQGLEMLAHLTYLDLNWTRILQIPDGMLSNLSRIQHLRLDRVA--F 413
            L+KLDL  T ++ +PQG+EML++L YL+L    + ++P G+L  LS++Q L  +R +  F
Sbjct: 679  LRKLDLRYTALEELPQGMEMLSNLRYLNLFGNSLKEMPAGILPKLSQLQFLNANRASGIF 738

Query: 414  EN--AEDILRLMKLEIFGVRFDHLQDYHRYL-SLQSRRRLSKYYFTV-------EKNAYT 463
            +    E++  L ++E    +F  L D+ +YL S + R+ L+ Y+FT+       E ++  
Sbjct: 739  KTVRVEEVACLNRMETLRYQFCDLVDFKKYLKSPEVRQYLTTYFFTIGQLGVDREMDSLL 798

Query: 464  YARGE--WDKYVSLVELRICENS--VVLPRDIQQLHFNVCGGMRSLRDVPSLKDTTDLRE 519
            Y   E  + K V + + +I E    + LP D+       C   RSL DV   K  T L+ 
Sbjct: 799  YMTPEEVFYKEVLVHDCQIGEKGRFLELPEDVSSFSIGRCHDARSLCDVSPFKHATSLKS 858

Query: 520  CVIYRCYEMEFVFCLS-SCYGILETLEYLLLQRLVDLKAIFQIAEDEVNASSLRTQTPSP 578
              ++ C  +E +  +S S   I E+LE L L+ L +   +F   E     S     T S 
Sbjct: 859  LGMWECDGIECLASMSESSTDIFESLESLYLKTLKNF-CVFITREGAAPPSWQSNGTFS- 916

Query: 579  PNIVFRLKRLIMSDCGKIRKLFSPELLPSLQNLEEIQVKYCGGLEEIIAASDDDEEGENN 638
                  LK++ + +C  ++ LFS +LLP+L NLE I+V  C  +EEIIA  D++E     
Sbjct: 917  -----HLKKVTIGECPSMKNLFSLDLLPNLTNLEVIEVDDCDQMEEIIAIEDEEEGMMVE 971

Query: 639  EAAGNNSIKSLALPKLRVLYLKELPNLMSICSRRSTLVCNSLETIVVLRCPEIKRLPVLL 698
            +++ ++     +LP L+VL L  LP L SI      ++C+SL+ I+V+ CP +KR+ +  
Sbjct: 972  DSSSSSHYAVTSLPNLKVLKLSNLPELKSIF--HGEVICDSLQEIIVVNCPNLKRISLSH 1029

Query: 699  PHLVNGQ-PLNPRSLRIDIDKDCWDALEWDDPNTKSLLALVRGYWWS 744
             +  NGQ PL  R ++    K+ W+++EW + N+K+ L  +  +W S
Sbjct: 1030 RNHANGQTPL--RKIQA-YPKEWWESVEWGNSNSKNALEPLCVFWES 1073

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224109372|ref|XP_002333267.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222835868|gb|EEE74289.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225461744|ref|XP_002283414.1| PREDICTED: probable disease resistance protein At4g27220-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|105922577|gb|ABF81424.1| NBS-LRR type disease resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224117250|ref|XP_002317519.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222860584|gb|EEE98131.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224145639|ref|XP_002325714.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222862589|gb|EEF00096.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224144510|ref|XP_002325315.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222862190|gb|EEE99696.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224112395|ref|XP_002332783.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222833192|gb|EEE71669.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224115986|ref|XP_002332020.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222875245|gb|EEF12376.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224128424|ref|XP_002329158.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222869827|gb|EEF06958.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query744
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.544 0.440 0.373 1.7e-80
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.538 0.407 0.368 4.6e-73
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.438 0.367 0.411 5.7e-73
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.439 0.365 0.395 8.5e-73
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.455 0.377 0.395 1.4e-72
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.436 0.426 0.392 2.9e-71
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.436 0.365 0.397 4.1e-69
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.440 0.371 0.408 2.1e-68
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.438 0.365 0.405 2.5e-66
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.547 0.452 0.354 8.6e-64
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 665 (239.2 bits), Expect = 1.7e-80, Sum P(3) = 1.7e-80
 Identities = 157/420 (37%), Positives = 247/420 (58%)

Query:     2 LKERKRYVLILDDVWKRFSLDEVGIP---EPTVDNGCKLVLTTRLKEVARSMGC-EVIPV 57
             L + K ++LILDDVW    LD++GIP   E + D+  K+VLT+R  EV + M   E I V
Sbjct:   212 LIDLKNFLLILDDVWHPIDLDQLGIPLALERSKDS--KVVLTSRRLEVCQQMMTNENIKV 269

Query:    58 DLLSEDEALRLFSKHVGDYLLRIPTIEPILKQVVEQCAGLPLAIVTVASSMKSEDDVDLW 117
               L E EA  LF  +VG+ +     ++PI K V  +C GLPLAI+T+  +++ +  V++W
Sbjct:   270 ACLQEKEAWELFCHNVGE-VANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVW 328

Query:   118 KNALNELKENSTSVEGMGDEVIPRLKFSYDRLMDPKIKRCFLYCALFPEDFDIPKEELIE 177
             K+ LN LK ++ S++   +++   LK SYD L D  +K CFL+CALFPED+ I   ELI 
Sbjct:   329 KHTLNLLKRSAPSID-TEEKIFGTLKLSYDFLQD-NMKSCFLFCALFPEDYSIKVSELIM 386

Query:   178 YWIVEGLIDVMETRQAMHYKGLAILHKLKENCLLESAEDGKCVKMHDLVREMALDITTGS 237
             YW+ EGL+D     + M  +G+ ++ +LK++CLLE  +    VKMHD+VR+ A+   +  
Sbjct:   387 YWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQ 446

Query:   238 PR---YLVEAGKFGALLLEEEWKDDVEKVSLMRCRITRIPSNFPSSGCRSLSTLLLQHNY 294
                   LV AG+      ++++   V++VSLM  ++ R+P+N    G  +L  LL  +++
Sbjct:   447 GEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNV-IEGVETLVLLLQGNSH 505

Query:   295 IEEIPEFFFEHLTGLKILDLSGNSNLLRLPDSISGLINLTALMVHGCFRLRHVPXXXXXX 354
             ++E+P  F +    L+ILDLSG   +  LPDS S L +L +L++  C +LR++P      
Sbjct:   506 VKEVPNGFLQAFPNLRILDLSG-VRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLV 564

Query:   355 XXXXXDLGGTEIDVVPQGLEMLAHLTYLDLNWTRILQ-IPDGMLSNLSRIQHLRLDRVAF 413
                  DL  + I  +P+GLE L+ L Y+ ++ T  LQ IP G +  LS ++ L +   A+
Sbjct:   565 KLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAY 624
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query744
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 3e-54
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-06
PLN032101153 PLN03210, PLN03210, Resistant to P 5e-05
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
PLN032101153 PLN03210, PLN03210, Resistant to P 0.001
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  188 bits (479), Expect = 3e-54
 Identities = 74/185 (40%), Positives = 115/185 (62%), Gaps = 5/185 (2%)

Query: 4   ERKRYVLILDDVWKRFSLDEVGIPEPTVDNGCKLVLTTRLKEVARSMG--CEVIPVDLLS 61
            RKR++L+LDDVW++   D++G+P P  +NG ++++TTR + VA  MG   +   V+ L 
Sbjct: 98  LRKRFLLVLDDVWEKNDWDKIGVPFPDGENGSRVIVTTRSESVAGRMGGTSKPHEVESLE 157

Query: 62  EDEALRLFSKHVGDY-LLRIPTIEPILKQVVEQCAGLPLAIVTVASSMKSEDDVDLWKNA 120
            +E+  LFS  V +  L   P +E + K++VE+C GLPLA+  +   +  +  V  W++ 
Sbjct: 158 PEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHV 217

Query: 121 LNELKENSTSVEGMGDEVIPRLKFSYDRLMDPKIKRCFLYCALFPEDFDIPKEELIEYWI 180
           L +L       +G+ +EV+  L  SYD L    +KRCFLY ALFPED++I KE+LI+ WI
Sbjct: 218 LEQLNNELAGRDGL-NEVLSILSLSYDNLPMH-LKRCFLYLALFPEDYNIRKEQLIKLWI 275

Query: 181 VEGLI 185
            EG +
Sbjct: 276 AEGFV 280

Length = 285
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 744
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.9
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.84
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.77
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.77
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.71
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.71
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.65
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.61
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.55
KOG0617264 consensus Ras suppressor protein (contains leucine 99.47
KOG0617264 consensus Ras suppressor protein (contains leucine 99.46
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.41
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.39
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.37
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.32
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.28
KOG4237498 consensus Extracellular matrix protein slit, conta 99.17
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.14
KOG4237498 consensus Extracellular matrix protein slit, conta 99.02
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.87
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.76
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.7
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.69
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.65
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.57
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.52
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.41
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.4
KOG4341483 consensus F-box protein containing LRR [General fu 98.37
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.3
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.27
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.16
KOG4341483 consensus F-box protein containing LRR [General fu 98.15
PLN03150623 hypothetical protein; Provisional 98.07
PLN03150623 hypothetical protein; Provisional 98.05
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.0
PRK04841903 transcriptional regulator MalT; Provisional 97.97
PRK15386426 type III secretion protein GogB; Provisional 97.95
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.85
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.81
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.77
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.74
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.73
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.71
PRK15386426 type III secretion protein GogB; Provisional 97.68
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.61
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.48
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.24
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.18
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.86
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.84
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 96.83
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.63
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.53
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.42
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 96.42
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.26
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.14
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.02
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.01
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 95.99
KOG2982418 consensus Uncharacterized conserved protein [Funct 95.96
PRK06893229 DNA replication initiation factor; Validated 95.72
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.56
PF05729166 NACHT: NACHT domain 95.52
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 95.43
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.98
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 94.95
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 94.88
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.35
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 94.22
KOG1947482 consensus Leucine rich repeat proteins, some prote 93.56
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.42
KOG2123388 consensus Uncharacterized conserved protein [Funct 93.32
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.74
PRK09087226 hypothetical protein; Validated 92.32
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.21
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.14
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.13
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 90.85
PRK00411394 cdc6 cell division control protein 6; Reviewed 90.51
COG3899849 Predicted ATPase [General function prediction only 88.43
PF13173128 AAA_14: AAA domain 88.07
PRK13342413 recombination factor protein RarA; Reviewed 87.65
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 87.65
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 87.59
smart0037026 LRR Leucine-rich repeats, outliers. 86.29
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.29
TIGR02928365 orc1/cdc6 family replication initiation protein. M 86.02
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 85.78
PRK07471365 DNA polymerase III subunit delta'; Validated 85.75
PRK08727233 hypothetical protein; Validated 84.36
smart0037026 LRR Leucine-rich repeats, outliers. 84.13
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.13
PRK05564313 DNA polymerase III subunit delta'; Validated 84.06
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 83.21
PRK09112351 DNA polymerase III subunit delta'; Validated 80.54
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 80.28
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=6.7e-71  Score=626.57  Aligned_cols=607  Identities=34%  Similarity=0.508  Sum_probs=429.8

Q ss_pred             cCCCceEEEEEcCCCCccccccccCCCCCCCCCcEEEEEecchhHHHh-cCC-eeEecCCCCHHHHHHHHHHHhCCC-CC
Q 004573            2 LKERKRYVLILDDVWKRFSLDEVGIPEPTVDNGCKLVLTTRLKEVARS-MGC-EVIPVDLLSEDEALRLFSKHVGDY-LL   78 (744)
Q Consensus         2 ll~~kr~LiVLDDv~~~~~~~~l~~~~~~~~~gsriivTTR~~~v~~~-~~~-~~~~l~~L~~~~~~~Lf~~~~~~~-~~   78 (744)
                      +|++|||+|||||||++.+|+.++.|+|...+||+|++|||++.|+.. +++ ..++++.|+++|||.||++.||.. ..
T Consensus       257 ~L~~krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~  336 (889)
T KOG4658|consen  257 LLEGKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLG  336 (889)
T ss_pred             HhccCceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhcccccc
Confidence            578999999999999999999999999988889999999999999998 887 899999999999999999999876 33


Q ss_pred             CCCCHHHHHHHHHHHhcCCcHHHHHHHHhhcCCCCHHHHHHHHHHHHhc-CCCCCCCccchhhhhhhhccCCCChhhhHH
Q 004573           79 RIPTIEPILKQVVEQCAGLPLAIVTVASSMKSEDDVDLWKNALNELKEN-STSVEGMGDEVIPRLKFSYDRLMDPKIKRC  157 (744)
Q Consensus        79 ~~~~~~~~~~~i~~~c~glPLai~~~~~~L~~~~~~~~w~~~l~~l~~~-~~~~~~~~~~i~~~l~~sy~~L~~~~~k~c  157 (744)
                      ..+.++++|++||++|+|+|||++++|+.|+.+.+..+|+++.+.+... .....++.+.+.++|++|||+|| +++|.|
T Consensus       337 ~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~-~~lK~C  415 (889)
T KOG4658|consen  337 SHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLP-EELKSC  415 (889)
T ss_pred             ccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhh-HHHHHH
Confidence            4456899999999999999999999999999999999999999988766 33334566889999999999999 899999


Q ss_pred             HhhccCCCCCcccChHHHHHHHHHhCccccchhhhHHHHhHHHHHHHHHHcccccccCC---CcEEechHHHHHHHHHHh
Q 004573          158 FLYCALFPEDFDIPKEELIEYWIVEGLIDVMETRQAMHYKGLAILHKLKENCLLESAED---GKCVKMHDLVREMALDIT  234 (744)
Q Consensus       158 fl~~s~fp~~~~i~~~~Li~~wiaeg~i~~~~~~~~~~~~~~~~~~~L~~~~l~~~~~~---~~~~~mHdli~~~~~~i~  234 (744)
                      |+|||+||+||.|+++.|+.+||||||+.+...+..++++|..|+.+|++++|++...+   ..+|+|||+|||+|.++|
T Consensus       416 FLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ia  495 (889)
T KOG4658|consen  416 FLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIA  495 (889)
T ss_pred             HHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHh
Confidence            99999999999999999999999999999977788899999999999999999998753   378999999999999999


Q ss_pred             c-----CCCceEEecCccccccccccccccccEEEeecccccccCCCCCCCCCCcccEEEcccCC--CCCCChhHHhcCC
Q 004573          235 T-----GSPRYLVEAGKFGALLLEEEWKDDVEKVSLMRCRITRIPSNFPSSGCRSLSTLLLQHNY--IEEIPEFFFEHLT  307 (744)
Q Consensus       235 ~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~--l~~l~~~~~~~l~  307 (744)
                      +     +++ .++..+......++......+|++++.++.+..++.   ...+++|++|.+..|.  +..++..+|..++
T Consensus       496 s~~~~~~e~-~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~---~~~~~~L~tLll~~n~~~l~~is~~ff~~m~  571 (889)
T KOG4658|consen  496 SDFGKQEEN-QIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAG---SSENPKLRTLLLQRNSDWLLEISGEFFRSLP  571 (889)
T ss_pred             ccccccccc-eEEECCcCccccccccchhheeEEEEeccchhhccC---CCCCCccceEEEeecchhhhhcCHHHHhhCc
Confidence            8     555 556655444555655555789999999999988887   3567799999999995  7889999999999


Q ss_pred             CCcEEEcCCCCCCccCCccccCcccccEEeccCcccccCCc-CccCCCCccEEEccCCC-CcccccccccCCCCCEEecc
Q 004573          308 GLKILDLSGNSNLLRLPDSISGLINLTALMVHGCFRLRHVP-SLAKLSALKKLDLGGTE-IDVVPQGLEMLAHLTYLDLN  385 (744)
Q Consensus       308 ~L~~L~l~~~~~~~~lp~~i~~l~~L~~L~l~~~~~l~~~~-~i~~l~~L~~L~l~~~~-l~~lp~~i~~L~~L~~L~l~  385 (744)
                      .|++|||++|..+.++|++|++|.|||||+++++. ++.+| ++++|+.|.+|++..+. +..+|..+..|++||+|.+.
T Consensus       572 ~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~-I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~  650 (889)
T KOG4658|consen  572 LLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTG-ISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLP  650 (889)
T ss_pred             ceEEEECCCCCccCcCChHHhhhhhhhcccccCCC-ccccchHHHHHHhhheeccccccccccccchhhhcccccEEEee
Confidence            99999999999999999999999999988888763 44444 56666666666666663 23333334446666666554


Q ss_pred             CccccccCCCccCCCCCCcEEEcCccccccchhhhcccCCcEEEeeecCCcchHHhhhhhhccccceEEEEeeccccccc
Q 004573          386 WTRILQIPDGMLSNLSRIQHLRLDRVAFENAEDILRLMKLEIFGVRFDHLQDYHRYLSLQSRRRLSKYYFTVEKNAYTYA  465 (744)
Q Consensus       386 ~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~l~~~~~~~~~~~~  465 (744)
                      ......                    ....+.++.++.+|+.+.+...............                    
T Consensus       651 ~s~~~~--------------------~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~~~~--------------------  690 (889)
T KOG4658|consen  651 RSALSN--------------------DKLLLKELENLEHLENLSITISSVLLLEDLLGMT--------------------  690 (889)
T ss_pred             cccccc--------------------chhhHHhhhcccchhhheeecchhHhHhhhhhhH--------------------
Confidence            433100                    0111133444555555544322210000000000                    


Q ss_pred             ccccccccceEEEeeccCccccccccceeeeeccCCccccccCCCCCCcCCCcEEEEeecCCcceeecC--ccccch-hh
Q 004573          466 RGEWDKYVSLVELRICENSVVLPRDIQQLHFNVCGGMRSLRDVPSLKDTTDLRECVIYRCYEMEFVFCL--SSCYGI-LE  542 (744)
Q Consensus       466 ~~~~~~~~~~~~L~~~~~~~~~p~~L~~L~l~~c~~l~~l~~~~~l~~l~~L~~L~l~~c~~l~~l~~~--~~~~~~-l~  542 (744)
                                          .+....+.+.+.+|...+.   .+++..+.+|+.|.|.+|...+.....  ...... |+
T Consensus       691 --------------------~L~~~~~~l~~~~~~~~~~---~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~~~f~  747 (889)
T KOG4658|consen  691 --------------------RLRSLLQSLSIEGCSKRTL---ISSLGSLGNLEELSILDCGISEIVIEWEESLIVLLCFP  747 (889)
T ss_pred             --------------------HHHHHhHhhhhccccccee---ecccccccCcceEEEEcCCCchhhcccccccchhhhHH
Confidence                                0001122222222221121   256788899999999999876533211  001111 55


Q ss_pred             hhHHHHhcCccchhhHhhhhhhhhccccccCCCCCCCceeEEEEEEEEecCCCcccccCCCcccCCCCccEEEEccccch
Q 004573          543 TLEYLLLQRLVDLKAIFQIAEDEVNASSLRTQTPSPPNIVFRLKRLIMSDCGKIRKLFSPELLPSLQNLEEIQVKYCGGL  622 (744)
Q Consensus       543 ~L~~L~l~~~~~L~~l~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~C~~L~~l~~~~~l~~l~~L~~L~l~~c~~l  622 (744)
                      ++..+.+.+|..++.+...                  ...++|+.|.+..|+.++...|  ....+..++++.       
T Consensus       748 ~l~~~~~~~~~~~r~l~~~------------------~f~~~L~~l~l~~~~~~e~~i~--~~k~~~~l~~~i-------  800 (889)
T KOG4658|consen  748 NLSKVSILNCHMLRDLTWL------------------LFAPHLTSLSLVSCRLLEDIIP--KLKALLELKELI-------  800 (889)
T ss_pred             HHHHHHhhccccccccchh------------------hccCcccEEEEecccccccCCC--HHHHhhhcccEE-------
Confidence            5666655555444333210                  0111555555555554444311  111122222211       


Q ss_pred             hhhhccCCCCcccccccccCCCCcccccCCcccee-cccccccccccccccceeccCccceEEeccCCCCcccCcccccc
Q 004573          623 EEIIAASDDDEEGENNEAAGNNSIKSLALPKLRVL-YLKELPNLMSICSRRSTLVCNSLETIVVLRCPEIKRLPVLLPHL  701 (744)
Q Consensus       623 ~~i~~~~~~~~~~~~~~~~~~~~~~~~~lp~L~~L-~l~~c~~L~~l~~~~~~~~~~sL~~L~i~~C~~L~~lP~~~~~L  701 (744)
                                                ..|+++..+ .+.+.+.++++...  ...++.|+.+.|..||+++++|.... +
T Consensus       801 --------------------------~~f~~~~~l~~~~~l~~l~~i~~~--~l~~~~l~~~~ve~~p~l~~~P~~~~-~  851 (889)
T KOG4658|consen  801 --------------------------LPFNKLEGLRMLCSLGGLPQLYWL--PLSFLKLEELIVEECPKLGKLPLLST-L  851 (889)
T ss_pred             --------------------------ecccccccceeeecCCCCceeEec--ccCccchhheehhcCcccccCccccc-c
Confidence                                      345566666 46666666665543  45567789999999999999987531 1


Q ss_pred             cCCCCCCCCccccccchhhhcccccCCccccccc
Q 004573          702 VNGQPLNPRSLRIDIDKDCWDALEWDDPNTKSLL  735 (744)
Q Consensus       702 ~~l~~~~~~l~~i~~~~~w~~~lew~~~~~~~~~  735 (744)
                      ..-.. .+.+ ....+.+|.++++|.+++.+..+
T Consensus       852 ~i~~~-~~~~-~~~~~~~~~~~v~~~~~~~~~~~  883 (889)
T KOG4658|consen  852 TIVGC-EEKL-KEYPDGEWLEGVYWEDELTKLRF  883 (889)
T ss_pred             ceecc-ccce-eecCCccceeeEEehhhhhhhhc
Confidence            11100 0111 22344568899999999888776

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query744
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 3e-05
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 4e-05
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 6e-05
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 6e-05
1z6t_A591 Structure Of The Apoptotic Protease-activating Fact 6e-05
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 2e-04
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 2e-04
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 3e-04
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 4e-04
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure 
Iteration: 1

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 65/144 (45%), Gaps = 10/144 (6%)
Query: 269 RITRIPSNFPSSGCRSLSTLLLQHNYIEEIPEFFFEHLTGLKILDLSGNSNLLRLPDSI- 327
           ++T IPSN P+        L LQ N +  +P   F  LT L++L L+ N  L  LP  I 
Sbjct: 27  KLTAIPSNIPAD----TKKLDLQSNKLSSLPSKAFHRLTKLRLLYLNDNK-LQTLPAGIF 81
Query: 328 SGLINLTALMVHGCFRLRHVPXXXXXXXXXXXDLG---GTEIDVVPQGLEMLAHLTYLDL 384
             L NL  L V    +L+ +P           +L         + P+  + L  LTYL L
Sbjct: 82  KELKNLETLWVTD-NKLQALPIGVFDQLVNLAELRLDRNQLKSLPPRVFDSLTKLTYLSL 140
Query: 385 NWTRILQIPDGMLSNLSRIQHLRL 408
            +  +  +P G+   L+ ++ LRL
Sbjct: 141 GYNELQSLPKGVFDKLTSLKELRL 164
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query744
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 1e-45
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 1e-45
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-38
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-25
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-24
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-23
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-22
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-19
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-19
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-16
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-18
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-16
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-18
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-14
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-06
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 7e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-16
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 7e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 8e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  171 bits (435), Expect = 1e-45
 Identities = 51/239 (21%), Positives = 97/239 (40%), Gaps = 31/239 (12%)

Query: 1   MLKERKRYVLILDDVWKRFSLDEVGIPEPTVDNGCKLVLTTRLKEVARSMGCEVIPVDL- 59
           ML++  R +LILDDVW  + L          D+ C+++LTTR K V  S+      V + 
Sbjct: 231 MLRKHPRSLLILDDVWDSWVLKAF-------DSQCQILLTTRDKSVTDSVMGPKYVVPVE 283

Query: 60  --LSEDEALRLFSKHVGDYLLRIPTIEPILKQVVEQCAGLPLAIVTVASSMKS-EDDVDL 116
             L +++ L + S  V     +   +      ++++C G PL +  + + ++   +  + 
Sbjct: 284 SSLGKEKGLEILSLFVNM---KKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEY 340

Query: 117 WKNALN--ELKENSTSVEGMGDEVIPRLKFSYDRLMDPKIKRCFLYCALFPEDFDIPKEE 174
           +   L   + K    S     + +   +  S + L    IK  +   ++  +D  +P + 
Sbjct: 341 YLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEML-REDIKDYYTDLSILQKDVKVPTKV 399

Query: 175 LIEYWIVEGLIDVMETRQAMHYKGLAILHKLKENCLLESAEDGK--CVKMHDLVREMAL 231
           L   W +E   + +E           IL +     LL    +GK     +HDL  +   
Sbjct: 400 LCILWDMET--EEVED----------ILQEFVNKSLLFCDRNGKSFRYYLHDLQVDFLT 446
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 744
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 1e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 87.6 bits (216), Expect = 1e-19
 Identities = 29/157 (18%), Positives = 56/157 (35%), Gaps = 17/157 (10%)

Query: 4   ERKRYVLILDDVWKRFSLDEVGIPEPTVDNGCKLVLTTRLKEVARSMG--CEVIPVDLLS 61
           +R   + + DDV       +        +   + ++TTR  E++ +    CE I V  L 
Sbjct: 133 DRPNTLFVFDDVV------QEETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLE 186

Query: 62  EDEALRLFSKHVGDYLLRIPTIEPILKQVVEQCAGLPLAIVTVASSMKSEDDVDLWKNAL 121
            DE       +    +      E +L + +E  +G P  ++    S + +   +      
Sbjct: 187 IDECYDFLEAYGMP-MPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTF-EKMAQLN 244

Query: 122 NELKENSTSVEGMGDEVIPRLKFSYDRLMDPKIKRCF 158
           N+L+            V     +SY  L    ++RC 
Sbjct: 245 NKLESRGL------VGVECITPYSYKSL-AMALQRCV 274
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query744
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.86
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.86
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.84
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.83
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.61
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.37
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.3
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.11
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.09
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.02
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.97
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.69
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.69
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.57
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.49
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.09
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.7
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.36
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.29
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.95
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.54
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 91.56
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 87.47
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 87.12
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 84.94
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=100.00  E-value=1.2e-33  Score=195.06  Aligned_cols=144  Identities=19%  Similarity=0.216  Sum_probs=123.9

Q ss_pred             CCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEEECCHHHHHHCCC--EEEECCCCCHHHHHHHHHHHHCCCCCCC
Q ss_conf             78962999983888864312014778999999489999164468873098--2375589998889999998837877788
Q 004573            3 KERKRYVLILDDVWKRFSLDEVGIPEPTVDNGCKLVLTTRLKEVARSMGC--EVIPVDLLSEDEALRLFSKHVGDYLLRI   80 (744)
Q Consensus         3 l~~kr~LivlDdv~~~~~~~~l~~~l~~~~~gs~iivTTR~~~v~~~~~~--~~~~l~~l~~~ea~~lf~~~a~~~~~~~   80 (744)
                      +.++|+|+||||||+.++|+.+.      ..|||||||||++.++..+..  +.|+|++|+.+|||+||+++++... ..
T Consensus       132 L~~kr~LlVLDDv~~~~~~~~~~------~~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~-~~  204 (277)
T d2a5yb3         132 IDRPNTLFVFDDVVQEETIRWAQ------ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMP-VG  204 (277)
T ss_dssp             TTSTTEEEEEEEECCHHHHHHHH------HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC---
T ss_pred             HCCCCEEEECCHHHHHHHHHHHC------CCCCEEEEEEEHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHCCCC-CC
T ss_conf             44688167525066776655520------457559999644899986378871687788997999999999847766-74


Q ss_pred             CCHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             89788999999991599479999997622899778899999998716788789851102146630059998235489846
Q 004573           81 PTIEPILKQVVEQCAGLPLAIVTVASSMKSEDDVDLWKNALNELKENSTSVEGMGDEVIPRLKFSYDRLMDPKIKRCFLY  160 (744)
Q Consensus        81 ~~~~~~~~~i~~~c~glPLal~~~g~~L~~~~~~~~w~~~~~~l~~~~~~~~~~~~~i~~~l~~sy~~L~~~~~k~~fl~  160 (744)
                      +..++++++|+++|+|+||||+++|+.|+. +++..|.+..+.+.....      ..+..++..||++|| +++|.||.+
T Consensus       205 ~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~-k~~~~~~~~~~~L~~~~~------~~v~~il~~sY~~L~-~~lk~c~~~  276 (277)
T d2a5yb3         205 EKEEDVLNKTIELSSGNPATLMMFFKSCEP-KTFEKMAQLNNKLESRGL------VGVECITPYSYKSLA-MALQRCVEV  276 (277)
T ss_dssp             CHHHHHHHHHHHHHTTCHHHHHHHHTTCCS-SSHHHHHHHHHHHHHHCS------STTCCCSSSSSSSHH-HHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHCC-CCHHHHHHHHHHHHCCCH------HHHHHHHHHHHHCCC-HHHHHHHHH
T ss_conf             256799999999958998999999998655-989999999999734867------889999999885126-999999973


Q ss_pred             C
Q ss_conf             1
Q 004573          161 C  161 (744)
Q Consensus       161 ~  161 (744)
                      +
T Consensus       277 l  277 (277)
T d2a5yb3         277 L  277 (277)
T ss_dssp             S
T ss_pred             C
T ss_conf             9
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure