Citrus Sinensis ID: 004574

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740----
MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLSNTSDGKCGA
cccccccEEEEccccccccccEEEEccccccccccEEEcccccEEEEEEEEccccccccccEEEEEEEcccccEEEccccccccccccccccEEEEcccEEEEEEccccccccccccccccccEEEcccccccccccccccccccHHHHcccccccEEEEEEccccccEEEcccccEEEEEEcccccEEEEEEEccccEEEEcccccccEEEEEcccccEEEEEcccccccccccccccccccccccEEccccccEEEEEEEccccccccccccccEEEccccccccccccEEEEcccccccEEEEcccccEEEEEEEcccccEEEEEEEccccccccEEEEEccccccccccccccEEEcccccEEEEEEEcccccEEEEEEccccccccccccEEEEEEcccccEEEEEEcccccccEEEEEEEcccccEEccccccEEEEEEEccccccEEEEEEcccccEEEcccccccccccccccEEEEEEEcccccEEEEEEEccccccccccccEEEEEEEcccccccccccccccccccccccccccccEEEEcccEEEEccccccccccccccHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccHHHHHHcccccccccccccEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHHHHHHcccccccccccc
ccccccEEEEEccccccccccEEEccccccccccccEEcccccEEEEEEEEEcccccccccEEEEEEEcccccccEEEcccccccccccccEEEEccccEEEEEEcccccccccccccccccEEEEcccccccccccHHHHHccHHHHHHHHHHHHccEEEEcccccEEEccccccEccccccccccEEEEEEEEcccccccccccccccEEEEcccccEEEEccccccHcccccccccccccccccEEccccccEEEEEEEccccccccccccccccEcccccccccccccHEEEcccccccEEEcccccEEEEEEccccccEEEEEEcccccccccEEEEcccccccccccccEEEEEcccccEEEEEEEcccccccEEEEEccccccccccEEEEEEEcccccEEEEEEEcccccEEEEEEEEcccccEEEcccccEEEEEEccccccccEEEEEccccccEEEEcccccHHHHcccccEEEEEEcccccEEEEEEEcccccccccccccEEEEEEcccccccHHHcccEEcccccccccccccHHHHHHccEEEEccccccccccccccccHHHHHHHHHHHHcccccHccEEEEcccHHHHHHHHHHHcccHHHHHEEEcccccccccccccccHccccccccHHHHHHcccHHHHHcccccEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHccccccccccc
mpfftgigihrllpddslgpekevhgypdgakinfvswspdgkriafsvrvdeednvssckLRVWIADaetgeakplfespdiclnaVFGSFvwvnnstlliftipssrrdppkktmvplgpkiqsneqKNIIISRMTdnllkdeydesLFDYYTTAQLVLGsldgtakdfgtpavytavepspdqkYVLITSmhrpysykvpcarfsqKVQVWTTDGKLVRelcdlppaedipvcynSVREGMRsiswradkpstlYWVEAQdrgdanvevsprdiiytqpaepaegekpeilhkldlrfrsvswcddSLALVNETWYKtsqtrtwlvcpgskdvaprvLFDRVFenvysdpgspmmtrtstgTNVIAKIKKENDEQIYILLNgrgftpegnipfldlfdintgskerIWESNREKYFETAVALVFGqgeedinlNQLKILTSKESKTEITQYHILswplkkssqitnfphpyptlASLQKEMIKYQrkdgvpltatlylppgydqskdgplpclfwaypedykskdaagqvrgspnefsgmtptsSLIFLARRFAvlagpsipiigegdklpndsaEAAVEEVVRRgvadpsriavgghsygAFMTAHLLahaphlfccgiarsgsynktltpfgfqTEFRTLWEATNVYiemspithankikkpiliihgevddkvglfpmQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYClsntsdgkcga
MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFsvrvdeednvsscKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIftipssrrdppkktmvplgpkiqsneqkniIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAvytavepspdQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRelcdlppaedipVCYNSVREGMRsiswradkpstLYWVEAQDrgdanvevspRDIIytqpaepaegekpeILHKLDLRFRSVSWCDDSLALVNETWyktsqtrtwlvcpgskdVAPRVLFDRVFENvysdpgspmmtrtsTGTNVIAKIKKENDEQIYILLNGrgftpegniPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPiigegdklpnDSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLsntsdgkcga
MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDSaeaaveevvRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLSNTSDGKCGA
***FTGIGIHRLLP*********VHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTI*************************NIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIY*************ILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYS*************TNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDY***********************SLIFLARRFAVLAGPSIPIIGEG***********VEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLS*********
*PFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIP****************KIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKY************
MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLSN********
*PFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLSN********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLSNTSDGKCGA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query744 2.2.26 [Sep-21-2011]
Q8VZF3960 Probable glutamyl endopep yes no 0.990 0.767 0.708 0.0
Q10MJ1938 Probable glutamyl endopep yes no 0.989 0.784 0.703 0.0
P39839657 Uncharacterized peptidase yes no 0.282 0.319 0.270 5e-10
P34422740 Dipeptidyl peptidase fami yes no 0.202 0.204 0.291 9e-09
P13676732 Acylamino-acid-releasing yes no 0.200 0.203 0.275 5e-08
Q8R146732 Acylamino-acid-releasing yes no 0.201 0.204 0.246 9e-08
P80227730 Acylamino-acid-releasing yes no 0.189 0.193 0.290 4e-07
P14740767 Dipeptidyl peptidase 4 OS no no 0.326 0.316 0.266 9e-07
P19205732 Acylamino-acid-releasing yes no 0.176 0.178 0.261 1e-06
P28843760 Dipeptidyl peptidase 4 OS no no 0.327 0.321 0.267 3e-06
>sp|Q8VZF3|CGEP_ARATH Probable glutamyl endopeptidase, chloroplastic OS=Arabidopsis thaliana GN=GEP PE=2 SV=2 Back     alignment and function desciption
 Score = 1122 bits (2902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/748 (70%), Positives = 623/748 (83%), Gaps = 11/748 (1%)

Query: 1   MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSC 60
           M F+TG+GIH+LLPD +L PEKE+ G PDG KINFV+WS DGK +AFS+RVDE  N  S 
Sbjct: 174 MSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAFSIRVDENGN--SS 231

Query: 61  KLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPL 120
           K  VW+AD ETG A+PLF S DI LNA+F SFVW++NSTLL+ TIPSSR +PPKK +VP 
Sbjct: 232 KPVVWVADVETGVARPLFNSQDIFLNAIFESFVWIDNSTLLVSTIPSSRGEPPKKPLVPS 291

Query: 121 GPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAV 180
           GPK  SNE K ++  R   +LLKDEYD  LFDYY ++QLVL SLDGT K+ G PAVYT++
Sbjct: 292 GPKTLSNETKTVVQVRTFQDLLKDEYDADLFDYYASSQLVLASLDGTVKEVGVPAVYTSL 351

Query: 181 EPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSV 240
           +PS D KY+L++S+HRPYS+ VPC RF +KV+VWTTDG+ VR+LCDLP AEDIP+  NSV
Sbjct: 352 DPSTDHKYLLVSSLHRPYSFIVPCGRFPKKVEVWTTDGRFVRQLCDLPLAEDIPIASNSV 411

Query: 241 REGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLR 300
           R+GMRSI+WRADKPSTL W E QD GDA +EVSPRDI+Y Q AEP  GE+PE+LHKLDLR
Sbjct: 412 RKGMRSINWRADKPSTL-WAETQDGGDAKMEVSPRDIVYMQSAEPLAGEEPEVLHKLDLR 470

Query: 301 FRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTR 360
           +  +SWCDD+LALV E+WYKT +TRTW++ PGS DV+PR+LFDR  E+VYSDPGS M+ R
Sbjct: 471 YGGISWCDDTLALVYESWYKTRRTRTWVISPGSNDVSPRILFDRSSEDVYSDPGSTMLRR 530

Query: 361 TSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFE 420
           T  GT VIAKIKKENDE  Y+LLNG G TP+GN+PFLDLFDINTG+KERIWES++EKYFE
Sbjct: 531 TDAGTYVIAKIKKENDEGTYVLLNGSGATPQGNVPFLDLFDINTGNKERIWESDKEKYFE 590

Query: 421 TAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASL 480
           T VAL+  Q E D+ + +LKILTSKESKTE TQY +  WP +K  QITNFPHPYP LASL
Sbjct: 591 TVVALMSDQKEGDLKMEELKILTSKESKTENTQYSLQLWPDRKVQQITNFPHPYPQLASL 650

Query: 481 QKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEF 540
           QKEMI+YQRKDGV LTATLYLPPGYD SKDGPLPCLFW+YP ++KSKDAAGQVRGSPNEF
Sbjct: 651 QKEMIRYQRKDGVQLTATLYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEF 710

Query: 541 SGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPND--------SAEAAVEEVVRRGVAD 592
           +G+  TS+L++LARRFA+L+GP+IPIIGEGD+  ND        SAEAAVEEVVRRGVAD
Sbjct: 711 AGIGSTSALLWLARRFAILSGPTIPIIGEGDEEANDRYVEQLVASAEAAVEEVVRRGVAD 770

Query: 593 PSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVY 652
            S+IAVGGHSYGAFMTA+LLAHAPHLF CGIARSG+YN+TLTPFGFQ E RTLWEATNVY
Sbjct: 771 RSKIAVGGHSYGAFMTANLLAHAPHLFACGIARSGAYNRTLTPFGFQNEDRTLWEATNVY 830

Query: 653 IEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVY 712
           +EMSP   ANKIKKPIL+IHGE D+  G   MQ++RFF+ALKGHGAL RLV+LP E H Y
Sbjct: 831 VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVVLPHESHGY 890

Query: 713 AARENVMHVIWETDRWLQKYCLSNTSDG 740
           +ARE++MHV+WETDRWLQKYC+ NTSD 
Sbjct: 891 SARESIMHVLWETDRWLQKYCVPNTSDA 918
Serine-type protease active in vitro against the LHCII N-terminal. Cleaves its substrate on the carboxy-side of Glu residues.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: -
>sp|Q10MJ1|CGEP_ORYSJ Probable glutamyl endopeptidase, chloroplastic OS=Oryza sativa subsp. japonica GN=GEP PE=2 SV=1 Back     alignment and function description
>sp|P39839|YUXL_BACSU Uncharacterized peptidase YuxL OS=Bacillus subtilis (strain 168) GN=yuxL PE=3 SV=3 Back     alignment and function description
>sp|P34422|DPF6_CAEEL Dipeptidyl peptidase family member 6 OS=Caenorhabditis elegans GN=dpf-6 PE=3 SV=2 Back     alignment and function description
>sp|P13676|ACPH_RAT Acylamino-acid-releasing enzyme OS=Rattus norvegicus GN=Apeh PE=1 SV=1 Back     alignment and function description
>sp|Q8R146|APEH_MOUSE Acylamino-acid-releasing enzyme OS=Mus musculus GN=Apeh PE=2 SV=3 Back     alignment and function description
>sp|P80227|ACPH_BOVIN Acylamino-acid-releasing enzyme OS=Bos taurus GN=APEH PE=1 SV=2 Back     alignment and function description
>sp|P14740|DPP4_RAT Dipeptidyl peptidase 4 OS=Rattus norvegicus GN=Dpp4 PE=1 SV=2 Back     alignment and function description
>sp|P19205|ACPH_PIG Acylamino-acid-releasing enzyme OS=Sus scrofa GN=APEH PE=1 SV=2 Back     alignment and function description
>sp|P28843|DPP4_MOUSE Dipeptidyl peptidase 4 OS=Mus musculus GN=Dpp4 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query744
297743980 913 unnamed protein product [Vitis vinifera] 0.991 0.808 0.732 0.0
359479944 961 PREDICTED: probable glutamyl endopeptida 0.990 0.766 0.730 0.0
224130988 967 predicted protein [Populus trichocarpa] 0.993 0.764 0.726 0.0
449436423 970 PREDICTED: probable glutamyl endopeptida 0.991 0.760 0.721 0.0
449436421 971 PREDICTED: probable glutamyl endopeptida 0.991 0.760 0.721 0.0
357511363 962 Acylamino-acid-releasing enzyme [Medicag 0.993 0.768 0.712 0.0
224064539 905 predicted protein [Populus trichocarpa] 0.987 0.812 0.721 0.0
30690669 961 prolyl oligopeptidase-like protein [Arab 0.991 0.767 0.709 0.0
297828471 962 serine-type peptidase [Arabidopsis lyrat 0.991 0.767 0.708 0.0
332278170 960 RecName: Full=Probable glutamyl endopept 0.990 0.767 0.708 0.0
>gi|297743980|emb|CBI36950.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1169 bits (3025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/747 (73%), Positives = 647/747 (86%), Gaps = 9/747 (1%)

Query: 1   MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSC 60
           M F+T IGIH+L+PD +LGPEKEVHG+PDGAKINFVSWS +G+ ++FS+RVDEE+N SS 
Sbjct: 109 MSFYTSIGIHQLMPDGTLGPEKEVHGFPDGAKINFVSWSLNGQHLSFSIRVDEEEN-SSS 167

Query: 61  KLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPL 120
           KLR+W+AD ETG+A+PLF+SPDI LNAVF +FVWV++STLL+ TIP SR DPPKK +VP 
Sbjct: 168 KLRIWVADVETGKARPLFQSPDIHLNAVFDNFVWVDDSTLLVCTIPLSRGDPPKKPLVPS 227

Query: 121 GPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAV 180
           GPK+QSNEQKN++  R   +LLKDEYD  LFDYY T QLVL SLDGT K+ G PAVYT++
Sbjct: 228 GPKVQSNEQKNVVQVRTFQDLLKDEYDADLFDYYATTQLVLASLDGTMKEIGPPAVYTSM 287

Query: 181 EPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSV 240
           +PSPDQKY+LI+S+HRPYS+ VPC RF +KV +WT++GK VRELCDLP AEDIP+ +NSV
Sbjct: 288 DPSPDQKYLLISSIHRPYSFIVPCGRFPKKVDLWTSEGKFVRELCDLPLAEDIPIAFNSV 347

Query: 241 REGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLR 300
           R+GMRSI+WRADKPSTLYWVE QD GDA VEVSPRDI+Y QPAEP +GE+  ILHKLDLR
Sbjct: 348 RKGMRSINWRADKPSTLYWVETQDEGDAKVEVSPRDIVYMQPAEPLDGEQQAILHKLDLR 407

Query: 301 FRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTR 360
           +  +SWCDDSLALV E+WYKT +TRTW++ PGS+DV+PR+LFDR  E+VYSDPGSPM+ R
Sbjct: 408 YGGISWCDDSLALVYESWYKTRRTRTWVISPGSEDVSPRILFDRSSEDVYSDPGSPMLRR 467

Query: 361 TSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFE 420
           T+ GT VIAKIKKENDE  YILLNG G TPEGNIPFLDLFDINTGSKERIWES++EKY+E
Sbjct: 468 TTAGTYVIAKIKKENDEGTYILLNGSGATPEGNIPFLDLFDINTGSKERIWESDKEKYYE 527

Query: 421 TAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASL 480
           T VAL+  Q E D+ LNQLKILTSKESKTE TQY I SW  KK+ QITNFPHPYP LASL
Sbjct: 528 TVVALMSDQSEGDLYLNQLKILTSKESKTENTQYFIQSWLDKKACQITNFPHPYPQLASL 587

Query: 481 QKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEF 540
           QKEMI+Y+RKDGV LTATLYLPPGYD SKDGPLPCL W+YP ++KSKDAAGQVRGSPNEF
Sbjct: 588 QKEMIRYERKDGVQLTATLYLPPGYDPSKDGPLPCLVWSYPGEFKSKDAAGQVRGSPNEF 647

Query: 541 SGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPND--------SAEAAVEEVVRRGVAD 592
           +G+ PTS+L++LARRFA+L+GP+IPIIGEG++  ND        SAEAAVEEV+RRGVA 
Sbjct: 648 AGIGPTSALLWLARRFAILSGPTIPIIGEGNEEANDRYVEQLVASAEAAVEEVIRRGVAH 707

Query: 593 PSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVY 652
           P++IAVGGHSYGAFMTA+LLAHAPHLFCCGIARSG+YN+TLTPFGFQ E RTLWEAT+ Y
Sbjct: 708 PNKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATDTY 767

Query: 653 IEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVY 712
           +EMSP   ANKIK+P+L+IHGE D+  G   MQ++RFF+ALKGHGAL RLV+LPFE H Y
Sbjct: 768 VEMSPFMSANKIKRPVLLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY 827

Query: 713 AARENVMHVIWETDRWLQKYCLSNTSD 739
           AARE++MHV+WETDRWLQK+C+SNT++
Sbjct: 828 AARESIMHVLWETDRWLQKHCVSNTTN 854

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359479944|ref|XP_002270510.2| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224130988|ref|XP_002320974.1| predicted protein [Populus trichocarpa] gi|222861747|gb|EEE99289.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449436423|ref|XP_004135992.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like isoform 2 [Cucumis sativus] gi|449507837|ref|XP_004163143.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449436421|ref|XP_004135991.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like isoform 1 [Cucumis sativus] gi|449507834|ref|XP_004163142.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357511363|ref|XP_003625970.1| Acylamino-acid-releasing enzyme [Medicago truncatula] gi|355500985|gb|AES82188.1| Acylamino-acid-releasing enzyme [Medicago truncatula] Back     alignment and taxonomy information
>gi|224064539|ref|XP_002301512.1| predicted protein [Populus trichocarpa] gi|222843238|gb|EEE80785.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|30690669|ref|NP_850473.1| prolyl oligopeptidase-like protein [Arabidopsis thaliana] gi|330255741|gb|AEC10835.1| prolyl oligopeptidase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297828471|ref|XP_002882118.1| serine-type peptidase [Arabidopsis lyrata subsp. lyrata] gi|297327957|gb|EFH58377.1| serine-type peptidase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|332278170|sp|Q8VZF3.2|CGEP_ARATH RecName: Full=Probable glutamyl endopeptidase, chloroplastic; Flags: Precursor Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query744
UNIPROTKB|Q8EHB8801 SO_1310 "Serine peptidase S9 f 0.841 0.781 0.338 4.8e-94
TIGR_CMR|SO_1310801 SO_1310 "conserved hypothetica 0.841 0.781 0.338 4.8e-94
TIGR_CMR|SO_4618645 SO_4618 "prolyl oligopeptidase 0.266 0.306 0.253 1.4e-10
TIGR_CMR|SO_4537675 SO_4537 "peptidase, putative" 0.184 0.202 0.267 2.6e-09
UNIPROTKB|Q47UC7693 CPS_4957 "Putative uncharacter 0.440 0.473 0.217 9.9e-08
TIGR_CMR|CPS_4957693 CPS_4957 "conserved hypothetic 0.440 0.473 0.217 9.9e-08
TAIR|locus:2129920764 AARE "acylamino acid-releasing 0.192 0.187 0.3 2e-07
TAIR|locus:2169789746 AT5G24260 [Arabidopsis thalian 0.178 0.178 0.277 3.1e-07
UNIPROTKB|Q0C2V8770 HNE_1217 "Dipeptidyl aminopept 0.342 0.331 0.252 0.00012
MGI|MGI:94919760 Dpp4 "dipeptidylpeptidase 4" [ 0.303 0.297 0.258 0.00017
UNIPROTKB|Q8EHB8 SO_1310 "Serine peptidase S9 family" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
 Score = 936 (334.5 bits), Expect = 4.8e-94, P = 4.8e-94
 Identities = 222/656 (33%), Positives = 345/656 (52%)

Query:    85 LNAVFG-SFVWVNNSTLLI-FTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLL 142
             LN      + W NN TLL  F I  ++     +  V + PK +    KN    R   +LL
Sbjct:   160 LNGTISLDYQWANNKTLLARFVI--AQDISASQPHVSISPKTKETSGKNSP-QRTYQDLL 216

Query:   143 KDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKV 202
             K   D+ LF   TT+QL L  L+G     G P +      SPD +Y+L   +  P+S +V
Sbjct:   217 KTSADKQLFSRLTTSQLALVDLEGKLTKIGAPGIIEDFSVSPDGQYILSRQITTPFSTQV 276

Query:   203 PCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEA 262
                 F    +++  +G+L+  L      E  P   +SV  G R   W   + +TL + +A
Sbjct:   277 KYDDFPTLTEIYNLNGQLITLLHQSQGGESRPQGKDSVLPGPRMFHWVQGQAATLAFTKA 336

Query:   263 QDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTS 322
              D+GD+  +   RD ++    +P   ++   + +   R   + W ++ LAL+ E   K  
Sbjct:   337 LDQGDSQRDAPQRDSLWL--LDPPFTQQATRVAQTQWRITDIDWAENHLALITERNSKAQ 394

Query:   323 QTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYIL 382
             Q R   +     + +   L +R   + Y D G         G   +  ++ +  +   ++
Sbjct:   395 QIRLSSLNTRLGESSLHTLNERNLRDKYQDLGL-FAKHYYPGKGQVVSLQ-QGAKTTGLI 452

Query:   383 LNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKIL 442
               G+G TP+G+ PFL    + T     +W+S   +    +V  V       +NL+ L+++
Sbjct:   453 HYGQGATPQGDKPFLKRTSLITSESSLLWQSASNRL--ESVRYV-------LNLDPLQLI 503

Query:   443 TSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLP 502
              ++ES TE     +L+    K S +   P        +QK++I ++R DGVPL+ TLYLP
Sbjct:   504 INRESPTESPSLVLLN--AAKESVLYEQPDGLSAYLGMQKQLITFKRADGVPLSGTLYLP 561

Query:   503 PGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGP 562
               Y + + G LP L WAYP ++   + AGQ+  S N++  ++P   +  +A  FAV    
Sbjct:   562 ANYTKEQ-GTLPVLMWAYPREFNDPEVAGQISFSANQYPTISPRGPIPLVAEGFAVFDKV 620

Query:   563 SIPIIGEGDKLPNDSXXXXXXXXXRR--------GVADPSRIAVGGHSYGAFMTAHLLAH 614
             S+PII +GDK  ND+         +         G+AD  +IAVGGHSYGAFM A+LLAH
Sbjct:   621 SMPIIAQGDKESNDTFREQLTANAQAAIDTLVDLGIADRKQIAVGGHSYGAFMVANLLAH 680

Query:   615 APHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGE 674
                LF  GIARSG+YN++LTPFGFQ E RT W+A ++Y +MSP  +A+KIK P+L+IHGE
Sbjct:   681 TD-LFYAGIARSGAYNRSLTPFGFQNEERTYWQANDIYQQMSPFNYADKIKSPLLLIHGE 739

Query:   675 VDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQ 730
             +D   G FP+Q+ER FDA++G G  +RLV+LPFE H Y A+E++ H+++E  ++L+
Sbjct:   740 MDQNSGTFPLQSERLFDAIQGLGGKARLVILPFEGHSYTAKESLEHLLFEQSQFLK 795
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TIGR_CMR|SO_1310 SO_1310 "conserved hypothetical protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4618 SO_4618 "prolyl oligopeptidase family protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4537 SO_4537 "peptidase, putative" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q47UC7 CPS_4957 "Putative uncharacterized protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4957 CPS_4957 "conserved hypothetical protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TAIR|locus:2129920 AARE "acylamino acid-releasing enzyme" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169789 AT5G24260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0C2V8 HNE_1217 "Dipeptidyl aminopeptidase IV" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
MGI|MGI:94919 Dpp4 "dipeptidylpeptidase 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q10MJ1CGEP_ORYSJ3, ., 4, ., 2, 1, ., -0.70370.98920.7846yesno
Q8VZF3CGEP_ARATH3, ., 4, ., 2, 1, ., -0.70850.99050.7677yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query744
COG1506620 COG1506, DAP2, Dipeptidyl aminopeptidases/acylamin 2e-42
pfam00326212 pfam00326, Peptidase_S9, Prolyl oligopeptidase fam 3e-25
pfam12697187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 7e-10
pfam12695145 pfam12695, Abhydrolase_5, Alpha/beta hydrolase fam 1e-08
COG0412236 COG0412, COG0412, Dienelactone hydrolase and relat 3e-07
COG0400207 COG0400, COG0400, Predicted esterase [General func 8e-07
COG0657312 COG0657, Aes, Esterase/lipase [Lipid metabolism] 4e-05
COG1073299 COG1073, COG1073, Hydrolases of the alpha/beta sup 3e-04
PRK10566249 PRK10566, PRK10566, esterase; Provisional 4e-04
COG4099387 COG4099, COG4099, Predicted peptidase [General fun 6e-04
pfam02129265 pfam02129, Peptidase_S15, X-Pro dipeptidyl-peptida 0.002
>gnl|CDD|224423 COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information 
 Score =  163 bits (414), Expect = 2e-42
 Identities = 89/324 (27%), Positives = 139/324 (42%), Gaps = 44/324 (13%)

Query: 432 EDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASL-QKEMIKYQRK 490
              +++  K+  +  S TE     I  +   + +++T+  +       L + E + Y+  
Sbjct: 316 PGFDVDGRKLALAYSSPTE--PPEIYLYDRGEEAKLTSSNNSGLKKVKLAEPEPVTYKSN 373

Query: 491 DGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLI 550
           DG  +   LY PPG+D  K  PL  + + +              G P+   G +    + 
Sbjct: 374 DGETIHGWLYKPPGFDPRKKYPL--IVYIH--------------GGPSAQVGYSFNPEIQ 417

Query: 551 FLARR-FAVLA-------GPSIP----IIGE-GDKLPNDSAEAAVEEVVRRGVADPSRIA 597
            LA   +AVLA       G        I G+ G     D   AAV+ +V+  + DP RI 
Sbjct: 418 VLASAGYAVLAPNYRGSTGYGREFADAIRGDWGGVDLED-LIAAVDALVKLPLVDPERIG 476

Query: 598 VGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEAT-------- 649
           + G SYG +MT       P  F   +A +G  +  L         R   E          
Sbjct: 477 ITGGSYGGYMTLLAATKTP-RFKAAVAVAGGVDWLLYFGESTEGLRFDPEENGGGPPEDR 535

Query: 650 NVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEH 709
             Y + SPI +A+ IK P+L+IHGE DD+V +   QAE+  DALK  G    LV+ P E 
Sbjct: 536 EKYEDRSPIFYADNIKTPLLLIHGEEDDRVPIE--QAEQLVDALKRKGKPVELVVFPDEG 593

Query: 710 HVYAARENVMHVIWETDRWLQKYC 733
           H ++  EN + V+ E   W +++ 
Sbjct: 594 HGFSRPENRVKVLKEILDWFKRHL 617

Length = 620
>gnl|CDD|215859 pfam00326, Peptidase_S9, Prolyl oligopeptidase family Back     alignment and domain information
>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|221718 pfam12695, Abhydrolase_5, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|223489 COG0412, COG0412, Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|223477 COG0400, COG0400, Predicted esterase [General function prediction only] Back     alignment and domain information
>gnl|CDD|223730 COG0657, Aes, Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223999 COG1073, COG1073, Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|182555 PRK10566, PRK10566, esterase; Provisional Back     alignment and domain information
>gnl|CDD|226584 COG4099, COG4099, Predicted peptidase [General function prediction only] Back     alignment and domain information
>gnl|CDD|216890 pfam02129, Peptidase_S15, X-Pro dipeptidyl-peptidase (S15 family) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 744
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 100.0
PRK10115686 protease 2; Provisional 100.0
COG1770682 PtrB Protease II [Amino acid transport and metabol 99.97
KOG2281867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 99.97
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 99.97
PRK01029428 tolB translocation protein TolB; Provisional 99.94
PRK01029428 tolB translocation protein TolB; Provisional 99.94
PRK03629429 tolB translocation protein TolB; Provisional 99.93
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 99.93
PRK05137435 tolB translocation protein TolB; Provisional 99.93
PRK03629429 tolB translocation protein TolB; Provisional 99.93
PRK04043419 tolB translocation protein TolB; Provisional 99.93
PRK05137435 tolB translocation protein TolB; Provisional 99.92
PRK04792448 tolB translocation protein TolB; Provisional 99.92
PRK04043419 tolB translocation protein TolB; Provisional 99.91
PRK02889427 tolB translocation protein TolB; Provisional 99.91
PRK02889427 tolB translocation protein TolB; Provisional 99.91
PRK04922433 tolB translocation protein TolB; Provisional 99.91
PRK04792448 tolB translocation protein TolB; Provisional 99.91
PRK04922433 tolB translocation protein TolB; Provisional 99.91
PRK00178430 tolB translocation protein TolB; Provisional 99.91
COG4946668 Uncharacterized protein related to the periplasmic 99.9
PRK00178430 tolB translocation protein TolB; Provisional 99.9
COG1505648 Serine proteases of the peptidase family S9A [Amin 99.89
KOG2237712 consensus Predicted serine protease [Posttranslati 99.87
PRK01742429 tolB translocation protein TolB; Provisional 99.87
PRK01742429 tolB translocation protein TolB; Provisional 99.87
KOG1455313 consensus Lysophospholipase [Lipid transport and m 99.85
PRK10566249 esterase; Provisional 99.85
PLN02298330 hydrolase, alpha/beta fold family protein 99.85
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.83
PRK05077414 frsA fermentation/respiration switch protein; Revi 99.83
PLN02385349 hydrolase; alpha/beta fold family protein 99.82
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.82
PRK13604307 luxD acyl transferase; Provisional 99.82
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 99.81
PHA02857276 monoglyceride lipase; Provisional 99.81
COG0823425 TolB Periplasmic component of the Tol biopolymer t 99.8
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 99.8
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 99.8
PLN02442283 S-formylglutathione hydrolase 99.8
PRK10162318 acetyl esterase; Provisional 99.78
COG0823425 TolB Periplasmic component of the Tol biopolymer t 99.78
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 99.78
PRK10749330 lysophospholipase L2; Provisional 99.78
COG0412236 Dienelactone hydrolase and related enzymes [Second 99.78
KOG1552258 consensus Predicted alpha/beta hydrolase [General 99.75
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 99.75
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 99.75
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 99.74
PLN02652395 hydrolase; alpha/beta fold family protein 99.74
COG1647243 Esterase/lipase [General function prediction only] 99.73
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 99.71
PRK11460232 putative hydrolase; Provisional 99.69
COG2267298 PldB Lysophospholipase [Lipid metabolism] 99.69
COG0657312 Aes Esterase/lipase [Lipid metabolism] 99.67
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 99.66
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 99.64
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 99.64
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 99.64
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 99.63
COG4099387 Predicted peptidase [General function prediction o 99.63
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 99.63
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 99.62
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 99.62
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 99.62
PLN02511388 hydrolase 99.6
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.59
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 99.59
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.59
PLN00021313 chlorophyllase 99.58
PRK00870302 haloalkane dehalogenase; Provisional 99.58
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 99.58
PRK10985324 putative hydrolase; Provisional 99.56
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.56
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 99.55
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 99.55
PF10503220 Esterase_phd: Esterase PHB depolymerase 99.54
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 99.54
PLN02824294 hydrolase, alpha/beta fold family protein 99.54
COG4946668 Uncharacterized protein related to the periplasmic 99.54
PRK11071190 esterase YqiA; Provisional 99.54
PRK10673255 acyl-CoA esterase; Provisional 99.53
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.53
PLN02965255 Probable pheophorbidase 99.53
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.53
COG0400207 Predicted esterase [General function prediction on 99.53
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.52
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.52
PRK10349256 carboxylesterase BioH; Provisional 99.52
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.52
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 99.52
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 99.51
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 99.5
PRK06489360 hypothetical protein; Provisional 99.49
PLN02679360 hydrolase, alpha/beta fold family protein 99.49
COG2945210 Predicted hydrolase of the alpha/beta superfamily 99.49
KOG0293519 consensus WD40 repeat-containing protein [Function 99.48
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.47
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.46
PRK07581339 hypothetical protein; Validated 99.46
PLN02894402 hydrolase, alpha/beta fold family protein 99.46
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.45
PRK03592295 haloalkane dehalogenase; Provisional 99.44
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.43
PRK03204286 haloalkane dehalogenase; Provisional 99.43
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 99.43
PLN02578354 hydrolase 99.42
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 99.41
PLN02872395 triacylglycerol lipase 99.41
PRK00175379 metX homoserine O-acetyltransferase; Provisional 99.41
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 99.39
PLN03084383 alpha/beta hydrolase fold protein; Provisional 99.39
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.39
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 99.38
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 99.38
KOG0315311 consensus G-protein beta subunit-like protein (con 99.37
PRK08775343 homoserine O-acetyltransferase; Provisional 99.37
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 99.36
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.36
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.35
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.35
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 99.35
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 99.34
PLN02211273 methyl indole-3-acetate methyltransferase 99.34
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.34
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 99.33
KOG3101283 consensus Esterase D [General function prediction 99.33
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.3
KOG1838409 consensus Alpha/beta hydrolase [General function p 99.28
PRK11028330 6-phosphogluconolactonase; Provisional 99.28
KOG3043242 consensus Predicted hydrolase related to dienelact 99.27
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.27
COG2936 563 Predicted acyl esterases [General function predict 99.27
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.26
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 99.26
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 99.26
KOG2984277 consensus Predicted hydrolase [General function pr 99.24
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.23
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.23
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.22
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 99.22
KOG2055514 consensus WD40 repeat protein [General function pr 99.21
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.21
PRK13616591 lipoprotein LpqB; Provisional 99.2
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 99.19
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.18
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.17
PRK11028330 6-phosphogluconolactonase; Provisional 99.16
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 99.15
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.14
KOG4667269 consensus Predicted esterase [Lipid transport and 99.14
PRK06765389 homoserine O-acetyltransferase; Provisional 99.14
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.13
KOG0266456 consensus WD40 repeat-containing protein [General 99.12
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.12
PRK05855 582 short chain dehydrogenase; Validated 99.12
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.1
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.08
PF07224307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 99.08
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 99.07
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.07
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 99.07
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.06
KOG0315311 consensus G-protein beta subunit-like protein (con 99.05
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.04
KOG0293519 consensus WD40 repeat-containing protein [Function 99.04
PRK07868 994 acyl-CoA synthetase; Validated 99.04
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.03
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.01
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 99.0
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 99.0
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 98.97
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 98.96
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 98.96
KOG2055514 consensus WD40 repeat protein [General function pr 98.95
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.94
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 98.93
PRK10115686 protease 2; Provisional 98.93
KOG2112206 consensus Lysophospholipase [Lipid transport and m 98.93
COG0627316 Predicted esterase [General function prediction on 98.92
TIGR01838 532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 98.9
KOG1407313 consensus WD40 repeat protein [Function unknown] 98.89
KOG3847399 consensus Phospholipase A2 (platelet-activating fa 98.89
KOG0263707 consensus Transcription initiation factor TFIID, s 98.88
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.87
PTZ00421493 coronin; Provisional 98.84
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.83
COG4188365 Predicted dienelactone hydrolase [General function 98.83
KOG2382315 consensus Predicted alpha/beta hydrolase [General 98.82
KOG0973 942 consensus Histone transcription regulator HIRA, WD 98.82
KOG2096420 consensus WD40 repeat protein [General function pr 98.8
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 98.79
PRK13616591 lipoprotein LpqB; Provisional 98.79
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 98.78
KOG2314698 consensus Translation initiation factor 3, subunit 98.76
KOG0772641 consensus Uncharacterized conserved protein, conta 98.76
PLN00181793 protein SPA1-RELATED; Provisional 98.74
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.74
KOG0286343 consensus G-protein beta subunit [General function 98.73
KOG2315566 consensus Predicted translation initiation factor 98.73
KOG0772641 consensus Uncharacterized conserved protein, conta 98.72
COG2819264 Predicted hydrolase of the alpha/beta superfamily 98.72
KOG2564343 consensus Predicted acetyltransferases and hydrola 98.72
KOG0266456 consensus WD40 repeat-containing protein [General 98.72
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 98.72
KOG0296399 consensus Angio-associated migratory cell protein 98.71
KOG2314698 consensus Translation initiation factor 3, subunit 98.71
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 98.68
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 98.66
KOG2624403 consensus Triglyceride lipase-cholesterol esterase 98.64
PTZ00420568 coronin; Provisional 98.63
KOG0286343 consensus G-protein beta subunit [General function 98.63
PTZ00421493 coronin; Provisional 98.6
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 98.59
KOG2315566 consensus Predicted translation initiation factor 98.58
TIGR01839 560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 98.57
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 98.56
KOG0263707 consensus Transcription initiation factor TFIID, s 98.56
KOG2139445 consensus WD40 repeat protein [General function pr 98.56
KOG0282503 consensus mRNA splicing factor [Function unknown] 98.56
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.55
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 98.53
COG3208244 GrsT Predicted thioesterase involved in non-riboso 98.53
KOG0265338 consensus U5 snRNP-specific protein-like factor an 98.51
KOG2139445 consensus WD40 repeat protein [General function pr 98.5
COG1073299 Hydrolases of the alpha/beta superfamily [General 98.5
PTZ00420568 coronin; Provisional 98.49
PRK04940180 hypothetical protein; Provisional 98.49
KOG0265338 consensus U5 snRNP-specific protein-like factor an 98.48
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 98.47
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 98.47
KOG0282503 consensus mRNA splicing factor [Function unknown] 98.46
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 98.45
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 98.44
KOG0275508 consensus Conserved WD40 repeat-containing protein 98.44
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.42
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 98.42
KOG1273405 consensus WD40 repeat protein [General function pr 98.38
KOG0645312 consensus WD40 repeat protein [General function pr 98.38
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.38
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.37
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.37
KOG2096420 consensus WD40 repeat protein [General function pr 98.36
KOG0296399 consensus Angio-associated migratory cell protein 98.35
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.35
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 98.33
PLN00181793 protein SPA1-RELATED; Provisional 98.32
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 98.3
KOG1274 933 consensus WD40 repeat protein [General function pr 98.29
PF00135 535 COesterase: Carboxylesterase family The prints ent 98.27
KOG1274 933 consensus WD40 repeat protein [General function pr 98.25
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 98.24
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 98.23
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 98.21
KOG0645312 consensus WD40 repeat protein [General function pr 98.2
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 98.19
KOG0284464 consensus Polyadenylation factor I complex, subuni 98.19
PF10142367 PhoPQ_related: PhoPQ-activated pathogenicity-relat 98.19
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 98.17
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 98.16
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.12
COG4757281 Predicted alpha/beta hydrolase [General function p 98.11
TIGR02171912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 98.11
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 98.1
KOG0275508 consensus Conserved WD40 repeat-containing protein 98.1
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.1
KOG0284464 consensus Polyadenylation factor I complex, subuni 98.09
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 98.08
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 98.08
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 98.08
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.08
KOG14451012 consensus Tumor-specific antigen (contains WD repe 98.07
KOG0639705 consensus Transducin-like enhancer of split protei 98.05
KOG0283712 consensus WD40 repeat-containing protein [Function 98.04
KOG0640430 consensus mRNA cleavage stimulating factor complex 98.02
KOG3253 784 consensus Predicted alpha/beta hydrolase [General 98.02
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 98.02
KOG1539910 consensus WD repeat protein [General function pred 97.99
COG1770682 PtrB Protease II [Amino acid transport and metabol 97.98
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 97.98
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 97.97
KOG0639705 consensus Transducin-like enhancer of split protei 97.97
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.95
KOG2106626 consensus Uncharacterized conserved protein, conta 97.95
TIGR02171912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 97.91
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.91
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 97.9
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.89
KOG1553517 consensus Predicted alpha/beta hydrolase BAT5 [Gen 97.86
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 97.85
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.82
KOG0288459 consensus WD40 repeat protein TipD [General functi 97.81
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 97.81
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 97.77
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 97.76
KOG0643327 consensus Translation initiation factor 3, subunit 97.76
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.73
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 97.73
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 97.73
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 97.71
KOG0643327 consensus Translation initiation factor 3, subunit 97.71
KOG14451012 consensus Tumor-specific antigen (contains WD repe 97.68
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 97.67
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 97.67
COG3150191 Predicted esterase [General function prediction on 97.63
PF05705240 DUF829: Eukaryotic protein of unknown function (DU 97.62
KOG0306888 consensus WD40-repeat-containing subunit of the 18 97.61
KOG4328498 consensus WD40 protein [Function unknown] 97.6
PRK02888635 nitrous-oxide reductase; Validated 97.59
KOG1063764 consensus RNA polymerase II elongator complex, sub 97.59
KOG1273405 consensus WD40 repeat protein [General function pr 97.56
COG3243 445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 97.55
KOG0295406 consensus WD40 repeat-containing protein [Function 97.51
KOG0278334 consensus Serine/threonine kinase receptor-associa 97.49
COG4814288 Uncharacterized protein with an alpha/beta hydrola 97.46
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 97.46
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 97.46
KOG0771398 consensus Prolactin regulatory element-binding pro 97.44
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 97.41
KOG0306888 consensus WD40-repeat-containing subunit of the 18 97.39
KOG4840299 consensus Predicted hydrolases or acyltransferases 97.38
KOG0310487 consensus Conserved WD40 repeat-containing protein 97.37
KOG2048691 consensus WD40 repeat protein [General function pr 97.37
COG4947227 Uncharacterized protein conserved in bacteria [Fun 97.33
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.3
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 97.29
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 97.28
KOG0771398 consensus Prolactin regulatory element-binding pro 97.27
KOG0278334 consensus Serine/threonine kinase receptor-associa 97.27
KOG0319775 consensus WD40-repeat-containing subunit of the 18 97.22
KOG0283712 consensus WD40 repeat-containing protein [Function 97.22
KOG0288459 consensus WD40 repeat protein TipD [General functi 97.2
PRK02888635 nitrous-oxide reductase; Validated 97.16
KOG2110391 consensus Uncharacterized conserved protein, conta 97.15
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.13
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 97.11
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 97.09
KOG0289506 consensus mRNA splicing factor [General function p 97.08
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 97.07
KOG0289506 consensus mRNA splicing factor [General function p 97.04
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 97.02
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 97.0
KOG0303472 consensus Actin-binding protein Coronin, contains 96.99
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.98
KOG0295406 consensus WD40 repeat-containing protein [Function 96.97
KOG0302440 consensus Ribosome Assembly protein [General funct 96.97
KOG2931326 consensus Differentiation-related gene 1 protein ( 96.91
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 96.88
KOG0647347 consensus mRNA export protein (contains WD40 repea 96.88
KOG0316307 consensus Conserved WD40 repeat-containing protein 96.86
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 96.85
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 96.83
KOG2048691 consensus WD40 repeat protein [General function pr 96.78
COG4782377 Uncharacterized protein conserved in bacteria [Fun 96.78
KOG1963 792 consensus WD40 repeat protein [General function pr 96.73
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 96.73
KOG1516 545 consensus Carboxylesterase and related proteins [G 96.72
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 96.71
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 96.69
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 96.68
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.68
KOG0313423 consensus Microtubule binding protein YTM1 (contai 96.66
KOG2110391 consensus Uncharacterized conserved protein, conta 96.65
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.62
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 96.61
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 96.61
KOG4283397 consensus Transcription-coupled repair protein CSA 96.59
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 96.59
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 96.56
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 96.53
KOG0268433 consensus Sof1-like rRNA processing protein (conta 96.53
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.52
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 96.48
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 96.46
KOG0316307 consensus Conserved WD40 repeat-containing protein 96.46
KOG1963792 consensus WD40 repeat protein [General function pr 96.45
KOG1063764 consensus RNA polymerase II elongator complex, sub 96.45
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 96.43
KOG0303472 consensus Actin-binding protein Coronin, contains 96.4
KOG0290364 consensus Conserved WD40 repeat-containing protein 96.32
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 96.31
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 96.29
KOG0310487 consensus Conserved WD40 repeat-containing protein 96.29
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 96.23
COG3391381 Uncharacterized conserved protein [Function unknow 96.22
COG3490366 Uncharacterized protein conserved in bacteria [Fun 96.21
KOG3975301 consensus Uncharacterized conserved protein [Funct 96.19
KOG0640430 consensus mRNA cleavage stimulating factor complex 96.15
COG3391381 Uncharacterized conserved protein [Function unknow 96.14
KOG0641350 consensus WD40 repeat protein [General function pr 96.13
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 96.05
KOG2321703 consensus WD40 repeat protein [General function pr 96.02
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.01
KOG0299479 consensus U3 snoRNP-associated protein (contains W 95.92
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.91
KOG1539910 consensus WD repeat protein [General function pred 95.9
KOG0268433 consensus Sof1-like rRNA processing protein (conta 95.84
KOG4388880 consensus Hormone-sensitive lipase HSL [Lipid tran 95.84
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 95.79
KOG0647347 consensus mRNA export protein (contains WD40 repea 95.74
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 95.7
PRK13614573 lipoprotein LpqB; Provisional 95.67
KOG0269 839 consensus WD40 repeat-containing protein [Function 95.62
KOG4328498 consensus WD40 protein [Function unknown] 95.58
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 95.53
KOG4389 601 consensus Acetylcholinesterase/Butyrylcholinestera 95.5
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 95.44
KOG1551371 consensus Uncharacterized conserved protein [Funct 95.4
KOG4283397 consensus Transcription-coupled repair protein CSA 95.36
KOG14081080 consensus WD40 repeat protein [Function unknown] 95.35
PRK13614573 lipoprotein LpqB; Provisional 95.28
COG3946456 VirJ Type IV secretory pathway, VirJ component [In 95.26
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 95.18
PRK13613599 lipoprotein LpqB; Provisional 95.17
KOG3967297 consensus Uncharacterized conserved protein [Funct 95.13
PRK13615557 lipoprotein LpqB; Provisional 94.94
KOG2041 1189 consensus WD40 repeat protein [General function pr 94.92
KOG2521350 consensus Uncharacterized conserved protein [Funct 94.84
PRK13615557 lipoprotein LpqB; Provisional 94.73
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 94.62
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 94.62
KOG0294362 consensus WD40 repeat-containing protein [Function 94.61
KOG12141289 consensus Nidogen and related basement membrane pr 94.59
KOG2565469 consensus Predicted hydrolases or acyltransferases 94.52
PRK102521296 entF enterobactin synthase subunit F; Provisional 94.48
PLN02606306 palmitoyl-protein thioesterase 94.45
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 94.26
KOG1520376 consensus Predicted alkaloid synthase/Surface muci 94.17
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 94.12
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 94.12
KOG0641350 consensus WD40 repeat protein [General function pr 93.97
KOG2183 492 consensus Prolylcarboxypeptidase (angiotensinase C 93.9
KOG2182 514 consensus Hydrolytic enzymes of the alpha/beta hyd 93.89
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 93.81
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 93.81
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 93.8
COG4287 507 PqaA PhoPQ-activated pathogenicity-related protein 93.76
PF07519474 Tannase: Tannase and feruloyl esterase; InterPro: 93.76
PLN02633314 palmitoyl protein thioesterase family protein 93.72
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 93.7
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 93.7
PF02450 389 LCAT: Lecithin:cholesterol acyltransferase; InterP 93.63
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 93.6
KOG2106626 consensus Uncharacterized conserved protein, conta 93.58
KOG0294362 consensus WD40 repeat-containing protein [Function 93.54
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 93.54
KOG12141289 consensus Nidogen and related basement membrane pr 93.51
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 93.42
COG1075336 LipA Predicted acetyltransferases and hydrolases w 93.42
TIGR03712511 acc_sec_asp2 accessory Sec system protein Asp2. Th 93.37
PF13449326 Phytase-like: Esterase-like activity of phytase 93.28
KOG0299479 consensus U3 snoRNP-associated protein (contains W 93.26
COG3319257 Thioesterase domains of type I polyketide synthase 93.19
KOG0313423 consensus Microtubule binding protein YTM1 (contai 93.19
KOG3621726 consensus WD40 repeat-containing protein [General 93.02
PRK13613599 lipoprotein LpqB; Provisional 92.96
KOG2321 703 consensus WD40 repeat protein [General function pr 92.81
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 92.57
KOG0646476 consensus WD40 repeat protein [General function pr 92.42
KOG0270463 consensus WD40 repeat-containing protein [Function 92.35
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 92.29
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 92.29
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.16
KOG0269839 consensus WD40 repeat-containing protein [Function 92.0
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 91.74
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 91.56
KOG0646476 consensus WD40 repeat protein [General function pr 91.46
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 91.23
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 91.17
KOG2041 1189 consensus WD40 repeat protein [General function pr 91.16
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 91.03
PF13449326 Phytase-like: Esterase-like activity of phytase 90.96
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 90.86
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 90.83
PF07519 474 Tannase: Tannase and feruloyl esterase; InterPro: 90.57
KOG0308735 consensus Conserved WD40 repeat-containing protein 90.52
PLN02454414 triacylglycerol lipase 90.47
PF03283361 PAE: Pectinacetylesterase 90.45
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 90.43
PF15525200 DUF4652: Domain of unknown function (DUF4652) 89.95
PF02089279 Palm_thioest: Palmitoyl protein thioesterase; Inte 89.93
KOG4547541 consensus WD40 repeat-containing protein [General 89.68
KOG0302440 consensus Ribosome Assembly protein [General funct 89.65
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 89.63
KOG3724 973 consensus Negative regulator of COPII vesicle form 89.21
COG3204316 Uncharacterized protein conserved in bacteria [Fun 88.95
PLN02408365 phospholipase A1 88.91
KOG2111346 consensus Uncharacterized conserved protein, conta 88.9
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 88.57
PLN02571413 triacylglycerol lipase 88.5
KOG0290364 consensus Conserved WD40 repeat-containing protein 88.42
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 88.32
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 88.27
KOG1520376 consensus Predicted alkaloid synthase/Surface muci 88.06
PF05787524 DUF839: Bacterial protein of unknown function (DUF 88.0
PLN02324415 triacylglycerol lipase 87.94
KOG1912 1062 consensus WD40 repeat protein [General function pr 87.73
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 87.58
KOG4532344 consensus WD40-like repeat containing protein [Gen 87.55
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1e-41  Score=378.72  Aligned_cols=566  Identities=21%  Similarity=0.218  Sum_probs=374.2

Q ss_pred             cccceeecCCCCeEEEeeecccccccCCCceeEEEEECCCCceeccccCCCccccccccceEEecCCcEEEEEecCCCCC
Q 004574           32 KINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRD  111 (744)
Q Consensus        32 ~~~~p~~SpDG~~laf~~~~~~~~~~~~~~~~l~~~~~~gg~~~~lt~~~~~~~~~~~~~~~wspDg~~l~~~~~~~~~~  111 (744)
                      .+..|..+|+|+.++|+...- +.........+|+.+...  .+.++...      ....+.|||||+.++|....  +.
T Consensus        14 ~~~~~~~~~~~~~~~~i~~~~-~~~~~~~~~~~~~~d~~~--~~~~~~~~------~~~~~~~spdg~~~~~~~~~--~~   82 (620)
T COG1506          14 RVSDPRVSPPGGRLAYILTGL-DFLKPLYKSSLWVSDGKT--VRLLTFGG------GVSELRWSPDGSVLAFVSTD--GG   82 (620)
T ss_pred             cccCcccCCCCceeEEeeccc-cccccccccceEEEeccc--ccccccCC------cccccccCCCCCEEEEEecc--CC
Confidence            577899999999999998631 122235568899977554  44454444      25678999999999998521  11


Q ss_pred             CCCCCCCCCCCeeeecCCCcccccccccccCCCchhhhccceeeeeEEEEEcCCCCeeecCCC-ceeeeeccCCCCceEE
Q 004574          112 PPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTP-AVYTAVEPSPDQKYVL  190 (744)
Q Consensus       112 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~G~~~~l~~~-~~~~~~~~SpDG~~i~  190 (744)
                                                                 ...++|+++.+|   .+... ..+....|+|+|++++
T Consensus        83 -------------------------------------------~~~~l~l~~~~g---~~~~~~~~v~~~~~~~~g~~~~  116 (620)
T COG1506          83 -------------------------------------------RVAQLYLVDVGG---LITKTAFGVSDARWSPDGDRIA  116 (620)
T ss_pred             -------------------------------------------CcceEEEEecCC---ceeeeecccccceeCCCCCeEE
Confidence                                                       016899998875   23223 5677889999999999


Q ss_pred             EEEeeCCcccccc--------------cCCCcceEEEEeCCCCeeeeccCCCCCCCCCcccCCccCCCCccceecCCCce
Q 004574          191 ITSMHRPYSYKVP--------------CARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPST  256 (744)
Q Consensus       191 ~~~~~~~~~~~~~--------------~~~~~~~l~~~~~~g~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~spDg~~~  256 (744)
                      +............              .+.....+++++.++ ....+...+             ..+..+.+.++++. 
T Consensus       117 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~l~~~d~~~-~~~~~~~~~-------------~~~~~~~~~~~~~~-  181 (620)
T COG1506         117 FLTAEGASKRDGGDHLFVDRLPVWFDGRGGERSDLYVVDIES-KLIKLGLGN-------------LDVVSFATDGDGRL-  181 (620)
T ss_pred             EEecccccccCCceeeeecccceeecCCCCcccceEEEccCc-ccccccCCC-------------CceeeeeeCCCCce-
Confidence            9433221100000              000112344444443 111111111             11334455555554 


Q ss_pred             EEEEEeecCCCCCccCCccceEEeccCCCCCCCCceEeeeeccceeceeeccCCceEEEeeeeec----cceeEEEEcCC
Q 004574          257 LYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKT----SQTRTWLVCPG  332 (744)
Q Consensus       257 l~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~SpDg~~l~~~~~~~~----~~~~l~~~~~~  332 (744)
                      ++.+........     .....++...   .++....++.....+..+.|.+||+.+++......    ....+++.+..
T Consensus       182 ~~~~~~~~~~~~-----~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~gk~~~~~~~~~~~~~~~~~~~~~~~~~  253 (620)
T COG1506         182 VASIRLDDDADP-----WVTNLYVLIE---GNGELESLTPGEGSISKLAFDADGKSIALLGTESDRGLAEGDFILLLDGE  253 (620)
T ss_pred             eEEeeeccccCC-----ceEeeEEEec---CCCceEEEcCCCceeeeeeeCCCCCeeEEeccCCccCccccceEEEEecc
Confidence            444433222111     1112233222   35667777777788999999999998888763332    22345555522


Q ss_pred             CCCCccee-eeccccccccCCCCCCceeeCCCCCeEEEEeeecCCcceEEEEccCCCCCCCCCceEEEEecCCCceeEEe
Q 004574          333 SKDVAPRV-LFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIW  411 (744)
Q Consensus       333 ~~~~~~~~-l~~~~~~~~~~~~~~~~~~~spdg~~l~~~~~~~~~~~~~~~~~~~g~~~~~~~~~l~~~d~~~g~~~~l~  411 (744)
                      .+  .... +...+  ..   .+.....+.-++..++|.....                 .....++..+..++... +.
T Consensus       254 ~~--~~d~~~~~~~--~~---~~~~~~~~~~~~~~~~~~~~~~-----------------~g~~~l~~~~~~~~~~~-~~  308 (620)
T COG1506         254 LG--EVDGDLSSGD--DT---RGAWAVEGGLDGDGLLFIATDG-----------------GGSSPLFRVDDLGGGVE-GL  308 (620)
T ss_pred             cc--ccceeeccCC--cc---cCcHHhccccCCCcEEEEEecC-----------------CCceEEEEEeccCCcee-ee
Confidence            21  1111 11111  00   0100011223455555554220                 11222444443333322 22


Q ss_pred             eccchhhhhheeeeecCCcceecccCCCEEEEEEecCCCCceEEEEECCCCceeeeecCCC-CCCCcCCCceEEEEEEcC
Q 004574          412 ESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPH-PYPTLASLQKEMIKYQRK  490 (744)
Q Consensus       412 ~~~~~~~~~~~~~~~~~~~~~~~s~d~~~~~~~~~~~~~~~~i~~~~~~~g~~~~lt~~~~-~~~~~~~~~~~~i~~~~~  490 (744)
                      ..+..             ....++.+++.+++..++...|+++|+++.  ++..+++..+. ........+++.+++...
T Consensus       309 ~~~~~-------------~v~~f~~~~~~~~~~~s~~~~p~~i~~~~~--~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~  373 (620)
T COG1506         309 SGDDG-------------GVPGFDVDGRKLALAYSSPTEPPEIYLYDR--GEEAKLTSSNNSGLKKVKLAEPEPVTYKSN  373 (620)
T ss_pred             cCCCc-------------eEEEEeeCCCEEEEEecCCCCccceEEEcC--CCceEEeecccccccccccCCceEEEEEcC
Confidence            22211             112455589999999999999999999987  55555555443 455677789999999999


Q ss_pred             CCeEEEEEEEeCCCCCCCCCCCceEEEEECCCCCcccccCCcccCCCCccCCCCchhHHHHHhCCeEEEecCCCCCCCCC
Q 004574          491 DGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEG  570 (744)
Q Consensus       491 ~g~~l~~~~~~P~~~~~~~~~~~p~vv~~HG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~v~~~~~~~~~g~g  570 (744)
                      +|.++++++++|+++++.+  ++|+||++|||+...             +........+.|+++||+|+.+++++..|+|
T Consensus       374 dG~~i~~~l~~P~~~~~~k--~yP~i~~~hGGP~~~-------------~~~~~~~~~q~~~~~G~~V~~~n~RGS~GyG  438 (620)
T COG1506         374 DGETIHGWLYKPPGFDPRK--KYPLIVYIHGGPSAQ-------------VGYSFNPEIQVLASAGYAVLAPNYRGSTGYG  438 (620)
T ss_pred             CCCEEEEEEecCCCCCCCC--CCCEEEEeCCCCccc-------------cccccchhhHHHhcCCeEEEEeCCCCCCccH
Confidence            9999999999999987655  399999999997321             1112335678899999999999998888876


Q ss_pred             CC-----------ChHHHHHHHHHHHHHcCCCCCCcEEEEEechHHHHHHHHHHhCCCceeEEEEccCCCCCCCCCCccc
Q 004574          571 DK-----------LPNDSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQ  639 (744)
Q Consensus       571 ~~-----------~~~~d~~~~~~~l~~~~~~d~~~i~l~G~S~GG~~a~~~~~~~p~~~~~~v~~~~~~~~~~~~~~~~  639 (744)
                      ..           ...+|+.++++++.+++.+|++||+|+|+|+||+|+++++.+.| .|+++++..+.+++........
T Consensus       439 ~~F~~~~~~~~g~~~~~D~~~~~~~l~~~~~~d~~ri~i~G~SyGGymtl~~~~~~~-~f~a~~~~~~~~~~~~~~~~~~  517 (620)
T COG1506         439 REFADAIRGDWGGVDLEDLIAAVDALVKLPLVDPERIGITGGSYGGYMTLLAATKTP-RFKAAVAVAGGVDWLLYFGEST  517 (620)
T ss_pred             HHHHHhhhhccCCccHHHHHHHHHHHHhCCCcChHHeEEeccChHHHHHHHHHhcCc-hhheEEeccCcchhhhhccccc
Confidence            65           23459999999999999999999999999999999999999996 8888888888766543322211


Q ss_pred             cc--------ccchhhcHHHHHhcCcccccCCCCCCEEEEeeCCCCCCCCCHHHHHHHHHHHHhCCCcEEEEEeCCCCcc
Q 004574          640 TE--------FRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHV  711 (744)
Q Consensus       640 ~~--------~~~~~~~~~~~~~~~~~~~~~~~~~P~l~i~G~~D~~v~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~H~  711 (744)
                      ..        ...++.+.+.|.+.||+.+++++++|+|+|||++|..||  .+++++++++|+..|+++++++||+++|.
T Consensus       518 ~~~~~~~~~~~~~~~~~~~~~~~~sp~~~~~~i~~P~LliHG~~D~~v~--~~q~~~~~~aL~~~g~~~~~~~~p~e~H~  595 (620)
T COG1506         518 EGLRFDPEENGGGPPEDREKYEDRSPIFYADNIKTPLLLIHGEEDDRVP--IEQAEQLVDALKRKGKPVELVVFPDEGHG  595 (620)
T ss_pred             hhhcCCHHHhCCCcccChHHHHhcChhhhhcccCCCEEEEeecCCccCC--hHHHHHHHHHHHHcCceEEEEEeCCCCcC
Confidence            11        111111567899999999999999999999999999999  99999999999999999999999999999


Q ss_pred             cCccccHHHHHHHHHHHHHHhccC
Q 004574          712 YAARENVMHVIWETDRWLQKYCLS  735 (744)
Q Consensus       712 ~~~~~~~~~~~~~~~~fl~~~l~~  735 (744)
                      +...++..+.++.+++||.++++.
T Consensus       596 ~~~~~~~~~~~~~~~~~~~~~~~~  619 (620)
T COG1506         596 FSRPENRVKVLKEILDWFKRHLKQ  619 (620)
T ss_pred             CCCchhHHHHHHHHHHHHHHHhcC
Confidence            998788899999999999999864

>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG2112 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella Back     alignment and domain information
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only] Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG4840 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1516 consensus Carboxylesterase and related proteins [General function prediction only] Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4388 consensus Hormone-sensitive lipase HSL [Lipid transport and metabolism] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13614 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4389 consensus Acetylcholinesterase/Butyrylcholinesterase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1551 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>PRK13614 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PRK13613 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG3967 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13615 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2521 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13615 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PLN02606 palmitoyl-protein thioesterase Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>KOG2182 consensus Hydrolytic enzymes of the alpha/beta hydrolase fold [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>COG4287 PqaA PhoPQ-activated pathogenicity-related protein [General function prediction only] Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>PLN02633 palmitoyl protein thioesterase family protein Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>TIGR03712 acc_sec_asp2 accessory Sec system protein Asp2 Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK13613 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PF03283 PAE: Pectinacetylesterase Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF15525 DUF4652: Domain of unknown function (DUF4652) Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query744
2ecf_A741 Crystal Structure Of Dipeptidyl Aminopeptidase Iv F 1e-08
2gbc_A730 Native Dpp-Iv (Cd26) From Rat Length = 730 3e-06
2qr5_A582 Aeropyrum Pernix Acylaminoacyl Peptidase, H367a Mut 1e-05
2qzp_A562 Crystal Structure Of Mutation Of An Acylptide Hydro 1e-05
1ve6_A582 Crystal Structure Of An Acylpeptide HydrolaseESTERA 1e-05
2hu8_A582 Binding Of Inhibitors By Acylaminoacyl Peptidase Le 2e-05
3o4j_A582 Structure And Catalysis Of Acylaminoacyl Peptidase 4e-05
3o4h_A582 Structure And Catalysis Of Acylaminoacyl Peptidase 1e-04
1orv_A728 Crystal Structure Of Porcine Dipeptidyl Peptidase I 1e-04
2qjr_A748 Dipepdyl Peptidase Iv In Complex With Inhibitor Pzf 2e-04
2jid_A736 Human Dipeptidyl Peptidase Iv In Complex With 1-(3, 2e-04
2bgr_A738 Crystal Structure Of Hiv-1 Tat Derived Nonapeptides 2e-04
3qbj_A748 Crystal Structure Of Dipeptidyl Peptidase Iv In Com 2e-04
2qt9_A766 Human Dipeptidyl Peptidase IvCD26 IN COMPLEX WITH A 2e-04
3nox_A753 Crystal Structure Of Human Dpp-Iv In Complex With S 2e-04
1x70_A728 Human Dipeptidyl Peptidase Iv In Complex With A Bet 2e-04
1j2e_A740 Crystal Structure Of Human Dipeptidyl Peptidase Iv 2e-04
3ccb_A740 Crystal Structure Of Human Dpp4 In Complex With A B 2e-04
1r9n_A739 Crystal Structure Of Human Dipeptidyl Peptidase Iv 2e-04
1n1m_A728 Human Dipeptidyl Peptidase IvCD26 IN COMPLEX WITH A 2e-04
3q8w_A732 A B-Aminoacyl Containing Thiazolidine Derivative An 2e-04
2rgu_A734 Crystal Structure Of Complex Of Human Dpp4 And Inhi 2e-04
2g5p_A726 Crystal Structure Of Human Dipeptidyl Peptidase Iv 2e-04
1xfd_A723 Structure Of A Human A-Type Potassium Channel Accel 2e-04
1pfq_A731 Crystal Structure Of Human Apo Dipeptidyl Peptidase 2e-04
2rip_A729 Structure Of Dppiv In Complex With An Inhibitor Len 3e-04
4a5s_A740 Crystal Structure Of Human Dpp4 In Complex With A N 3e-04
1z68_A719 Crystal Structure Of Human Fibroblast Activation Pr 3e-04
2onc_A731 Crystal Structure Of Human Dpp-4 Length = 731 3e-04
1r9m_A733 Crystal Structure Of Human Dipeptidyl Peptidase Iv 3e-04
1u8e_A728 Human Dipeptidyl Peptidase IvCD26 MUTANT Y547F Leng 3e-04
3azo_A662 Crystal Structure Of Puromycin Hydrolase Length = 6 5e-04
>pdb|2ECF|A Chain A, Crystal Structure Of Dipeptidyl Aminopeptidase Iv From Stenotrophomonas Maltophilia Length = 741 Back     alignment and structure 
Iteration: 1

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 70/164 (42%), Gaps = 22/164 (13%)
Query: 588 RGVA--------DPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQ 639
           RGVA        DP+RI V G S G +MT  LLA A   + CG+A +   +  L    + 
Sbjct: 588 RGVAWLKQQPWVDPARIGVQGWSNGGYMTLMLLAKASDSYACGVAGAPVTDWGLYDSHYT 647
Query: 640 TEFRTLWEATNV-YIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGA 698
             +  L    +  Y E   +TH   ++ P+L+IHG  DD V LF   +     AL+  G 
Sbjct: 648 ERYMDLPARNDAGYREARVLTHIEGLRSPLLLIHGMADDNV-LF-TNSTSLMSALQKRGQ 705
Query: 699 LSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLSNTSDGKC 742
              L+  P   H  +  +            L +Y ++    G+C
Sbjct: 706 PFELMTYPGAKHGLSGADA-----------LHRYRVAEAFLGRC 738
>pdb|2GBC|A Chain A, Native Dpp-Iv (Cd26) From Rat Length = 730 Back     alignment and structure
>pdb|2QR5|A Chain A, Aeropyrum Pernix Acylaminoacyl Peptidase, H367a Mutant Length = 582 Back     alignment and structure
>pdb|2QZP|A Chain A, Crystal Structure Of Mutation Of An Acylptide HydrolaseESTERASE FROM AEROPYRUM PERNIX K1 Length = 562 Back     alignment and structure
>pdb|1VE6|A Chain A, Crystal Structure Of An Acylpeptide HydrolaseESTERASE FROM Aeropyrum Pernix K1 Length = 582 Back     alignment and structure
>pdb|2HU8|A Chain A, Binding Of Inhibitors By Acylaminoacyl Peptidase Length = 582 Back     alignment and structure
>pdb|3O4J|A Chain A, Structure And Catalysis Of Acylaminoacyl Peptidase Length = 582 Back     alignment and structure
>pdb|3O4H|A Chain A, Structure And Catalysis Of Acylaminoacyl Peptidase Length = 582 Back     alignment and structure
>pdb|1ORV|A Chain A, Crystal Structure Of Porcine Dipeptidyl Peptidase Iv (Cd26) Length = 728 Back     alignment and structure
>pdb|2QJR|A Chain A, Dipepdyl Peptidase Iv In Complex With Inhibitor Pzf Length = 748 Back     alignment and structure
>pdb|2JID|A Chain A, Human Dipeptidyl Peptidase Iv In Complex With 1-(3,4- Dimethoxy-Phenyl)-3-M-Tolyl-Piperidine-4-Ylamine Length = 736 Back     alignment and structure
>pdb|2BGR|A Chain A, Crystal Structure Of Hiv-1 Tat Derived Nonapeptides Tat(1-9) Bound To The Active Site Of Dipeptidyl Peptidase Iv (Cd26) Length = 738 Back     alignment and structure
>pdb|3QBJ|A Chain A, Crystal Structure Of Dipeptidyl Peptidase Iv In Complex With Inhibitor Length = 748 Back     alignment and structure
>pdb|2QT9|A Chain A, Human Dipeptidyl Peptidase IvCD26 IN COMPLEX WITH A 4-Aryl Cyclohexylalanine Inhibitor Length = 766 Back     alignment and structure
>pdb|3NOX|A Chain A, Crystal Structure Of Human Dpp-Iv In Complex With Sa-(+)-(6- (Aminomethyl)-5-(2,4-Dichlorophenyl)-7-Methylimidazo[1, 2-A]pyrimidin- 2-Yl)(Morpholino)methanone Length = 753 Back     alignment and structure
>pdb|1X70|A Chain A, Human Dipeptidyl Peptidase Iv In Complex With A Beta Amino Acid Inhibitor Length = 728 Back     alignment and structure
>pdb|1J2E|A Chain A, Crystal Structure Of Human Dipeptidyl Peptidase Iv Length = 740 Back     alignment and structure
>pdb|3CCB|A Chain A, Crystal Structure Of Human Dpp4 In Complex With A Benzimidazole Derivative Length = 740 Back     alignment and structure
>pdb|1R9N|A Chain A, Crystal Structure Of Human Dipeptidyl Peptidase Iv In Complex With A Decapeptide (Tnpy) At 2.3 Ang. Resolution Length = 739 Back     alignment and structure
>pdb|1N1M|A Chain A, Human Dipeptidyl Peptidase IvCD26 IN COMPLEX WITH AN INHIBITOR Length = 728 Back     alignment and structure
>pdb|3Q8W|A Chain A, A B-Aminoacyl Containing Thiazolidine Derivative And Dppiv Complex Length = 732 Back     alignment and structure
>pdb|2RGU|A Chain A, Crystal Structure Of Complex Of Human Dpp4 And Inhibitor Length = 734 Back     alignment and structure
>pdb|2G5P|A Chain A, Crystal Structure Of Human Dipeptidyl Peptidase Iv (Dppiv) Complexed With Cyanopyrrolidine (C5-Pro-Pro) Inhibitor 21ac Length = 726 Back     alignment and structure
>pdb|1XFD|A Chain A, Structure Of A Human A-Type Potassium Channel Accelerating Factor Dppx, A Member Of The Dipeptidyl Aminopeptidase Family Length = 723 Back     alignment and structure
>pdb|1PFQ|A Chain A, Crystal Structure Of Human Apo Dipeptidyl Peptidase Iv / Cd26 Length = 731 Back     alignment and structure
>pdb|2RIP|A Chain A, Structure Of Dppiv In Complex With An Inhibitor Length = 729 Back     alignment and structure
>pdb|4A5S|A Chain A, Crystal Structure Of Human Dpp4 In Complex With A Noval Heterocyclic Dpp4 Inhibitor Length = 740 Back     alignment and structure
>pdb|1Z68|A Chain A, Crystal Structure Of Human Fibroblast Activation Protein Alpha Length = 719 Back     alignment and structure
>pdb|2ONC|A Chain A, Crystal Structure Of Human Dpp-4 Length = 731 Back     alignment and structure
>pdb|1R9M|A Chain A, Crystal Structure Of Human Dipeptidyl Peptidase Iv At 2.1 Ang. Resolution. Length = 733 Back     alignment and structure
>pdb|1U8E|A Chain A, Human Dipeptidyl Peptidase IvCD26 MUTANT Y547F Length = 728 Back     alignment and structure
>pdb|3AZO|A Chain A, Crystal Structure Of Puromycin Hydrolase Length = 662 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query744
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 2e-33
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 1e-31
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 8e-27
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 1e-24
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 9e-24
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 1e-21
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 1e-20
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 3e-20
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 2e-19
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 1e-18
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 1e-18
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 1e-17
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 8e-16
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 8e-16
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 3e-15
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 6e-15
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 3e-14
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 8e-14
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 1e-13
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 1e-13
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 2e-12
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 1e-11
3nuz_A398 Putative acetyl xylan esterase; structural genomic 1e-11
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 2e-11
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 3e-11
1vkh_A273 Putative serine hydrolase; structural genomics, jo 5e-11
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 6e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 3e-09
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 3e-09
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 6e-09
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 3e-05
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 1e-08
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 3e-08
3bjr_A283 Putative carboxylesterase; structural genomics, jo 1e-07
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 3e-07
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 3e-07
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 3e-07
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 1e-06
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 1e-06
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 1e-06
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 1e-06
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 2e-06
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 9e-06
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 9e-06
1k32_A 1045 Tricorn protease; protein degradation, substrate g 1e-05
1k32_A1045 Tricorn protease; protein degradation, substrate g 3e-04
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 1e-04
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 1e-04
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 1e-04
3llc_A270 Putative hydrolase; structural genomics, joint cen 2e-04
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 2e-04
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 2e-04
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 2e-04
3h04_A275 Uncharacterized protein; protein with unknown func 2e-04
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 2e-04
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 4e-04
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 4e-04
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 5e-04
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 5e-04
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 5e-04
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 6e-04
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 6e-04
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Length = 662 Back     alignment and structure
 Score =  136 bits (343), Expect = 2e-33
 Identities = 49/273 (17%), Positives = 86/273 (31%), Gaps = 40/273 (14%)

Query: 483 EMIKYQRKDGVPLTATLYLPPG--YDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEF 540
           ++  +   DG  + A +Y P    +    D   P +  A+          G     P   
Sbjct: 392 QIRTFTAPDGREIHAHIYPPHSPDFTGPADELPPYVVMAHG---------GPTSRVPAVL 442

Query: 541 SGMTPTSSLIFLARR-FAVLA---------GPSIPIIGEGDKLPNDSA--EAAVEEVVRR 588
                     +   R   V           G +      G     D     A    +   
Sbjct: 443 DLDVA-----YFTSRGIGVADVNYGGSTGYGRAYRERLRGRWGVVDVEDCAAVATALAEE 497

Query: 589 GVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYN-----KTLTP----FGFQ 639
           G AD +R+AV G S G +  A  L     ++ CG       +        T         
Sbjct: 498 GTADRARLAVRGGSAGGWTAASSLVS-TDVYACGTVLYPVLDLLGWADGGTHDFESRYLD 556

Query: 640 TEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGAL 699
               +  E    Y + +P+T A++++ P L++ G  D      P Q +RF +A+ G G  
Sbjct: 557 FLIGSFEEFPERYRDRAPLTRADRVRVPFLLLQGLEDPVCP--PEQCDRFLEAVAGCGVP 614

Query: 700 SRLVLLPFEHHVYAARENVMHVIWETDRWLQKY 732
              +    E H +  +E ++  +        + 
Sbjct: 615 HAYLSFEGEGHGFRRKETMVRALEAELSLYAQV 647
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Length = 582 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Length = 290 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Length = 318 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Length = 337 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Length = 346 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Length = 740 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Length = 741 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Length = 706 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Length = 723 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Length = 719 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Length = 386 Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Length = 380 Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Length = 415 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Length = 405 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Length = 238 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Length = 251 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Length = 262 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Length = 446 Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Length = 422 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Length = 303 Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Length = 223 Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Length = 398 Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Length = 226 Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Length = 391 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Length = 273 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} Length = 209 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Length = 276 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Length = 277 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Length = 347 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Length = 347 Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Length = 251 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Length = 305 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Length = 283 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Length = 251 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} Length = 270 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Length = 270 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Length = 258 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Length = 226 Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Length = 306 Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Length = 318 Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Length = 403 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Length = 247 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Length = 223 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Length = 1045 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Length = 1045 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Length = 218 Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Length = 176 Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Length = 397 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Length = 270 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Length = 262 Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Length = 331 Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Length = 239 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Length = 275 Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Length = 278 Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Length = 241 Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Length = 367 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Length = 297 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Length = 232 Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Length = 268 Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Length = 275 Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Length = 259 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 744
d2gzsa1265 c.69.1.38 (A:41-305) Enterobactin and salmochelin 4e-16
d2d81a1 318 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymer 6e-16
d1xfda2258 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-li 8e-16
d1vlqa_322 c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Therm 2e-15
d2bgra2258 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26 2e-13
d1qfma2280 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-term 2e-13
d3c8da2246 c.69.1.2 (A:151-396) Enterochelin esterase, cataly 6e-11
d1wb4a1273 c.69.1.2 (A:803-1075) Feruloyl esterase domain of 7e-11
d2jbwa1360 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine h 8e-11
d2hu7a2260 c.69.1.33 (A:322-581) Acylamino-acid-releasing enz 3e-10
d1l7aa_318 c.69.1.25 (A:) Cephalosporin C deacetylase {Bacill 1e-09
d1mpxa2381 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrol 3e-09
d1lnsa3405 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopep 5e-09
d2b9va2385 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrol 2e-08
d1jjfa_255 c.69.1.2 (A:) Feruloyl esterase domain of the cell 7e-08
d1sfra_288 c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculo 5e-07
d1pv1a_299 c.69.1.34 (A:) Hypothetical esterase YJL068C {Bake 2e-06
d1thta_302 c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase 4e-06
d1jjia_311 c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeogl 1e-05
d1r88a_267 c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tu 3e-05
d1uxoa_186 c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus 5e-05
d1vkha_263 c.69.1.32 (A:) Putative serine hydrolase Ydr428c { 8e-05
d2hqsa1269 b.68.4.1 (A:163-431) TolB, C-terminal domain {Esch 1e-04
d1dqza_280 c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculo 2e-04
d1dina_233 c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas 3e-04
d1lzla_317 c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [Ta 7e-04
d1qlwa_318 c.69.1.15 (A:) A novel bacterial esterase {Alcalig 0.001
d1ju3a2347 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-t 0.001
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Length = 265 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: IroE-like
domain: Enterobactin and salmochelin hydrolase IroE
species: Escherichia coli [TaxId: 562]

 Score = 76.6 bits (187), Expect = 4e-16
 Identities = 27/256 (10%), Positives = 57/256 (22%), Gaps = 26/256 (10%)

Query: 483 EMIKYQRKDGV-PLTATLYLPPGYDQSKDGPL-------PC--------LFWAYPEDYKS 526
               +   DG         +P     +   P+                 L     +    
Sbjct: 14  SATSFDSVDGTRHYRVWTAVPNTTAPASGYPILYMLDGNAVMDRLDDELLKQLSEKTPPV 73

Query: 527 KDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDSAEAAVEEVV 586
             A G     P + +      +    +R+  + +G      G  +            +V 
Sbjct: 74  IVAVGYQTNLPFDLNSRAYDYTPAAESRKTDLHSGRFSRKSGGSNNFRQLLETRIAPKVE 133

Query: 587 RRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLW 646
           +    D  R  + GHSYG          + +      + S S  +       +       
Sbjct: 134 QGLNIDRQRRGLWGHSYGGLFVLDSWLSSSYFRSY-YSASPSLGRGYDALLSRVTAVEPL 192

Query: 647 EATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLP 706
           +    ++ +                + E          +       LK  G  +     P
Sbjct: 193 QFCTKHLAIM-------EGSATQGDNRETHAVG--VLSKIHTTLTILKDKGVNAVFWDFP 243

Query: 707 FEHHVYAARENVMHVI 722
              H      +    +
Sbjct: 244 NLGHGPMFNASFRQAL 259
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Length = 318 Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Length = 322 Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 258 Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 280 Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Length = 246 Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Length = 273 Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 360 Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Length = 260 Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Length = 318 Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Length = 381 Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Length = 405 Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Length = 385 Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Length = 255 Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Length = 288 Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 299 Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Length = 302 Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 311 Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 267 Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Length = 186 Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 263 Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 269 Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 280 Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Length = 233 Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Length = 317 Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Length = 318 Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Length = 347 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query744
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 100.0
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 100.0
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 100.0
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.98
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.98
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.98
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.97
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 99.97
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.97
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.97
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.97
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 99.96
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 99.96
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 99.96
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.95
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.95
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 99.95
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 99.95
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 99.94
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 99.94
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 99.93
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 99.93
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 99.93
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 99.92
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 99.92
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.92
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 99.92
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 99.92
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.91
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 99.91
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.9
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 99.9
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 99.9
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 99.9
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.89
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.89
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 99.88
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 99.88
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.88
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 99.88
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.87
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 99.87
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.86
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.86
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.86
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.86
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 99.85
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.85
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.85
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.85
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.85
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.85
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.85
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 99.84
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 99.83
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.83
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.83
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.82
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.82
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.82
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 99.82
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.82
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.82
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 99.82
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.82
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.82
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 99.81
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.81
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.8
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.79
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.79
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.79
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 99.79
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.79
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.79
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 99.78
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 99.78
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.78
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.78
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.78
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.76
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 99.76
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.76
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.76
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.76
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.75
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.75
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.74
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.73
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.73
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 99.73
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.72
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.72
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.71
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.7
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.69
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.68
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.67
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 99.67
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.63
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.62
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.62
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 99.62
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 99.6
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.6
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.59
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 99.58
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 99.56
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.55
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.53
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.52
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 99.51
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.49
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.47
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 99.46
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.46
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 99.36
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.33
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 99.31
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 99.3
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 99.27
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.22
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 99.2
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.19
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.17
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 99.16
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 99.16
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 99.16
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 99.14
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 99.14
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 99.12
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 99.12
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.12
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 99.1
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.1
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 99.09
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 99.08
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.08
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 99.08
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 99.04
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 99.03
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.01
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.95
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 98.94
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.93
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 98.9
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 98.89
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 98.83
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.81
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.81
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 98.8
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.78
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.75
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 98.73
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.72
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.65
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 98.6
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.43
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.42
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 98.41
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.34
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 98.29
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 98.25
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 98.15
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.1
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 98.08
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 98.06
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 98.02
d1ku0a_ 388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 97.87
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 97.85
d1wpxa1421 Serine carboxypeptidase II {Baker's yeast (Sacchar 97.6
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.56
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.23
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.22
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 97.18
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.1
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 96.22
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 95.83
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 94.81
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 94.78
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 94.49
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 94.31
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 94.31
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 94.3
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 94.2
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 86.54
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 83.56
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 80.18
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acylamino-acid-releasing enzyme, C-terminal donain
domain: Acylamino-acid-releasing enzyme, C-terminal donain
species: Aeropyrum pernix [TaxId: 56636]

Probab=100.00  E-value=3.5e-34  Score=209.11  Aligned_cols=235  Identities=19%  Similarity=0.219  Sum_probs=186.9

Q ss_pred             CCCEEEEEEECCCCEEEEEEEEECCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCEEE
Q ss_conf             87508999984799089999991899999999993099998799874656578435898866789932589998588199
Q 004574          479 SLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAV  558 (744)
Q Consensus       479 ~~~~~~i~~~~~~g~~l~~~~~~P~~~~~~~~~~~p~vi~~HG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~Gy~v  558 (744)
                      ....+.++|.+.+|.+++++++.|++.    .++.|+||++|||++....         ..+    ...+..|+++||+|
T Consensus         9 ~~~~~~v~~~s~dG~~i~~~l~~p~~~----~~~~Pviv~~HGG~~~~~~---------~~~----~~~~~~la~~G~~v   71 (260)
T d2hu7a2           9 IAGSRLVWVESFDGSRVPTYVLESGRA----PTPGPTVVLVHGGPFAEDS---------DSW----DTFAASLAAAGFHV   71 (260)
T ss_dssp             EEEEEEEEEECTTSCEEEEEEEEETTS----CSSEEEEEEECSSSSCCCC---------SSC----CHHHHHHHHHTCEE
T ss_pred             CCCEEEEEEECCCCCEEEEEEEECCCC----CCCCEEEEEECCCCCCCCC---------CCC----CHHHHHHHHHCCCC
T ss_conf             675189999999997999999807998----9992299998998754788---------631----39999998523333


Q ss_pred             EECCCCCCCCCCCC-----------CHHHHHHHHHHHHHHCCCCCCCCEEEEEECHHHHHHHHHHHHCCCCEEEEEECCC
Q ss_conf             96699887789998-----------8077899999999984998998279999265799999999959991139997258
Q 004574          559 LAGPSIPIIGEGDK-----------LPNDSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSG  627 (744)
Q Consensus       559 ~~~~~~~~~g~g~~-----------~~~~d~~~~~~~l~~~~~id~~~i~i~G~S~GG~~a~~~a~~~p~~~~a~v~~~~  627 (744)
                      +.++++...+.+..           ...+|+.++++++.++.  +..+++++|+|+||.+++.++..+|+.+++++..+|
T Consensus        72 ~~~d~r~~~~~g~~~~~~~~~~~~~~~~~D~~~~~~~l~~~~--~~~~~~i~g~s~gg~~~~~~~~~~~~~~~a~i~~~~  149 (260)
T d2hu7a2          72 VMPNYRGSTGYGEEWRLKIIGDPCGGELEDVSAAARWARESG--LASELYIMGYSYGGYMTLCALTMKPGLFKAGVAGAS  149 (260)
T ss_dssp             EEECCTTCSSSCHHHHHTTTTCTTTHHHHHHHHHHHHHHHTT--CEEEEEEEEETHHHHHHHHHHHHSTTSSSEEEEESC
T ss_pred             CCCEEEECCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCC--CCCEEECCCCCCCCCCCCCHHCCCCCCCCCCCCCCC
T ss_conf             111011021245543322112220023443101222222223--210000000245554222100147743332211001


Q ss_pred             CCCCCCCCC----CC-CCCCCCHHHCHHHHHHCCCCCCCCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCEEE
Q ss_conf             889988877----63-1111440011788985490110378999899996099997789979999999999949994899
Q 004574          628 SYNKTLTPF----GF-QTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRL  702 (744)
Q Consensus       628 ~~~~~~~~~----~~-~~~~~~~~~~~~~~~~~~~~~~~~~i~~P~li~~G~~D~~v~~~~~~~~~~~~~l~~~g~~~~~  702 (744)
                      ..+......    .+ ...........+.+...++...++++++|+|++||+.|..||  +.++.+++++|++.++++++
T Consensus       150 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~liihG~~D~~vp--~~~~~~~~~~l~~~~~~~~~  227 (260)
T d2hu7a2         150 VVDWEEMYELSDAAFRNFIEQLTGGSREIMRSRSPINHVDRIKEPLALIHPQNDSRTP--LKPLLRLMGELLARGKTFEA  227 (260)
T ss_dssp             CCCHHHHHHTCCHHHHHHHHHHHCSCHHHHHHTCGGGCGGGCCSCEEEEEETTCSSSC--SHHHHHHHHHHHHTTCCEEE
T ss_pred             CHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCEEEECCCCCEEC--HHHHHHHHHHHHHCCCCEEE
T ss_conf             1014343201334332123354554322222332000234567971245314676644--89999999999977998699


Q ss_pred             EEECCCCCCCCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             99089993267545388999999999999616
Q 004574          703 VLLPFEHHVYAARENVMHVIWETDRWLQKYCL  734 (744)
Q Consensus       703 ~~~~~~~H~~~~~~~~~~~~~~~~~fl~~~l~  734 (744)
                      +++|+++|.+...++..++++.+++||.++|+
T Consensus       228 ~~~~g~~H~~~~~e~~~~~~~~~~~fl~~hl~  259 (260)
T d2hu7a2         228 HIIPDAGHAINTMEDAVKILLPAVFFLATQRE  259 (260)
T ss_dssp             EEETTCCSSCCBHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEECCCCCCCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             99895998989767699999999999999745
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure