Citrus Sinensis ID: 004661


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------74
MASAQVLPTSRKQEHLEAGKRKLEEFRKKKAAERAKKASSVSQPQASDFSLHDQHHLEADRVRVTDLDGAGTSDGPDKAVVSLPLVMHNDDNKALKLAQQSQQVSLSDKRINSNCFENDLNSSSAYLAQTYSNNQETSGSAGPVNVSNSQETKDVNNDFVIYSSGQGRLRDGIMSNQFLSLLPEASQDYDSSNSSKSGFQGIEESQSKGNDSFPKVPTLVNSGPSHDFVTKISPQNSVSTLFQSKPSNAIALGNGHSFHSSSEGTAHLTTSTGGSASEVGLNTPSTTNFSDPVSFNTGEGKPSNSASGLASLQSTPFKRSEYSGYNFDAGNSFNHVPVSSATNKFTLGKSRASFLDSLNVPRASSGTLFEQTEPERDSFMSSSSLNSMDVLGSSPAQNPSMEKETTGAFSKTTTSNIPSAFDYLGNPTVSTSDRGDIRRLGSNESSIENQHGFYSTKHNEDFAALEQHIEDLTQEKFALQRSLEASRALSESLAAENSSLTDSYNQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLERQLENSQSEISSYKKKISSLEKERQDFQSTIEALQEEKKMMQSKLRKASGSGKSIDFGKTAASTVNASTSTEDLAITDTTLDNSNQDTHDDASLPRIDASGSTLLPESGRLALEGLAVNIPHDQMRMIHNINALISELALEKEELVQALSSELAQSSKLKV
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
ccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEcccccccccccccccEccccccEcccccccccccccccccccccccccccccccccccccccHEcccccccccccccccccccccccccccccccEEccccccccccEEccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccHHHHccccccccHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
masaqvlptsrkqEHLEAGKRKLEEFRKKKAAERAkkassvsqpqasdfslhdqhhleadrvrvtdldgagtsdgpdkavvslplvmhnddnKALKLAQQSQqvslsdkrinsncfendlnssSAYLAQTYsnnqetsgsagpvnvsnsqetkdvnndFVIYssgqgrlrdgimsnqflsllpeasqdydssnssksgfqgieesqskgndsfpkvptlvnsgpshdfvtkispqnsvstlfqskpsnaialgnghsfhsssegtahlttstggsasevglntpsttnfsdpvsfntgegkpsnsasglaslqstpfkrseysgynfdagnsfnhvpvssatnkftlgkSRASfldslnvprassgtlfeqteperdsfmsssslnsmdvlgsspaqnpsmekettgafsktttsnipsafdylgnptvstsdrgdirrlgsnessienqhgfystkhnEDFAALEQHIEDLTQEKFALQRSLEASRALSESLAAenssltdsynQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLERQLENSQSEISSYKKKISSLEKERQDFQSTIEALQEEKKMMQSKLRkasgsgksidfgktaastvnaststedlaitdttldnsnqdthddaslpridasgstllpesgrLALEGlavniphdqmRMIHNINALISELALEKEELVQALSSELAQSSKLKV
masaqvlptsrkqehleagkrKLEEFRKKKAAerakkassvsqpqasdfslHDQHHLEADRVRVTDLDGAGTSDGPDKAVVSLPLVMHNDDNKALKLAQQSQQVSLSDKRINSNCFENDLNSSSAYLAQTYSNNQETSGSAGPVNVSnsqetkdvnnDFVIYSSGQGRLRDGIMSNQFLSLLPEASQDYDSSNSSKSGFQGIEESqskgndsfpkVPTLVNSGPSHDFVTKISPQNSVSTLFQSKPSNAIALGNGHSFHSSSEGTAHLTTSTGGSASEVGLNTPSTTNFSDPVSFNTGEGKPSNSASGLASLQSTPFKRSEYSGYNFDAGNSFNHVPVSSATNKFTLGKSRASFldslnvprassgtlfeqteperDSFMSSSSLNSMDVLGSSPAQNPSMEKETTGAFSKTTTSNIPSAFDYLGNPTVSTSDRGDIRRLGSNESSIENQHGFYSTKHNEDFAALEQHIEDLTQEKFALQRSLEASRALSESLAaenssltdsynqQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASevigleekalrlrsnelklerqlensqseisSYKKKISSLEKERQDFQSTIEALQEEKKMMQSKLRkasgsgksidfgktaastvnaststedLAITDTTLDNSNQDTHDDASLPRIDASGSTLLPESGRLALEGLAVNIPHDQMRMIHNINALISELALEKEELVQALSselaqssklkv
MASAQVLPTSRKQEHLEAGkrkleefrkkkaaerakkaSSVSQPQASDFSLHDQHHLEADRVRVTDLDGAGTSDGPDKAVVSLPLVMHNDDNKALKLAQQSQQVSLSDKRINSNCFENDLNSSSAYLAQTYSNNQETSGSAGPVNVSNSQETKDVNNDFVIYSSGQGRLRDGIMSNQFLSLLPEAsqdydssnssksGFQGIEESQSKGNDSFPKVPTLVNSGPSHDFVTKISPQNSVSTLFQSKPSNAIALGNGHSFHSSSEGTAHLTTSTGGSASEVGLNTPSTTNFSDPVSFNTGEGKPSNSASGLASLQSTPFKRSEYSGYNFDAGNSFNHVPVSSATNKFTLGKSRASFLDSLNVPRASSGTLFEQTEPERdsfmsssslnsmdvlgssPAQNPSMEKETTGAFSKTTTSNIPSAFDYLGNPTVSTSDRGDIRRLGSNESSIENQHGFYSTKHNEDFAALEQHIEDLTQEKFALQrsleasralseslaaensslTDSYNQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLERQLENsqseissykkkisslekeRQDFQSTIEALQEEKKMMQSKLRKASGSGKSIDFGKtaastvnaststEDLAITDTTLDNSNQDTHDDASLPRIDASGSTLLPESGRLALEGLAVNIPHDQMRMIHNINALISELALEKEELVQALSSELAQSSKLKV
*************************************************************************************************************************************************************DFVIYSS************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************IKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEE***************************************************************************************************************************LALEGLAVNIPHDQMRMIHNINALISELALE********************
*********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************IHNINALISELALE********************
******************GKRKLEEF*************************HDQHHLEADRVRVTDLDGAGTSDGPDKAVVSLPLVMHNDDNKALKL***********KRINSNCFENDLNSSSAYLAQTYS**************SNSQETKDVNNDFVIYSSGQGRLRDGIMSNQFLSLLPEA**************************SFPKVPTLVNSGPSHDFVTKISPQNSVSTLFQSKPSNAIALGNGHSFHSSSEGTAHLTTSTGGSASEVGLNTPSTTNFSDPVSFN*****************STPFKRSEYSGYNFDAGNSFNHVPVSSATNKFTLGKSRASFLDSLNVPRASSGTLFE**************LNSM**********************KTTTSNIPSAFDYLGNPTVSTSDRGDIRRLGSNESSIENQHGFYSTKHNEDFAALEQHIEDLTQEKFALQRSLEASRALSESLAAENSSLTDSYNQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLE****************************STIEALQEE****************SIDFGKTAASTVNASTSTEDLAITDTTLDNSNQDTHDDASLPRIDASGSTLLPESGRLALEGLAVNIPHDQMRMIHNINALISELALEKEELVQALS***********
*************EHLEAGKRKLEEFRKKKAAER***********************************AGTSDGPDKAVVSLPLVMHNDDNKALKLAQ******LSDKRINSNCFEN*LNSSS*Y****************************VNNDFVIYSSGQGRLRDGIMSNQFLSL**********************************V*T**NSGPSHDFVTKI**************SNAIAL*N***F*********LT**TG*SASE********TNFSDP*SFNT******************************************************AS****LNVP**********************************************************************SDRGDIRRLGSNESSIENQHGFYSTKHNEDFAALEQHIEDLTQEKFALQRSLEASRALSESLAAENSSLTDSYNQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLERQLENSQSEISSYKKKISSLEKERQDFQSTIEALQEEKKMMQSKLRKASGSGKSIDFGKTAASTVNASTSTEDLAITDTTLDNSNQDTHDDASLPRIDASGSTLLPESGRLALEGLAVNIPHDQMRMIHNINALISELALEKEELVQALSSEL********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASAQVLPTSRKQEHxxxxxxxxxxxxxxxxxxxxxKASSVSQPQASDFSLHDQHHLEADRVRVTDLDGAGTSDGPDKAVVSLPLVMHNDDNKALKLAQQSQQVSLSDKRINSNCFENDLNSSSAYLAQTYSNNQETSGSAGPVNVSNSQETKDVNNDFVIYSSGQGRLRDGIMSNQFLSLLPEASQDYDSSNSSKSGFQGIEESQSKGNDSFPKVPTLVNSGPSHDFVTKISPQNSVSTLFQSKPSNAIALGNGHSFHSSSEGTAHLTTSTGGSASEVGLNTPSTTNFSDPVSFNTGEGKPSNSASGLASLQSTPFKRSEYSGYNFDAGNSFNHVPVSSATNKFTLGKSRASFLDSLNVPRASSGTLFEQTEPERDSFMSSSSLNSMDVLGSSPAQNPSMEKETTGAFSKTTTSNIPSAFDYLGNPTVSTSDRGDIRRLGSNESSIENQHGFYxxxxxxxxxxxxxxxxxxxxxxxxxxxxLEASRALSESLAAENSSLTDSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAKILASEVIGLEEKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGKSIDFGKTAASTVNASTSTEDLAITDTTLDNSNQDTHDDASLPRIDASGSTLLPESGRLALEGLAVNIPHDQMRMIHNINALISELALEKEELVQALSSELAQSSKLKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query739
225433351804 PREDICTED: uncharacterized protein LOC10 0.964 0.886 0.519 1e-163
356533381784 PREDICTED: uncharacterized protein LOC10 0.937 0.883 0.475 1e-151
255554298713 conserved hypothetical protein [Ricinus 0.851 0.882 0.440 1e-115
297831252728 hypothetical protein ARALYDRAFT_898989 [ 0.566 0.575 0.528 1e-109
145338880714 protein BLISTER [Arabidopsis thaliana] g 0.852 0.882 0.408 1e-108
449458920607 PREDICTED: uncharacterized protein LOC10 0.771 0.939 0.429 1e-104
356577582684 PREDICTED: uncharacterized protein LOC10 0.715 0.773 0.404 4e-92
125528809760 hypothetical protein OsI_04881 [Oryza sa 0.549 0.534 0.448 1e-76
115441767760 Os01g0911800 [Oryza sativa Japonica Grou 0.549 0.534 0.448 1e-76
414879058748 TPA: hypothetical protein ZEAMMB73_30879 0.512 0.506 0.445 2e-76
>gi|225433351|ref|XP_002282738.1| PREDICTED: uncharacterized protein LOC100251145 [Vitis vinifera] gi|297741880|emb|CBI33315.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  582 bits (1499), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 390/751 (51%), Positives = 497/751 (66%), Gaps = 38/751 (5%)

Query: 1   MASAQVLPTSRKQEHLEAGKRKLEEFRKKKAAERAKKASSVSQPQASDFSLHDQHHLEAD 60
           MASAQVL   RKQEHLEAGKR+LEEFRKKKAA+RAKK +S+SQ Q++D SL  Q  LE +
Sbjct: 1   MASAQVL---RKQEHLEAGKRRLEEFRKKKAADRAKKVASISQLQSADVSLCVQP-LENE 56

Query: 61  RVRVTDLDGAGTSDGPDKAVVSLPLVMHNDDNKALKLAQQSQQVSLSDKRINSNCFENDL 120
           +VRV D DGAG SDG  +AV  +     N+DNK +++ Q S+  S SD          D 
Sbjct: 57  QVRVMDSDGAGISDGVGEAVTKVI----NNDNKKIEIFQNSEPCS-SDIYAKPPFSTKDY 111

Query: 121 NSSSAYLAQTYSNNQ-----ETSGSAGPVNVSNSQETKDVNNDFVIYSSGQGRLRDGIMS 175
            + SA   QT  N+Q     + SG  G V     Q  K+ N+D  I++  +G   + I+S
Sbjct: 112 KAFSADSVQTQVNDQGFNRYDASGFLGLVG----QLAKEKNDDGGIHAGAEGSAYE-IVS 166

Query: 176 NQFLSLLPEASQDYDSSNSSKSGFQGIEESQSKGNDSFPKVPTLVNSGPSHDFVTKISPQ 235
           +Q ++  P+A +D DSS SS+S F  +EE+Q K + S  K  T+++ G S   +   S +
Sbjct: 167 DQSIAF-PQAIRDTDSS-SSQSNFHRMEETQQKDHKSSLKSFTVIDPGISQVPLANASSE 224

Query: 236 NSVSTLFQSKPSNAIALGN-GHSFHSSSEGTAHLTTSTGGSASEVGLNTPSTTNFSDPVS 294
           NS          NAI   N G++   SS  + H  T+   SA  VG + P + +F+  + 
Sbjct: 225 NS---------GNAILPNNYGYANMKSSADSVHPITTAKQSAFGVGQDVPGSVDFNVHML 275

Query: 295 FNTGEGKPSNSASGLASLQ-STPFK-RSEYSGYNFDAGNSFNHVPVSSATNKFTLGKSRA 352
            N  + K S+S   L S   ++P    S  + + FD   S NH+P+ S T +    +SR 
Sbjct: 276 SNKEDKKLSSSFGYLPSTHGASPLASESSSTSFAFDVRGSSNHLPLYSVTPETNARRSRP 335

Query: 353 SFLDSLNVPRASSGTLFEQTEPERDS--FMSSSSLNSMDVLGSSPAQNPSMEKETTGAFS 410
           SFLDS+NVPR  S +    TEP +    F SSS +NSMDVLGSS +     E E    FS
Sbjct: 336 SFLDSINVPRVPSASHLPLTEPGKAEPFFSSSSKVNSMDVLGSSASTKSLAESENFEPFS 395

Query: 411 KTTTSNIPSAFDYLGNPTVSTSDRGDIRRLGSNESSIENQHGFYSTKHNEDFAALEQHIE 470
           K   SN PS FD+  N +VS  +R ++ R G +++S+E +  F+S K NEDFAALEQHIE
Sbjct: 396 KAGNSNGPSLFDHSINSSVSVGNRVEMLRHGLDQNSLERKFEFHSQKQNEDFAALEQHIE 455

Query: 471 DLTQEKFALQRSLEASRALSESLAAENSSLTDSYNQQRSVVNQLKSEMEKLQEEIKVQLV 530
           DLTQEKF+LQR+LEASRAL+ESLAAENSSLTDSYNQQ SVVNQLKS+MEKLQEEIK QLV
Sbjct: 456 DLTQEKFSLQRALEASRALAESLAAENSSLTDSYNQQGSVVNQLKSDMEKLQEEIKAQLV 515

Query: 531 ELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLERQLENSQSEISS 590
           +LESF+ EYAN +LECNAADERAK+LASEVIGLEEKALRLRS+ELKLERQLENS +EISS
Sbjct: 516 DLESFKIEYANAQLECNAADERAKLLASEVIGLEEKALRLRSSELKLERQLENSNAEISS 575

Query: 591 YKKKISSLEKERQDFQSTIEALQEEKKMMQSKLRKASGSGKSIDFGKTAASTVNASTSTE 650
           +KKK+SSLEKERQD Q TI+ALQEEKK++Q K+RKAS +GKSID  K+     + STST+
Sbjct: 576 FKKKVSSLEKERQDLQLTIDALQEEKKLLQKKVRKASANGKSIDASKSPTDRKDVSTSTD 635

Query: 651 DLAITDTTL---DNSNQDTHDDASLPRIDASGSTLLPESGRLALEGLAVNIPHDQMRMIH 707
           DL   D      + S+ +  + AS+   + S   LLP+ G++  E  +VNIP DQMRMI 
Sbjct: 636 DLVNEDNACMIPETSSLEMLNSASVQANELSSFPLLPDGGQMNFEVSSVNIPADQMRMIQ 695

Query: 708 NINALISELALEKEELVQALSSELAQSSKLK 738
           NINALISELALEKEEL+QAL +E +QSSKLK
Sbjct: 696 NINALISELALEKEELMQALVTESSQSSKLK 726




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356533381|ref|XP_003535243.1| PREDICTED: uncharacterized protein LOC100817279 [Glycine max] Back     alignment and taxonomy information
>gi|255554298|ref|XP_002518189.1| conserved hypothetical protein [Ricinus communis] gi|223542785|gb|EEF44322.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|297831252|ref|XP_002883508.1| hypothetical protein ARALYDRAFT_898989 [Arabidopsis lyrata subsp. lyrata] gi|297329348|gb|EFH59767.1| hypothetical protein ARALYDRAFT_898989 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|145338880|ref|NP_189040.3| protein BLISTER [Arabidopsis thaliana] gi|9294667|dbj|BAB03016.1| unnamed protein product [Arabidopsis thaliana] gi|332643320|gb|AEE76841.1| protein BLISTER [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449458920|ref|XP_004147194.1| PREDICTED: uncharacterized protein LOC101216257 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356577582|ref|XP_003556903.1| PREDICTED: uncharacterized protein LOC100811137 [Glycine max] Back     alignment and taxonomy information
>gi|125528809|gb|EAY76923.1| hypothetical protein OsI_04881 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|115441767|ref|NP_001045163.1| Os01g0911800 [Oryza sativa Japonica Group] gi|20161363|dbj|BAB90287.1| heavy meromyosin-like [Oryza sativa Japonica Group] gi|113534694|dbj|BAF07077.1| Os01g0911800 [Oryza sativa Japonica Group] gi|125573067|gb|EAZ14582.1| hypothetical protein OsJ_04505 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|414879058|tpg|DAA56189.1| TPA: hypothetical protein ZEAMMB73_308793 [Zea mays] gi|414879059|tpg|DAA56190.1| TPA: hypothetical protein ZEAMMB73_308793 [Zea mays] gi|414879060|tpg|DAA56191.1| TPA: hypothetical protein ZEAMMB73_308793 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query739
TAIR|locus:2076071714 BLI "BLISTER" [Arabidopsis tha 0.675 0.698 0.395 9.3e-84
DICTYBASE|DDB_G0271670374 DDB_G0271670 [Dictyostelium di 0.437 0.863 0.172 5.7e-06
ZFIN|ZDB-GENE-080618-2538 prdm1b "PR domain containing 1 0.457 0.628 0.212 0.00022
POMBASE|SPBC215.13534 SPBC215.13 "sequence orphan" [ 0.369 0.511 0.226 0.00028
CGD|CAL0006203 768 orf19.4906 [Candida albicans ( 0.327 0.315 0.247 0.00073
UNIPROTKB|Q5APQ2 768 CaO19.4906 "Putative uncharact 0.327 0.315 0.247 0.00073
TAIR|locus:2076071 BLI "BLISTER" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 809 (289.8 bits), Expect = 9.3e-84, Sum P(2) = 9.3e-84
 Identities = 209/528 (39%), Positives = 293/528 (55%)

Query:   220 VNSGPSHDFVTKISPQNSVSTLFQSKPSNAIALGNGHSFHSSSEGTAHLTTSTGGSASEV 279
             VN+ P     + I  Q+S S    S      +L +G S     +G  H +  T      +
Sbjct:   127 VNTRPEVVPYSNIDKQSSESFDRASTLRETASLFSGTSMQM--DGFIHGSGLTSSRKDSL 184

Query:   280 GLNTPSTTNFSDPVSFNTGEG--------KPSNSASGLASLQSTPFKRSEYSGYNFDAGN 331
                T    +F +      G G        KP+ S+S L +   T  + SE S ++ +  +
Sbjct:   185 QPTTRMAGSFDEVAKNQQGSGELGGSIVQKPTLSSSYLFNSPDTSSRPSEPSDFSVNITS 244

Query:   332 SFNHVPVSSATNKFTLGKSRASFLDSLNVPRASSGTLFEQTEPERXXXXXXXXXXXXXXX 391
             S    P++SA ++ T+ +SR SFLDSLN+ RA   T ++   PE                
Sbjct:   245 SS---PLNSAKSEATVKRSRPSFLDSLNISRAPE-TQYQH--PEIQADLVTSSGSQLSGS 298

Query:   392 XXXPAQNPSMEKETTGAFSKTT-TSNIPSAFDYLGNPTVSTSDRGDIRRLGSNESSIENQ 450
                     S  +++ G  S T+  S+ P+ F+   +     ++ G +   G  + S+  Q
Sbjct:   299 DGFGPSYISGRRDSNGPSSLTSGASDYPNPFEKFRSSLYPAAN-GVMP--GFTDFSMPKQ 355

Query:   451 HGFYSTKHNEDFAALEQHIEDLTQEKFALQXXXXXXXXXXXXXXXXXXXXTDSYNQQRSV 510
                     N+DF ALEQHIEDLTQEKF+LQ                    TD+YNQQR +
Sbjct:   356 --------NDDFTALEQHIEDLTQEKFSLQRDLDASRALAESLASENSSMTDTYNQQRGL 407

Query:   511 VNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRL 570
             VNQLK +ME+L ++I+ Q+ ELES R EYAN +LECNAADER++ILASEVI LE+KALRL
Sbjct:   408 VNQLKDDMERLYQQIQAQMGELESVRVEYANAQLECNAADERSQILASEVISLEDKALRL 467

Query:   571 RSNELKLERQLENXXXXXXXXXXXXXXXXXXRQDFQSTIEALQEEKKMMQSKLRKASGSG 630
             RSNELKLER+LE                   RQD QSTI+ALQEEKK++Q+ ++KAS  G
Sbjct:   468 RSNELKLERELEKAQTEMLSYKKKLQSLEKDRQDLQSTIKALQEEKKVLQTMVQKASSGG 527

Query:   631 KSIDFGKXXXXXXXXXXXXEDLAITDTTLDNSNQDTHDDASLPRIDASGSTLLPESGRLA 690
             KS D  K            E LAI+DTT ++SNQ+T D  +L   D+S + ++PE+ +L 
Sbjct:   528 KSTDLSKNSTSRKNVSTSTEGLAISDTTPESSNQET-DSTTLLESDSSNTAIIPETRQLT 586

Query:   691 LEGLAVNIPHDQMRMIHNINALISELALEKEELVQALSSELAQSSKLK 738
             LEG ++++P DQMR+IHNIN LI+ELA+EKEELVQALSSEL++S+ ++
Sbjct:   587 LEGFSLSVPADQMRVIHNINTLIAELAIEKEELVQALSSELSRSAHVQ 634


GO:0005794 "Golgi apparatus" evidence=ISM
GO:0005634 "nucleus" evidence=IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IMP
GO:0009908 "flower development" evidence=IMP
GO:0009965 "leaf morphogenesis" evidence=IGI
GO:0010091 "trichome branching" evidence=IMP
GO:0048316 "seed development" evidence=IMP
GO:0048826 "cotyledon morphogenesis" evidence=IMP
GO:0051781 "positive regulation of cell division" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
DICTYBASE|DDB_G0271670 DDB_G0271670 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080618-2 prdm1b "PR domain containing 1b, with ZNF domain" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
POMBASE|SPBC215.13 SPBC215.13 "sequence orphan" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
CGD|CAL0006203 orf19.4906 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5APQ2 CaO19.4906 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00020407001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (451 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query739
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 6e-11
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-10
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 8e-10
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-09
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-09
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-08
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-08
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-08
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-08
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-08
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-08
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-08
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 6e-08
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 7e-08
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 8e-08
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-07
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-07
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-07
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-07
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 4e-07
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 6e-07
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 8e-07
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-06
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 2e-06
pfam09726680 pfam09726, Macoilin, Transmembrane protein 5e-06
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 7e-06
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 8e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 9e-06
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-05
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 2e-05
COG2433652 COG2433, COG2433, Uncharacterized conserved protei 2e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-05
TIGR01843423 TIGR01843, type_I_hlyD, type I secretion membrane 3e-05
pfam13863126 pfam13863, DUF4200, Domain of unknown function (DU 5e-05
PRK04863 1486 PRK04863, mukB, cell division protein MukB; Provis 7e-05
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 8e-05
COG3096 1480 COG3096, MukB, Uncharacterized protein involved in 1e-04
pfam04156186 pfam04156, IncA, IncA protein 1e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-04
PRK02224 880 PRK02224, PRK02224, chromosome segregation protein 3e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-04
pfam00769244 pfam00769, ERM, Ezrin/radixin/moesin family 5e-04
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 8e-04
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 8e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.001
pfam13166 713 pfam13166, AAA_13, AAA domain 0.001
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
COG4717984 COG4717, COG4717, Uncharacterized conserved protei 0.002
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 0.002
pfam03962188 pfam03962, Mnd1, Mnd1 family 0.004
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
 Score = 65.9 bits (161), Expect = 6e-11
 Identities = 48/196 (24%), Positives = 93/196 (47%), Gaps = 3/196 (1%)

Query: 434 RGDIRRLGSNESSIENQHGFYSTKHNEDFAALEQ---HIEDLTQEKFALQRSLEASRALS 490
              +  L      +E Q      +       LEQ    +E+L +E   L+  LE  +   
Sbjct: 701 EDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERL 760

Query: 491 ESLAAENSSLTDSYNQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAAD 550
           E L  E  SL ++  + +  + +L+ + + LQEE++    ELE        +  E  + +
Sbjct: 761 EELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLE 820

Query: 551 ERAKILASEVIGLEEKALRLRSNELKLERQLENSQSEISSYKKKISSLEKERQDFQSTIE 610
           +R + L  E+  LEE+   L     +LE +LE  + E+   K+++  LE E+++ +  ++
Sbjct: 821 QRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELK 880

Query: 611 ALQEEKKMMQSKLRKA 626
            L+EEK+ ++ +LR+ 
Sbjct: 881 ELEEEKEELEEELREL 896


Length = 1163

>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>gnl|CDD|206034 pfam13863, DUF4200, Domain of unknown function (DUF4200) Back     alignment and domain information
>gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|225638 COG3096, MukB, Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|217933 pfam04156, IncA, IncA protein Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|221952 pfam13166, AAA_13, AAA domain Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|227061 COG4717, COG4717, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 739
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 98.15
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 98.1
PRK02224 880 chromosome segregation protein; Provisional 97.66
PRK11637 428 AmiB activator; Provisional 97.63
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 97.5
PRK02224 880 chromosome segregation protein; Provisional 97.49
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 97.48
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.42
PRK11637428 AmiB activator; Provisional 97.37
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 97.27
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.24
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 97.22
PHA02562562 46 endonuclease subunit; Provisional 97.19
PHA02562562 46 endonuclease subunit; Provisional 97.16
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 97.15
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 97.14
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 97.11
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 97.03
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 96.99
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 96.96
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 96.9
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 96.89
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 96.81
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 96.75
PRK09039343 hypothetical protein; Validated 96.73
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 96.69
PRK03918 880 chromosome segregation protein; Provisional 96.69
PRK03918880 chromosome segregation protein; Provisional 96.65
PF00038312 Filament: Intermediate filament protein; InterPro: 96.61
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 96.58
PRK04778569 septation ring formation regulator EzrA; Provision 96.58
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 96.58
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 96.53
PF05701522 WEMBL: Weak chloroplast movement under blue light; 96.51
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 96.32
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 96.27
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 96.27
PF14662193 CCDC155: Coiled-coil region of CCDC155 96.26
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 96.26
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 96.23
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 96.19
PRK04778569 septation ring formation regulator EzrA; Provision 96.15
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 96.13
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 96.03
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 95.99
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 95.96
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 95.96
PRK04863 1486 mukB cell division protein MukB; Provisional 95.95
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 95.91
PF00038312 Filament: Intermediate filament protein; InterPro: 95.85
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 95.81
PRK10361 475 DNA recombination protein RmuC; Provisional 95.74
COG4372 499 Uncharacterized protein conserved in bacteria with 95.72
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 95.69
PRK04863 1486 mukB cell division protein MukB; Provisional 95.66
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 95.63
PRK09039343 hypothetical protein; Validated 95.62
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 95.56
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 95.56
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 95.5
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 95.49
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 95.49
KOG0933 1174 consensus Structural maintenance of chromosome pro 95.49
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 95.44
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 95.34
PF10186302 Atg14: UV radiation resistance protein and autopha 95.31
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 95.31
PF13166 712 AAA_13: AAA domain 95.3
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 95.2
PF05701522 WEMBL: Weak chloroplast movement under blue light; 95.17
KOG0933 1174 consensus Structural maintenance of chromosome pro 95.17
PF05700221 BCAS2: Breast carcinoma amplified sequence 2 (BCAS 95.15
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 95.12
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 95.07
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 95.06
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 94.95
KOG1103 561 consensus Predicted coiled-coil protein [Function 94.93
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 94.91
COG4942420 Membrane-bound metallopeptidase [Cell division and 94.89
KOG0996 1293 consensus Structural maintenance of chromosome pro 94.85
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 94.84
PF07111 739 HCR: Alpha helical coiled-coil rod protein (HCR); 94.74
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 94.74
KOG0979 1072 consensus Structural maintenance of chromosome pro 94.73
KOG0971 1243 consensus Microtubule-associated protein dynactin 94.7
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 94.67
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 94.64
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 94.63
PF10186302 Atg14: UV radiation resistance protein and autopha 94.54
PF13851201 GAS: Growth-arrest specific micro-tubule binding 94.53
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 94.45
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 94.44
KOG0971 1243 consensus Microtubule-associated protein dynactin 94.34
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 94.34
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 94.32
PF13514 1111 AAA_27: AAA domain 94.29
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 94.27
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 94.25
PRK11281 1113 hypothetical protein; Provisional 94.23
KOG4673 961 consensus Transcription factor TMF, TATA element m 94.11
PF12795240 MscS_porin: Mechanosensitive ion channel porin dom 93.99
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 93.97
cd07651236 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology 93.93
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 93.85
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 93.8
PRK10476346 multidrug resistance protein MdtN; Provisional 93.76
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 93.74
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 93.67
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 93.63
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 93.61
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 93.56
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 93.54
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 93.53
PF135141111 AAA_27: AAA domain 93.47
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 93.46
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 93.28
cd07655258 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/ 93.27
PF02050123 FliJ: Flagellar FliJ protein; InterPro: IPR012823 93.27
KOG4593 716 consensus Mitotic checkpoint protein MAD1 [Cell cy 93.19
PRK01156895 chromosome segregation protein; Provisional 93.18
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 93.14
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 93.05
TIGR01010362 BexC_CtrB_KpsE polysaccharide export inner-membran 93.0
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 92.95
cd07653251 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B 92.92
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 92.9
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 92.74
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 92.63
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 92.55
cd07647239 F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/ 92.49
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 92.49
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 92.47
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 92.46
PF09744158 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte 92.36
KOG0996 1293 consensus Structural maintenance of chromosome pro 92.31
cd07653251 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B 92.21
TIGR02977219 phageshock_pspA phage shock protein A. Members of 92.16
PRK11519 719 tyrosine kinase; Provisional 92.14
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 92.0
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 91.94
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 91.81
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 91.8
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 91.75
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 91.73
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 91.66
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 91.63
PRK10929 1109 putative mechanosensitive channel protein; Provisi 91.58
cd07680258 F-BAR_PACSIN1 The F-BAR (FES-CIP4 Homology and Bin 91.56
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 91.48
PRK01156895 chromosome segregation protein; Provisional 91.39
PRK10246 1047 exonuclease subunit SbcC; Provisional 91.31
PRK1542279 septal ring assembly protein ZapB; Provisional 91.3
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 91.2
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 91.19
PRK10361 475 DNA recombination protein RmuC; Provisional 91.18
COG4942420 Membrane-bound metallopeptidase [Cell division and 91.16
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 90.92
TIGR03794421 NHPM_micro_HlyD NHPM bacteriocin system secretion 90.78
TIGR02473141 flagell_FliJ flagellar export protein FliJ. Member 90.57
cd07675252 F-BAR_FNBP1L The F-BAR (FES-CIP4 Homology and Bin/ 90.57
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 90.51
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 90.44
KOG0239 670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 90.38
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 90.29
PRK102461047 exonuclease subunit SbcC; Provisional 90.27
cd07671242 F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin 90.25
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 89.97
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 89.94
PRK10884206 SH3 domain-containing protein; Provisional 89.91
KOG0964 1200 consensus Structural maintenance of chromosome pro 89.88
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 89.8
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 89.75
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 89.72
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 89.69
PF13166 712 AAA_13: AAA domain 89.67
KOG0288 459 consensus WD40 repeat protein TipD [General functi 89.55
PF14662193 CCDC155: Coiled-coil region of CCDC155 89.19
COG307479 Uncharacterized protein conserved in bacteria [Fun 88.99
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 88.86
PLN031881320 kinesin-12 family protein; Provisional 88.63
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 88.49
PF05546207 She9_MDM33: She9 / Mdm33 family; InterPro: IPR0088 88.48
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 88.43
cd07666243 BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of S 88.41
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 88.39
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 88.15
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 88.12
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 88.09
KOG0249 916 consensus LAR-interacting protein and related prot 88.0
KOG0964 1200 consensus Structural maintenance of chromosome pro 87.98
PF15066527 CAGE1: Cancer-associated gene protein 1 family 87.96
KOG1962216 consensus B-cell receptor-associated protein and r 87.77
KOG4460741 consensus Nuclear pore complex, Nup88/rNup84 compo 87.75
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 87.68
PRK10884206 SH3 domain-containing protein; Provisional 87.5
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 87.44
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 87.24
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 87.2
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 87.17
TIGR02971327 heterocyst_DevB ABC exporter membrane fusion prote 87.13
cd07679258 F-BAR_PACSIN2 The F-BAR (FES-CIP4 Homology and Bin 87.03
cd07672240 F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin 86.9
cd07649233 F-BAR_GAS7 The F-BAR (FES-CIP4 Homology and Bin/Am 86.88
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 86.86
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 86.6
cd07652234 F-BAR_Rgd1 The F-BAR (FES-CIP4 Homology and Bin/Am 86.56
cd07658239 F-BAR_NOSTRIN The F-BAR (FES-CIP4 Homology and Bin 86.24
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 86.2
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 86.15
TIGR00634 563 recN DNA repair protein RecN. All proteins in this 86.15
COG2433652 Uncharacterized conserved protein [Function unknow 85.96
PRK05689147 fliJ flagellar biosynthesis chaperone; Validated 85.84
TIGR02231 525 conserved hypothetical protein. This family consis 85.71
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 85.66
PRK10698222 phage shock protein PspA; Provisional 85.59
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 85.59
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 85.53
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 85.5
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 85.43
TIGR03794421 NHPM_micro_HlyD NHPM bacteriocin system secretion 85.39
cd07676253 F-BAR_FBP17 The F-BAR (FES-CIP4 Homology and Bin/A 85.35
KOG0018 1141 consensus Structural maintenance of chromosome pro 85.17
PRK10929 1109 putative mechanosensitive channel protein; Provisi 85.14
PRK03598331 putative efflux pump membrane fusion protein; Prov 85.02
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 84.89
TIGR02977219 phageshock_pspA phage shock protein A. Members of 84.61
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 84.33
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 84.23
PF07111 739 HCR: Alpha helical coiled-coil rod protein (HCR); 83.52
PF14992280 TMCO5: TMCO5 family 83.4
PF13815118 Dzip-like_N: Iguana/Dzip1-like DAZ-interacting pro 83.34
KOG4673 961 consensus Transcription factor TMF, TATA element m 83.04
TIGR02231 525 conserved hypothetical protein. This family consis 82.99
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 82.81
KOG0239 670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 82.55
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 82.42
KOG4593 716 consensus Mitotic checkpoint protein MAD1 [Cell cy 81.97
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 81.88
PF12795240 MscS_porin: Mechanosensitive ion channel porin dom 81.86
COG3096 1480 MukB Uncharacterized protein involved in chromosom 81.72
PRK12704 520 phosphodiesterase; Provisional 81.67
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 81.39
KOG0249 916 consensus LAR-interacting protein and related prot 81.35
cd00632105 Prefoldin_beta Prefoldin beta; Prefoldin is a hexa 81.17
cd07622201 BAR_SNX4 The Bin/Amphiphysin/Rvs (BAR) domain of S 81.15
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 81.06
KOG3096225 consensus Spliceosome-associated coiled-coil prote 81.02
PF11180192 DUF2968: Protein of unknown function (DUF2968); In 80.87
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 80.65
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 80.63
PRK00409782 recombination and DNA strand exchange inhibitor pr 80.45
TIGR02338110 gimC_beta prefoldin, beta subunit, archaeal. Chape 80.4
KOG0962 1294 consensus DNA repair protein RAD50, ABC-type ATPas 80.32
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
Probab=98.15  E-value=0.00052  Score=77.59  Aligned_cols=41  Identities=29%  Similarity=0.410  Sum_probs=19.3

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHH
Q 004661          460 EDFAALEQHIEDLTQEKFALQRSLEASRALSESLAAENSSL  500 (739)
Q Consensus       460 ~~faaLqQhIeDLT~EKfaLqR~L~~q~~l~EsLA~ENsaL  500 (739)
                      .+...|++.++++..+--.+...+.....-.+++..+-..+
T Consensus       677 ~e~~~l~~~~~~l~~~l~~~~~~~~~~~~~l~~l~~~~~~~  717 (1179)
T TIGR02168       677 REIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQL  717 (1179)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34455555555555554444444444444444444433333



SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle.

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK10361 DNA recombination protein RmuC; Provisional Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG1103 consensus Predicted coiled-coil protein [Function unknown] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PF12795 MscS_porin: Mechanosensitive ion channel porin domain Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>cd07655 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>cd07647 F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Proteins Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>cd07680 F-BAR_PACSIN1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 1 (PACSIN1) Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10361 DNA recombination protein RmuC; Provisional Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>TIGR02473 flagell_FliJ flagellar export protein FliJ Back     alignment and domain information
>cd07675 F-BAR_FNBP1L The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 1-Like Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>cd07671 F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PF05546 She9_MDM33: She9 / Mdm33 family; InterPro: IPR008839 Members of this family are mitochondrial inner membrane proteins with a role in inner mitochondrial membrane organisation and biogenesis [] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>cd07666 BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 7 Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>cd07679 F-BAR_PACSIN2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 2 (PACSIN2) Back     alignment and domain information
>cd07672 F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 2 Back     alignment and domain information
>cd07649 F-BAR_GAS7 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Growth Arrest Specific protein 7 Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>cd07652 F-BAR_Rgd1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Saccharomyces cerevisiae Rho GTPase activating protein Rgd1 and similar proteins Back     alignment and domain information
>cd07658 F-BAR_NOSTRIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Nitric Oxide Synthase TRaffic INducer (NOSTRIN) Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK05689 fliJ flagellar biosynthesis chaperone; Validated Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>cd07676 F-BAR_FBP17 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 17 Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>PF14992 TMCO5: TMCO5 family Back     alignment and domain information
>PF13815 Dzip-like_N: Iguana/Dzip1-like DAZ-interacting protein N-terminal Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF12795 MscS_porin: Mechanosensitive ion channel porin domain Back     alignment and domain information
>COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea Back     alignment and domain information
>cd07622 BAR_SNX4 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 4 Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>KOG3096 consensus Spliceosome-associated coiled-coil protein [Function unknown] Back     alignment and domain information
>PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query739
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-13
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-11
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-11
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-10
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-10
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 5e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-04
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 3e-08
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 6e-08
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 8e-08
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 1e-07
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 9e-07
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 1e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 2e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 3e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 4e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 3e-04
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 2e-07
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 7e-05
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 9e-05
1m1j_C 409 Fibrinogen gamma chain; coiled coils, disulfide ri 7e-05
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 1e-04
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 2e-04
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
 Score = 72.2 bits (177), Expect = 4e-13
 Identities = 25/171 (14%), Positives = 63/171 (36%)

Query: 456  TKHNEDFAALEQHIEDLTQEKFALQRSLEASRALSESLAAENSSLTDSYNQQRSVVNQLK 515
             K   +    +  I+ +  +   ++          + L    S LT +  ++      L 
Sbjct: 972  QKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKNLT 1031

Query: 516  SEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRLRSNEL 575
                K +  I    V L+        +       +  +  L  ++  L+ +   L++   
Sbjct: 1032 KLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKAQLA 1091

Query: 576  KLERQLENSQSEISSYKKKISSLEKERQDFQSTIEALQEEKKMMQSKLRKA 626
            K E +L+ + + +     + ++  K+ ++ +S I  LQE+ +  ++   KA
Sbjct: 1092 KKEEELQAALARLEDETSQKNNALKKIRELESHISDLQEDLESEKAARNKA 1142


>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 Back     alignment and structure
>1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Length = 409 Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00