Citrus Sinensis ID: 004679

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------

MENFPFHDGSIYDMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRGEVATGLGKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEKVENIKKHIAAAETEKNNKANDGGARSEPRTGRVLSLSDIIYRSEANSDASQDGPRSEREDSDYDEEVEVDFHTSVPGDEGRDVEANFLHGSLNVRIHRRGDSARETVDANGSSGSPSSSSQNDRIPYQPETVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGRLIKMLLGDEAVVNCVQCHPFDCVVATSGIDNTIKIWTPSASVPSIVSGGAAGPDTADVLEAMESNQRKLSRNREHSL

cccccccccccEEEEEcccccccccccccEEEEcccccccccccccccccccEEEEEEcccccEEEEEEccccEEEEcccccEEEEEccccccccEEEEEEEccccccEEEEEEccccEEEEEcccccccccccccccccEEcccccccEEEEEEccccccEEEEEEccccEEEEEcccccccccccccccccEEEEEEcccccEEEEccccccEEEEEEEEEEcccccEEEEEEccccEEEEEccccccccccccccccccEEEEEcccccccccccccEEEEEEEcccccEEEEEEcccEEEEEEccccccccEEEEccccccEEEEccccccccccccccccccccccccccEEccccccHHHHHHHHccccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHccccccccHHHHHHccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccHHHHHHHHHccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccEEEcccccccccEEEEEcccccEEEEEEEccccccccccccccEEEccccccccccEEcccccccccEEEEEEEcccccEEEEccccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEEccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHcccccccc

ccccccccccEEEEEcccccEEEEcccccEEEEEEccccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEcccccccEEEEEEcccccccEEEEEccccEEEEEEcccccEEEcccccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEccccccccEEcccccccccEEEEEEccccccEEEEEccccEEEEEEccccccccccccccccccccEEEccccEEEccccccEEEEEEEcccccEEEEEccccEEEEEEccccccEEEEEccccccEEEEEEEcccccEEEccccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEcccccEEEEEEccccccccccccEEEcccccEEEEccccccEEEEEEcccccEEEccccccccEEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEcccccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEEcccccEEEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEcccccEEEEEccccccEEEEcccccccEEEEEEEcccccccEccccccccc

menfpfhdgsiydmldtrhtdtrpdvnhsLQMHSSLVRRLSQereleghqgcvnaiswnskgsllisgsddthinvWSYSSRKLLHSIetghsanvfctkfvpetsdelvvsgagdaEVRLFNlsrfsgrglddnaitpsalyqcHTRRVKKLAVEvgnphvvwsasedgtlrqhdfrqgsscppagsshqECRNILLDLrcgakrsladppkqtlslkscdisstrphlllvggsdafarlydrrmlppltscqkrmspppcvnyfcpmhlsehgrsslhlthvtfspngEEVLLSYSGEHVYLMDVnhaggramrytvgdaskimsftptlnglelqppihdflQTNIRVRGEVATGLGKCRMLVEIARNsleegkhpyygieaCNEVLEghlsgigpmlRHECLCIRAALLLKRKWKNDAQMAIRDCynarridsssfRAHLYMSEALEQLCKYKEALDFAIAAqcldpsnsvmAEKVENIKKHIAAAEteknnkandggarseprtgrvlsLSDIIYrseansdasqdgprseredsdydeevevdfhtsvpgdegrdveanflhgslnvrihrrgdsaretvdangssgspssssqndripyqpetVIDMKQRYVGhcnvgtdikqasflgqrgdyiasgsddgrwfIWEKQTGRLIKMLLgdeavvncvqchpfdcvvatsgidntikiwtpsasvpsivsggaagpdTADVLEAMESNQRKLsrnrehsl

menfpfhdgsiydMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVRLFNLSrfsgrglddnaitpsalyqCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLRCGAKRsladppkqtlslkscdisstrphLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRGEVATGLGKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEKVENIKKHIAaaeteknnkandggarseprtgrVLSLSDIIYrseansdasqdgprseredsdydeevEVDFHtsvpgdegrdvEANFLHGSLNVRIHRRGDSAREtvdangssgspssssqndriPYQPETVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIasgsddgrwFIWEKQTGRLIKMLLGDEAVVNCVQCHPFDCVVATSGIDNTIKIWTPSASVPSIVSGGAAGPDTADVLEAMEsnqrklsrnrehsl

MENFPFHDGSIYDMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRGEVATGLGKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEKVENIKKHIaaaeteknnkanDGGARSEPRTGRVLSLSDIIYRSEANSDASQDGPrseredsdydeevevdFHTSVPGDEGRDVEANFLHGSLNVRIHRRGDSARETVDANgssgspssssQNDRIPYQPETVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGRLIKMLLGDEAVVNCVQCHPFDCVVATSGIDNTIKIWTPSASVPSIVSGGAAGPDTADVLEAMESNQRKLSRNREHSL

************************************************HQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNPHVVWSA**************************CRNILLDLRCGA****************CDISSTRPHLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRGEVATGLGKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDP**********************************************************************************************FLH*****************************************TVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGRLIKMLLGDEAVVNCVQCHPFDCVVATSGIDNTIKIWTPSASV***********************************

MENFPFHDGSIYDMLDTRHTD****VNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRA*****GDASKIMSFTPTL*****************RVRGEVATGLGKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEKVENIKKHIAAAETEKNNKANDGGARSEPRTGRVLSLSDIIYRSEANS*****G**SEREDSDYDEEVEVDFHTSVPGDEGRDVEANFLHGSLNVRIHRRGDSARETVDAN***********NDRIPYQPETVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGRLIKMLLGDEAVVNCVQCHPFDCVVATSGIDNTIKIWTPSAS************************************

MENFPFHDGSIYDMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHD**************QECRNILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRGEVATGLGKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEKVENIKKHIAAAETEK**************TGRVLSLSDIIYRSE*********************EVEVDFHTSVPGDEGRDVEANFLHGSLNVRIHRRG************************IPYQPETVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGRLIKMLLGDEAVVNCVQCHPFDCVVATSGIDNTIKIWTPSASVPSIVSGGAAGPDTADVLEAMES*************

*ENFPFHDGSIYDMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRGEVATGLGKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEKVENIKKHIAAAETEKNNKANDGGARSEPRTGRVLSLSDIIYRSEANSDASQDGPRSEREDSDYDEEVEVDFHTSVPGDEGRDVEANFLHGSLNVRIHRRGDSARETVDANGSSGSPSSSSQNDRIPYQPETVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGRLIKMLLGDEAVVNCVQCHPFDCVVATSGIDNTIKIWTPSASVPSIVSGGAAGPDTADVLEAMES*************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MENFPFHDGSIYDMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRGEVATGLGKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEKxxxxxxxxxxxxxxxxxxxxxGGARSEPRTGRVLSLSDIIYRSEANSDASQDGPRSEREDSDYDEEVEVDFHTSVPGDEGRDVEANFLHGSLNVRIHRRGDSARETVDANGSSGSPSSSSQNDRIPYQPETVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGRLIKMLLGDEAVVNCVQCHPFDCVVATSGIDNTIKIWTPSASVPSIVSGGAAGPDTADVLEAMESNQRKLSRNREHSL

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		737	2.2.26 [Sep-21-2011]
Q8N5D0		677	WD and tetratricopeptide	yes	no	0.571	0.621	0.305	1e-45
Q80ZK9		677	WD and tetratricopeptide	yes	no	0.504	0.549	0.295	1e-43
Q9DC22		876	DDB1- and CUL4-associated	no	no	0.390	0.328	0.313	4e-34
Q58WW2		860	DDB1- and CUL4-associated	no	no	0.390	0.334	0.310	9e-34
Q5R9B8		860	DDB1- and CUL4-associated	no	no	0.390	0.334	0.310	1e-33
O94527		809	WD repeat protein iqw1 OS	yes	no	0.458	0.417	0.288	2e-33
Q5R448		597	DDB1- and CUL4-associated	no	no	0.354	0.437	0.288	4e-28
Q5TAQ9		597	DDB1- and CUL4-associated	no	no	0.354	0.437	0.285	3e-27
Q5U2M6		591	DDB1- and CUL4-associated	no	no	0.317	0.395	0.296	4e-27
Q8N7N5		591	DDB1- and CUL4-associated	no	no	0.354	0.441	0.282	1e-26

>sp\|Q8N5D0\|WDTC1_HUMAN WD and tetratricopeptide repeats protein 1 OS=Homo sapiens GN=WDTC1 PE=1 SV=2	Back alignment and function desciption

 Score =  185 bits (469), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 152/497 (30%), Positives = 221/497 (44%), Gaps = 76/497 (15%)

Query: 36  LVRRLSQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSAN 95
            +RRL  E EL+GH GCVN + WN KG LL SGSDD H  VW     K L S+ TGH+AN
Sbjct: 33  FIRRLGLEAELQGHSGCVNCLEWNEKGDLLASGSDDQHTIVWDPLHHKKLLSMHTGHTAN 92

Query: 96  VFCTKFVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAV 155
           +F  KF+P   D ++++GA D++V + +L+                ++  HT RVK++A 
Sbjct: 93  IFSVKFLPHAGDRILITGAADSKVHVHDLT----------VKETIHMFGDHTNRVKRIAT 142

Query: 156 EVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLR--CGAKRSLADPPK 213
               P+  WSA+EDG +RQ+D R+        S H E   +L+DL   CG          
Sbjct: 143 APMWPNTFWSAAEDGLIRQYDLRE-------NSKHSE---VLIDLTEYCG---------- 182

Query: 214 QTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFC----- 268
           Q +  K   ++    + L VG S  F RLYD RM+       K+ SP   V+ FC     
Sbjct: 183 QLVEAKCLTVNPQDNNCLAVGASGPFVRLYDIRMIHNHRKSMKQ-SPSAGVHTFCDRQKP 241

Query: 269 --------------PMHLSEHGR--SSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAG 312
                         P+ L ++      L  T+VTFSPNG E+L++  GE VYL D+ +  
Sbjct: 242 LPDGAAQYYVAGHLPVKLPDYNNRLRVLVATYVTFSPNGTELLVNMGGEQVYLFDLTY-- 299

Query: 313 GRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRG---EVATGLGKCRMLVEI 369
            +   YT     K  S     NG      + + +   + +      +    G     VE+
Sbjct: 300 -KQRPYTFLLPRKCHSSGEVQNGKMSTNGVSNGVSNGLHLHSNGFRLPESRGHVSPQVEL 358

Query: 370 ARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLR--HECLCI--RAALLLKRKWKNDAQM 425
               LE  K       AC +  +        + R  H  +    RAA  +KRKW  D   
Sbjct: 359 P-PYLERVKQQANEAFACQQWTQAIQLYSKAVQRAPHNAMLYGNRAAAYMKRKWDGDHYD 417

Query: 426 AIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEKVEN-- 483
           A+RDC  A  ++    +AH  ++  L +L    EAL      +CLD       E+  +  
Sbjct: 418 ALRDCLKAISLNPCHLKAHFRLARCLFELKYVAEAL------ECLDDFKGKFPEQAHSSA 471

Query: 484 ---IKKHIAAAETEKNN 497
              + + I AA   KN+
Sbjct: 472 CDALGRDITAALFSKND 488

Homo sapiens (taxid: 9606)

>sp\|Q80ZK9\|WDTC1_MOUSE WD and tetratricopeptide repeats protein 1 OS=Mus musculus GN=Wdtc1 PE=1 SV=1	Back alignment and function description

>sp\|Q9DC22\|DCAF6_MOUSE DDB1- and CUL4-associated factor 6 OS=Mus musculus GN=Dcaf6 PE=1 SV=1	Back alignment and function description

>sp\|Q58WW2\|DCAF6_HUMAN DDB1- and CUL4-associated factor 6 OS=Homo sapiens GN=DCAF6 PE=1 SV=1	Back alignment and function description

>sp\|Q5R9B8\|DCAF6_PONAB DDB1- and CUL4-associated factor 6 OS=Pongo abelii GN=DCAF6 PE=2 SV=2	Back alignment and function description

>sp\|O94527\|IQW1_SCHPO WD repeat protein iqw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=iqw1 PE=1 SV=1	Back alignment and function description

>sp\|Q5R448\|DCAF8_PONAB DDB1- and CUL4-associated factor 8 OS=Pongo abelii GN=DCAF8 PE=2 SV=1	Back alignment and function description

>sp\|Q5TAQ9\|DCAF8_HUMAN DDB1- and CUL4-associated factor 8 OS=Homo sapiens GN=DCAF8 PE=1 SV=1	Back alignment and function description

>sp\|Q5U2M6\|DCAF8_RAT DDB1- and CUL4-associated factor 8 OS=Rattus norvegicus GN=Dcaf8 PE=2 SV=1	Back alignment and function description

>sp\|Q8N7N5\|DCAF8_MOUSE DDB1- and CUL4-associated factor 8 OS=Mus musculus GN=Dcaf8 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		737
255545904		761	WD and tetratricopeptide repeat protein,	0.993	0.961	0.782	0.0
224081993		756	predicted protein [Populus trichocarpa]	0.990	0.965	0.795	0.0
302142032		762	unnamed protein product [Vitis vinifera]	0.998	0.965	0.765	0.0
449436964		759	PREDICTED: WD and tetratricopeptide repe	0.994	0.965	0.729	0.0
297811205		755	hypothetical protein ARALYDRAFT_487925 [	0.985	0.961	0.720	0.0
334187604		754	WD and tetratricopeptide repeats protein	0.985	0.962	0.721	0.0
356515704		762	PREDICTED: WD and tetratricopeptide repe	0.990	0.958	0.723	0.0
18416416		757	WD and tetratricopeptide repeats protein	0.986	0.960	0.717	0.0
357465333		758	DDB1- and CUL4-associated factor [Medica	0.987	0.960	0.717	0.0
356508017		762	PREDICTED: WD and tetratricopeptide repe	0.990	0.958	0.720	0.0

>gi\|255545904\|ref\|XP_002514012.1\| WD and tetratricopeptide repeat protein, putative [Ricinus communis] gi\|223547098\|gb\|EEF48595.1\| WD and tetratricopeptide repeat protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score = 1213 bits (3138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/734 (78%), Positives = 649/734 (88%), Gaps = 2/734 (0%)

Query: 1   MENFPFHDGSIYDMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNS 60
           M+   FHDG+IY+ L+TR+ D+R D+NHSLQMHSSL+RRLSQERELEGHQGCVN+I+WNS
Sbjct: 1   MDTCGFHDGNIYNFLETRYFDSRRDINHSLQMHSSLIRRLSQERELEGHQGCVNSIAWNS 60

Query: 61  KGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVR 120
            GSLL+SGSDDT +N+WSYS RKLLHSI+TGHSAN+FCTKF+PETSDELVVSGAGDAEVR
Sbjct: 61  TGSLLVSGSDDTRMNIWSYSGRKLLHSIDTGHSANIFCTKFIPETSDELVVSGAGDAEVR 120

Query: 121 LFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQG 180
           LFNLSR SGRG DDNAI P ALYQCHT+RVKKLAVEVGNP+VVWSASEDGTLRQHD R+ 
Sbjct: 121 LFNLSRLSGRGPDDNAIAPLALYQCHTKRVKKLAVEVGNPNVVWSASEDGTLRQHDLRED 180

Query: 181 SSCPPAGSSHQECRNILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFA 240
           SSCPPAGSS QECRN+LLDLRCGAKRSL DPPKQTL+LKSCDIS+ RPHLLLVGGSDAFA
Sbjct: 181 SSCPPAGSSPQECRNVLLDLRCGAKRSLVDPPKQTLALKSCDISARRPHLLLVGGSDAFA 240

Query: 241 RLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSG 300
           RLYDRRMLPPLTSC+KRM PPPCVNY CPMHLSE GRS LHLTHVTFSP+G+EVLLSYSG
Sbjct: 241 RLYDRRMLPPLTSCRKRMPPPPCVNYICPMHLSERGRSGLHLTHVTFSPSGDEVLLSYSG 300

Query: 301 EHVYLMDVNHAGGRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRGEVATGL 360
           EHVYLM+VNHAGG +M+YT GDASK+M+F P LNGLELQPP  D  +  +R +  VA+ L
Sbjct: 301 EHVYLMNVNHAGGSSMQYTTGDASKLMTFAPILNGLELQPPPSDISKNGLRFKSYVASTL 360

Query: 361 GKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWK 420
            KCR L++ A   L++G + +YGIEACNEVL+ H   I P +RH+CLC RAALLLKRKWK
Sbjct: 361 QKCRKLLQFAEKCLDDGANFFYGIEACNEVLDRHGRDISPAIRHDCLCTRAALLLKRKWK 420

Query: 421 NDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEK 480
           ND  MAIRDCYNARRIDSSSFRA  YMSEAL QL KYKEALDFA+A+QC+ PS++ +AE 
Sbjct: 421 NDVHMAIRDCYNARRIDSSSFRALYYMSEALSQLGKYKEALDFAVASQCVAPSDTEIAEW 480

Query: 481 VENIKKHIAAAETEKNNKANDGGARSEPRTGRVLSLSDIIYRSEANSDASQDGPRSERED 540
           VENIK ++A AE EK NKANDG  +SE R+GR LSLSDI+YRSEA SD SQDGP +ERE+
Sbjct: 481 VENIKNNLAQAEAEKTNKANDGALKSESRSGRALSLSDILYRSEATSDGSQDGP-TEREE 539

Query: 541 SDYDEEVEVDFHTSVPGDEGRDVEANFLHGSLNVRIHRRGDSARETVDANGSSGSPSSSS 600
           SDYDEE+E+DF TS+ GDEGRD+E N LHGSLN+RIHRRGDS+RET   NGS GSP SSS
Sbjct: 540 SDYDEELELDFETSISGDEGRDIEPNTLHGSLNLRIHRRGDSSRETSCTNGSCGSP-SSS 598

Query: 601 QNDRIPYQPETVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGR 660
            NDR+PYQPETVIDMKQR+VGHCNVGTDIKQASFLG+RG+Y+ASGSDDGRWFIWEKQTGR
Sbjct: 599 HNDRMPYQPETVIDMKQRFVGHCNVGTDIKQASFLGERGEYVASGSDDGRWFIWEKQTGR 658

Query: 661 LIKMLLGDEAVVNCVQCHPFDCVVATSGIDNTIKIWTPSASVPSIVSGGAAGPDTADVLE 720
           LIKMLLGDEAV+NCVQ HPFDCVVATSGIDNTIKIWTP+ASVPS V+GG+AGP+T+DVL+
Sbjct: 659 LIKMLLGDEAVLNCVQSHPFDCVVATSGIDNTIKIWTPTASVPSNVAGGSAGPETSDVLD 718

Query: 721 AMESNQRKLSRNRE 734
            MESNQR+LS NRE
Sbjct: 719 VMESNQRRLSHNRE 732

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224081993\|ref\|XP_002306549.1\| predicted protein [Populus trichocarpa] gi\|222855998\|gb\|EEE93545.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|302142032\|emb\|CBI19235.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449436964\|ref\|XP_004136262.1\| PREDICTED: WD and tetratricopeptide repeats protein 1-like [Cucumis sativus] gi\|449497029\|ref\|XP_004160293.1\| PREDICTED: WD and tetratricopeptide repeats protein 1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|297811205\|ref\|XP_002873486.1\| hypothetical protein ARALYDRAFT_487925 [Arabidopsis lyrata subsp. lyrata] gi\|297319323\|gb\|EFH49745.1\| hypothetical protein ARALYDRAFT_487925 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|334187604\|ref\|NP_001190286.1\| WD and tetratricopeptide repeats protein 1 [Arabidopsis thaliana] gi\|8979728\|emb\|CAB96849.1\| putative protein [Arabidopsis thaliana] gi\|332004229\|gb\|AED91612.1\| WD and tetratricopeptide repeats protein 1 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|356515704\|ref\|XP_003526538.1\| PREDICTED: WD and tetratricopeptide repeats protein 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|18416416\|ref\|NP_568242.1\| WD and tetratricopeptide repeats protein 1 [Arabidopsis thaliana] gi\|14532680\|gb\|AAK64141.1\| unknown protein [Arabidopsis thaliana] gi\|23297429\|gb\|AAN12885.1\| unknown protein [Arabidopsis thaliana] gi\|332004228\|gb\|AED91611.1\| WD and tetratricopeptide repeats protein 1 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|357465333\|ref\|XP_003602948.1\| DDB1- and CUL4-associated factor [Medicago truncatula] gi\|355491996\|gb\|AES73199.1\| DDB1- and CUL4-associated factor [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356508017\|ref\|XP_003522759.1\| PREDICTED: WD and tetratricopeptide repeats protein 1-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		737
TAIR\|locus:2183735		757	ASG2 "AT5G10940" [Arabidopsis	0.986	0.960	0.682	8.5e-271
UNIPROTKB\|Q8N5D0		677	WDTC1 "WD and tetratricopeptid	0.561	0.611	0.298	8.9e-65
UNIPROTKB\|E2RA21		679	WDTC1 "Uncharacterized protein	0.561	0.609	0.298	9.3e-65
MGI\|MGI:2685541		677	Wdtc1 "WD and tetratricopeptid	0.339	0.369	0.344	1.3e-64
UNIPROTKB\|B6CVL4		678	WDTC1 "Uncharacterized protein	0.561	0.610	0.298	1.5e-64
RGD\|1310362		676	Wdtc1 "WD and tetratricopeptid	0.339	0.369	0.341	2.9e-64
UNIPROTKB\|E1C4X5		671	WDTC1 "Uncharacterized protein	0.347	0.381	0.327	7.1e-63
FB\|FBgn0000057		628	adp "adipose" [Drosophila mela	0.153	0.179	0.508	1.3e-57
POMBASE\|SPBC609.03		809	iqw1 "WD repeat protein, Iqw1"	0.415	0.378	0.307	3.3e-49
UNIPROTKB\|F1NU19		825	F1NU19 "Uncharacterized protei	0.242	0.216	0.338	6.7e-46

TAIR\|locus:2183735 ASG2 "AT5G10940" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2604 (921.7 bits), Expect = 8.5e-271, P = 8.5e-271
 Identities = 506/741 (68%), Positives = 583/741 (78%)

Query:     1 MENFPFHDGSIYDMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNS 60
             M+N  FHDG+I+++L TR  D   +V+  +Q HSSLVRRLSQE+ELEGHQGCVNA++WNS
Sbjct:     1 MDNLSFHDGNIFNLLHTRSQDPSHEVDQRMQFHSSLVRRLSQEQELEGHQGCVNALAWNS 60

Query:    61 KGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVR 120
              GSLLISGSDD  IN+W+YSSRKLLHSI+TGH+AN+FCTKFVPETSDELVVSGAGDAEVR
Sbjct:    61 NGSLLISGSDDLRINIWNYSSRKLLHSIDTGHTANIFCTKFVPETSDELVVSGAGDAEVR 120

Query:   121 LFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQG 180
             LFN SR SGR  DDNAI PSALYQCHTRRVKKLAVE GNP+VVWSASEDGTLRQHDFR+ 
Sbjct:   121 LFNTSRLSGRAEDDNAIIPSALYQCHTRRVKKLAVEPGNPNVVWSASEDGTLRQHDFRES 180

Query:   181 SSCPPAGSSHQECRNILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFA 240
             +SCPPAG++HQECR++LLDLR GAKR+LADPPKQTLSLKSCDIS+TRPHLLLVGGSDAFA
Sbjct:   181 TSCPPAGTAHQECRSVLLDLRSGAKRALADPPKQTLSLKSCDISATRPHLLLVGGSDAFA 240

Query:   241 RLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSG 300
             RLYDRRMLPPL S +KRM PPPCVNYFCPMHLSE GR++LHLTHVTFSPNGEEVLLSYSG
Sbjct:   241 RLYDRRMLPPLASSRKRMPPPPCVNYFCPMHLSERGRTNLHLTHVTFSPNGEEVLLSYSG 300

Query:   301 EHVYLMDVNHA--GGRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRGEVAT 358
             EHVYLM+VN+       M+YT GD   + SF+  L+ +E  P +    Q         AT
Sbjct:   301 EHVYLMNVNNGICSTGIMQYTPGDVDNLFSFSNNLHDVESPPQVSTTPQNGFHRSSNAAT 360

Query:   359 GLGKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRK 418
              + KC  LVEIA+ SLEEG   +Y IEA NEVL+ H + I   LRHECLC RAALLLKRK
Sbjct:   361 -VKKCTELVEIAKWSLEEGTDVFYAIEAANEVLDAHSNDIESALRHECLCTRAALLLKRK 419

Query:   419 WKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMA 478
             WKNDA MA+RDC+NARRID+SSF+AH YMSEAL+QL K KEALDFA AAQ ++PS++ + 
Sbjct:   420 WKNDAHMAVRDCHNARRIDASSFKAHYYMSEALQQLGKCKEALDFATAAQHMNPSDADIV 479

Query:   479 EKVENIKKHIXXXXXXXXXXXXDGGARSEPRTGRVLSLSDIIYRSEANSDASQDGPXXXX 538
              KVE+IK+ +             G       T RVLSLSDI+YRSEANSD+S D      
Sbjct:   480 AKVESIKRDLQAAGAEKNEETGAG-------TTRVLSLSDILYRSEANSDSSHDMSRSER 532

Query:   539 XXXXXXXXXXXXFHTSVPGDEGRDVEANFLHGSLNVRIHRRGDSA--RETVDANXXXXXX 596
                           TS+  DEGRD ++N + GSLN+RIHR GD      TVD        
Sbjct:   533 EDSDYDEELELDIQTSLSDDEGRDTDSNSMRGSLNLRIHRVGDDKPMENTVD--NASSGT 590

Query:   597 XXXXQNDRIPYQPETVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEK 656
                 QNDR  YQPE  IDMK+RYVGHCNVGTDIKQASFLGQRG+YIASGSDDGRWFIWEK
Sbjct:   591 ASSSQNDRTSYQPEGAIDMKRRYVGHCNVGTDIKQASFLGQRGEYIASGSDDGRWFIWEK 650

Query:   657 QTGRLIKMLLGDEAVVNCVQCHPFDCVVATSGIDNTIKIWTPSASVPSIVSGGAAGPDTA 716
             QTGRL+K+L+GDE+V+NC+QCHPFD VVATSGIDNTIKIW+P+ASVPSIV+GG+AGP TA
Sbjct:   651 QTGRLMKVLVGDESVLNCIQCHPFDSVVATSGIDNTIKIWSPTASVPSIVAGGSAGPATA 710

Query:   717 DVLEAMESNQRKLSRNREHSL 737
             +V+E MESNQ+KLSRNRE+ L
Sbjct:   711 NVVEVMESNQQKLSRNRENPL 731

GO:0000166 "nucleotide binding" evidence=ISS

GO:0005737 "cytoplasm" evidence=ISM

GO:0008150 "biological_process" evidence=ND

GO:0005886 "plasma membrane" evidence=IDA

GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS

GO:0009506 "plasmodesma" evidence=IDA

GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA

GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA

GO:0007062 "sister chromatid cohesion" evidence=RCA

GO:0009630 "gravitropism" evidence=RCA

GO:0010413 "glucuronoxylan metabolic process" evidence=RCA

GO:0016246 "RNA interference" evidence=RCA

GO:0031048 "chromatin silencing by small RNA" evidence=RCA

GO:0045132 "meiotic chromosome segregation" evidence=RCA

GO:0045492 "xylan biosynthetic process" evidence=RCA

UNIPROTKB\|Q8N5D0 WDTC1 "WD and tetratricopeptide repeats protein 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RA21 WDTC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

MGI\|MGI:2685541 Wdtc1 "WD and tetratricopeptide repeats 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|B6CVL4 WDTC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

RGD\|1310362 Wdtc1 "WD and tetratricopeptide repeats 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|E1C4X5 WDTC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

FB\|FBgn0000057 adp "adipose" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

POMBASE\|SPBC609.03 iqw1 "WD repeat protein, Iqw1" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NU19 F1NU19 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	gw1.V.4660.1	hypothetical protein (756 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		737
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	4e-17
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	9e-15
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	1e-13
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	3e-13
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	6e-11
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	5e-10
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	5e-09
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	5e-09
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	1e-08
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	2e-08
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	2e-08
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	3e-08
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	4e-08
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	2e-07
pfam00400		39	pfam00400, WD40, WD domain, G-beta repeat	5e-07
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	6e-07
smart00320		40	smart00320, WD40, WD40 repeats	1e-06
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	8e-06
smart00320		40	smart00320, WD40, WD40 repeats	3e-05
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	4e-05
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	7e-05
pfam00400		39	pfam00400, WD40, WD domain, G-beta repeat	9e-05
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	5e-04
cd00189		100	cd00189, TPR, Tetratricopeptide repeat domain; typ	0.003
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	0.004
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	0.004
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	0.004

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment

Back alignment and domain information

 Score = 82.0 bits (203), Expect = 4e-17
 Identities = 45/219 (20%), Positives = 83/219 (37%), Gaps = 48/219 (21%)

Query: 41  SQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTK 100
              R L+GH G V  ++ ++ G+ L SGS D  I +W   + + + ++ TGH++ V    
Sbjct: 42  ELLRTLKGHTGPVRDVAASADGTYLASGSSDKTIRLWDLETGECVRTL-TGHTSYVSSVA 100

Query: 101 FVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNP 160
           F P     ++ S + D  ++++++                   + HT  V  +A      
Sbjct: 101 FSP--DGRILSSSSRDKTIKVWDVETG----------KCLTTLRGHTDWVNSVAFSPDGT 148

Query: 161 HVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLRCGAKRSLADPPKQTLSLKS 220
            V  S+S+DGT++  D R G                                  TL+  +
Sbjct: 149 FVA-SSSQDGTIKLWDLRTGK------------------------------CVATLTGHT 177

Query: 221 CDISSTRPH----LLLVGGSDAFARLYDRRMLPPLTSCQ 255
            +++S         LL   SD   +L+D      L + +
Sbjct: 178 GEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLR 216

Length = 289

Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

Back alignment and domain information

>gnl\|CDD\|201208 pfam00400, WD40, WD domain, G-beta repeat	Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|197651 smart00320, WD40, WD40 repeats	Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|197651 smart00320, WD40, WD40 repeats	Back alignment and domain information

Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|201208 pfam00400, WD40, WD domain, G-beta repeat	Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here

Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		737
KOG1310		758	consensus WD40 repeat protein [General function pr	100.0
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	100.0
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	100.0
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	100.0
KOG0286		343	consensus G-protein beta subunit [General function	100.0
KOG0315		311	consensus G-protein beta subunit-like protein (con	100.0
KOG0319		775	consensus WD40-repeat-containing subunit of the 18	100.0
KOG0293		519	consensus WD40 repeat-containing protein [Function	100.0
KOG0282		503	consensus mRNA splicing factor [Function unknown]	100.0
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	100.0
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	100.0
KOG0318		603	consensus WD40 repeat stress protein/actin interac	100.0
KOG0319		775	consensus WD40-repeat-containing subunit of the 18	100.0
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	100.0
KOG0315		311	consensus G-protein beta subunit-like protein (con	100.0
KOG0279		315	consensus G protein beta subunit-like protein [Sig	100.0
KOG0284		464	consensus Polyadenylation factor I complex, subuni	100.0
KOG0295		406	consensus WD40 repeat-containing protein [Function	100.0
KOG0318		603	consensus WD40 repeat stress protein/actin interac	100.0
KOG0263		707	consensus Transcription initiation factor TFIID, s	100.0
KOG0316		307	consensus Conserved WD40 repeat-containing protein	100.0
KOG0266		456	consensus WD40 repeat-containing protein [General	100.0
KOG0645		312	consensus WD40 repeat protein [General function pr	100.0
KOG0296		399	consensus Angio-associated migratory cell protein	100.0
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	100.0
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	100.0
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	100.0
PLN00181		793	protein SPA1-RELATED; Provisional	100.0
KOG0313		423	consensus Microtubule binding protein YTM1 (contai	100.0
KOG0286		343	consensus G-protein beta subunit [General function	100.0
KOG0278		334	consensus Serine/threonine kinase receptor-associa	100.0
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	100.0
KOG0279		315	consensus G protein beta subunit-like protein [Sig	99.98
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	99.98
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	99.97
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	99.97
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	99.97
KOG0295		406	consensus WD40 repeat-containing protein [Function	99.97
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	99.97
KOG0263		707	consensus Transcription initiation factor TFIID, s	99.97
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	99.97
KOG0292		1202	consensus Vesicle coat complex COPI, alpha subunit	99.97
KOG0284		464	consensus Polyadenylation factor I complex, subuni	99.97
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	99.97
KOG0277		311	consensus Peroxisomal targeting signal type 2 rece	99.97
KOG0640		430	consensus mRNA cleavage stimulating factor complex	99.97
KOG1408		1080	consensus WD40 repeat protein [Function unknown]	99.96
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	99.96
KOG0275		508	consensus Conserved WD40 repeat-containing protein	99.96
KOG1407		313	consensus WD40 repeat protein [Function unknown]	99.96
KOG0288		459	consensus WD40 repeat protein TipD [General functi	99.96
KOG0283		712	consensus WD40 repeat-containing protein [Function	99.96
KOG1334		559	consensus WD40 repeat protein [General function pr	99.96
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	99.96
KOG1539		910	consensus WD repeat protein [General function pred	99.96
KOG1063		764	consensus RNA polymerase II elongator complex, sub	99.96
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	99.96
PLN00181		793	protein SPA1-RELATED; Provisional	99.96
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	99.96
KOG0292		1202	consensus Vesicle coat complex COPI, alpha subunit	99.96
KOG0266		456	consensus WD40 repeat-containing protein [General	99.96
KOG0772		641	consensus Uncharacterized conserved protein, conta	99.95
KOG0645		312	consensus WD40 repeat protein [General function pr	99.95
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	99.95
KOG0316		307	consensus Conserved WD40 repeat-containing protein	99.95
KOG0296		399	consensus Angio-associated migratory cell protein	99.95
KOG0643		327	consensus Translation initiation factor 3, subunit	99.94
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	99.94
KOG0641		350	consensus WD40 repeat protein [General function pr	99.94
KOG0973		942	consensus Histone transcription regulator HIRA, WD	99.94
KOG0310		487	consensus Conserved WD40 repeat-containing protein	99.94
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	99.94
KOG0277		311	consensus Peroxisomal targeting signal type 2 rece	99.94
KOG1273		405	consensus WD40 repeat protein [General function pr	99.94
PTZ00421		493	coronin; Provisional	99.94
KOG0294		362	consensus WD40 repeat-containing protein [Function	99.94
PTZ00421		493	coronin; Provisional	99.93
KOG0321		720	consensus WD40 repeat-containing protein L2DTL [Fu	99.93
KOG1539		910	consensus WD repeat protein [General function pred	99.93
KOG0282		503	consensus mRNA splicing factor [Function unknown]	99.93
KOG0278		334	consensus Serine/threonine kinase receptor-associa	99.93
KOG0283		712	consensus WD40 repeat-containing protein [Function	99.93
PTZ00420		568	coronin; Provisional	99.93
KOG1407		313	consensus WD40 repeat protein [Function unknown]	99.93
KOG0289		506	consensus mRNA splicing factor [General function p	99.93
KOG0301		745	consensus Phospholipase A2-activating protein (con	99.93
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	99.93
KOG0293		519	consensus WD40 repeat-containing protein [Function	99.93
KOG1036		323	consensus Mitotic spindle checkpoint protein BUB3,	99.93
KOG0300		481	consensus WD40 repeat-containing protein [Function	99.92
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	99.92
KOG0264		422	consensus Nucleosome remodeling factor, subunit CA	99.92
KOG0275		508	consensus Conserved WD40 repeat-containing protein	99.92
KOG0647		347	consensus mRNA export protein (contains WD40 repea	99.92
PTZ00420		568	coronin; Provisional	99.92
KOG0288		459	consensus WD40 repeat protein TipD [General functi	99.92
KOG0264		422	consensus Nucleosome remodeling factor, subunit CA	99.92
KOG0313		423	consensus Microtubule binding protein YTM1 (contai	99.92
KOG2445		361	consensus Nuclear pore complex component (sc Seh1)	99.92
KOG0289		506	consensus mRNA splicing factor [General function p	99.91
KOG1332		299	consensus Vesicle coat complex COPII, subunit SEC1	99.91
KOG0643		327	consensus Translation initiation factor 3, subunit	99.91
KOG4283		397	consensus Transcription-coupled repair protein CSA	99.91
KOG2106		626	consensus Uncharacterized conserved protein, conta	99.91
KOG0310		487	consensus Conserved WD40 repeat-containing protein	99.91
KOG0650		733	consensus WD40 repeat nucleolar protein Bop1, invo	99.91
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	99.91
KOG0299		479	consensus U3 snoRNP-associated protein (contains W	99.9
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	99.9
KOG0646		476	consensus WD40 repeat protein [General function pr	99.9
KOG0294		362	consensus WD40 repeat-containing protein [Function	99.9
KOG0640		430	consensus mRNA cleavage stimulating factor complex	99.9
KOG0308		735	consensus Conserved WD40 repeat-containing protein	99.9
KOG4227		609	consensus WD40 repeat protein [General function pr	99.9
KOG0772		641	consensus Uncharacterized conserved protein, conta	99.89
KOG1063		764	consensus RNA polymerase II elongator complex, sub	99.89
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	99.89
KOG1332		299	consensus Vesicle coat complex COPII, subunit SEC1	99.89
KOG2106		626	consensus Uncharacterized conserved protein, conta	99.89
KOG0299		479	consensus U3 snoRNP-associated protein (contains W	99.89
KOG2096		420	consensus WD40 repeat protein [General function pr	99.88
KOG0639		705	consensus Transducin-like enhancer of split protei	99.88
KOG0269		839	consensus WD40 repeat-containing protein [Function	99.88
KOG0647		347	consensus mRNA export protein (contains WD40 repea	99.88
KOG4328		498	consensus WD40 protein [Function unknown]	99.88
KOG0646		476	consensus WD40 repeat protein [General function pr	99.88
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.88
KOG0321		720	consensus WD40 repeat-containing protein L2DTL [Fu	99.87
KOG0269		839	consensus WD40 repeat-containing protein [Function	99.87
KOG0308		735	consensus Conserved WD40 repeat-containing protein	99.87
KOG0973		942	consensus Histone transcription regulator HIRA, WD	99.87
KOG2048		691	consensus WD40 repeat protein [General function pr	99.86
KOG2055		514	consensus WD40 repeat protein [General function pr	99.86
KOG0641		350	consensus WD40 repeat protein [General function pr	99.86
KOG1274		933	consensus WD40 repeat protein [General function pr	99.86
KOG0300		481	consensus WD40 repeat-containing protein [Function	99.85
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	99.85
KOG0267		825	consensus Microtubule severing protein katanin p80	99.85
KOG1036		323	consensus Mitotic spindle checkpoint protein BUB3,	99.85
KOG0302		440	consensus Ribosome Assembly protein [General funct	99.85
KOG0270		463	consensus WD40 repeat-containing protein [Function	99.84
KOG0302		440	consensus Ribosome Assembly protein [General funct	99.84
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.84
KOG2445		361	consensus Nuclear pore complex component (sc Seh1)	99.84
KOG0267		825	consensus Microtubule severing protein katanin p80	99.83
KOG0322		323	consensus G-protein beta subunit-like protein GNB1	99.83
KOG1408		1080	consensus WD40 repeat protein [Function unknown]	99.82
KOG4283		397	consensus Transcription-coupled repair protein CSA	99.82
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	99.82
KOG0301		745	consensus Phospholipase A2-activating protein (con	99.81
KOG1009		434	consensus Chromatin assembly complex 1 subunit B/C	99.8
KOG2096		420	consensus WD40 repeat protein [General function pr	99.78
KOG0642		577	consensus Cell-cycle nuclear protein, contains WD-	99.78
KOG0307		1049	consensus Vesicle coat complex COPII, subunit SEC3	99.78
KOG1188		376	consensus WD40 repeat protein [General function pr	99.78
KOG1034		385	consensus Transcriptional repressor EED/ESC/FIE, r	99.77
KOG0307		1049	consensus Vesicle coat complex COPII, subunit SEC3	99.77
KOG0639		705	consensus Transducin-like enhancer of split protei	99.76
KOG1273		405	consensus WD40 repeat protein [General function pr	99.76
KOG1034		385	consensus Transcriptional repressor EED/ESC/FIE, r	99.76
KOG1274		933	consensus WD40 repeat protein [General function pr	99.76
KOG2048		691	consensus WD40 repeat protein [General function pr	99.76
KOG0270		463	consensus WD40 repeat-containing protein [Function	99.75
KOG4328		498	consensus WD40 protein [Function unknown]	99.75
KOG1963		792	consensus WD40 repeat protein [General function pr	99.75
KOG0303		472	consensus Actin-binding protein Coronin, contains	99.74
KOG1007		370	consensus WD repeat protein TSSC1, WD repeat super	99.74
KOG0290		364	consensus Conserved WD40 repeat-containing protein	99.73
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	99.73
KOG0644		1113	consensus Uncharacterized conserved protein, conta	99.73
KOG0290		364	consensus Conserved WD40 repeat-containing protein	99.7
KOG2055		514	consensus WD40 repeat protein [General function pr	99.7
KOG0642		577	consensus Cell-cycle nuclear protein, contains WD-	99.7
KOG1188		376	consensus WD40 repeat protein [General function pr	99.7
COG2319		466	FOG: WD40 repeat [General function prediction only	99.7
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	99.69
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	99.68
KOG1587		555	consensus Cytoplasmic dynein intermediate chain [C	99.67
COG2319		466	FOG: WD40 repeat [General function prediction only	99.67
KOG0650		733	consensus WD40 repeat nucleolar protein Bop1, invo	99.66
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	99.66
PRK11028		330	6-phosphogluconolactonase; Provisional	99.66
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	99.65
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	99.63
KOG1009		434	consensus Chromatin assembly complex 1 subunit B/C	99.63
KOG1007		370	consensus WD repeat protein TSSC1, WD repeat super	99.63
KOG0303		472	consensus Actin-binding protein Coronin, contains	99.63
KOG1523		361	consensus Actin-related protein Arp2/3 complex, su	99.63
KOG1587		555	consensus Cytoplasmic dynein intermediate chain [C	99.62
KOG0644		1113	consensus Uncharacterized conserved protein, conta	99.61
KOG1524		737	consensus WD40 repeat-containing protein CHE-2 [Ge	99.59
KOG4497		447	consensus Uncharacterized conserved protein WDR8,	99.58
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	99.55
KOG0322		323	consensus G-protein beta subunit-like protein GNB1	99.53
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	99.52
PRK01742		429	tolB translocation protein TolB; Provisional	99.52
KOG0771		398	consensus Prolactin regulatory element-binding pro	99.51
KOG0649		325	consensus WD40 repeat protein [General function pr	99.5
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	99.49
PRK01742		429	tolB translocation protein TolB; Provisional	99.49
KOG1310		758	consensus WD40 repeat protein [General function pr	99.49
KOG4227		609	consensus WD40 repeat protein [General function pr	99.48
KOG1963		792	consensus WD40 repeat protein [General function pr	99.48
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	99.46
PRK11028		330	6-phosphogluconolactonase; Provisional	99.45
KOG0649		325	consensus WD40 repeat protein [General function pr	99.43
KOG2110		391	consensus Uncharacterized conserved protein, conta	99.4
KOG1524		737	consensus WD40 repeat-containing protein CHE-2 [Ge	99.4
KOG2110		391	consensus Uncharacterized conserved protein, conta	99.38
KOG3881		412	consensus Uncharacterized conserved protein [Funct	99.38
KOG2394		636	consensus WD40 protein DMR-N9 [General function pr	99.37
KOG1523		361	consensus Actin-related protein Arp2/3 complex, su	99.36
KOG1334		559	consensus WD40 repeat protein [General function pr	99.34
KOG1272		545	consensus WD40-repeat-containing subunit of the 18	99.33
PRK04922		433	tolB translocation protein TolB; Provisional	99.33
KOG0771		398	consensus Prolactin regulatory element-binding pro	99.33
PRK03629		429	tolB translocation protein TolB; Provisional	99.32
KOG3881		412	consensus Uncharacterized conserved protein [Funct	99.31
KOG2139		445	consensus WD40 repeat protein [General function pr	99.31
PRK03629		429	tolB translocation protein TolB; Provisional	99.31
KOG1354		433	consensus Serine/threonine protein phosphatase 2A,	99.31
PRK02889		427	tolB translocation protein TolB; Provisional	99.28
KOG2394		636	consensus WD40 protein DMR-N9 [General function pr	99.27
PRK05137		435	tolB translocation protein TolB; Provisional	99.27
KOG2111		346	consensus Uncharacterized conserved protein, conta	99.26
PRK04922		433	tolB translocation protein TolB; Provisional	99.24
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	99.21
KOG2111		346	consensus Uncharacterized conserved protein, conta	99.19
KOG2321		703	consensus WD40 repeat protein [General function pr	99.19
KOG4497		447	consensus Uncharacterized conserved protein WDR8,	99.17
KOG2139		445	consensus WD40 repeat protein [General function pr	99.16
PRK02889		427	tolB translocation protein TolB; Provisional	99.15
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	99.15
KOG0280		339	consensus Uncharacterized conserved protein [Amino	99.13
KOG1272		545	consensus WD40-repeat-containing subunit of the 18	99.12
KOG0974		967	consensus WD-repeat protein WDR6, WD repeat superf	99.11
KOG2321		703	consensus WD40 repeat protein [General function pr	99.1
KOG2315		566	consensus Predicted translation initiation factor	99.08
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	99.07
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	99.05
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	99.05
KOG1409		404	consensus Uncharacterized conserved protein, conta	99.05
KOG0309		1081	consensus Conserved WD40 repeat-containing protein	99.04
KOG0974		967	consensus WD-repeat protein WDR6, WD repeat superf	99.04
PRK04792		448	tolB translocation protein TolB; Provisional	99.04
PRK00178		430	tolB translocation protein TolB; Provisional	99.03
PRK05137		435	tolB translocation protein TolB; Provisional	99.03
KOG0280		339	consensus Uncharacterized conserved protein [Amino	99.02
KOG1354		433	consensus Serine/threonine protein phosphatase 2A,	99.0
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	98.97
KOG1064		2439	consensus RAVE (regulator of V-ATPase assembly) co	98.97
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	98.93
COG5170		460	CDC55 Serine/threonine protein phosphatase 2A, reg	98.92
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	98.86
KOG1409		404	consensus Uncharacterized conserved protein, conta	98.86
KOG4532		344	consensus WD40-like repeat containing protein [Gen	98.86
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	98.84
PRK01029		428	tolB translocation protein TolB; Provisional	98.84
KOG1912		1062	consensus WD40 repeat protein [General function pr	98.82
KOG4547		541	consensus WD40 repeat-containing protein [General	98.79
KOG4547		541	consensus WD40 repeat-containing protein [General	98.74
KOG4190		1034	consensus Uncharacterized conserved protein [Funct	98.72
KOG1912		1062	consensus WD40 repeat protein [General function pr	98.72
KOG2314		698	consensus Translation initiation factor 3, subunit	98.71
KOG4714		319	consensus Nucleoporin [Nuclear structure]	98.69
PRK00178		430	tolB translocation protein TolB; Provisional	98.69
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	98.68
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	98.67
KOG0882		558	consensus Cyclophilin-related peptidyl-prolyl cis-	98.66
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	98.65
PRK04792		448	tolB translocation protein TolB; Provisional	98.65
KOG1064		2439	consensus RAVE (regulator of V-ATPase assembly) co	98.64
KOG3914		390	consensus WD repeat protein WDR4 [Function unknown	98.63
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	98.62
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	98.62
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	98.6
KOG1832		1516	consensus HIV-1 Vpr-binding protein [Cell cycle co	98.59
KOG0309		1081	consensus Conserved WD40 repeat-containing protein	98.57
KOG4714		319	consensus Nucleoporin [Nuclear structure]	98.55
KOG2315		566	consensus Predicted translation initiation factor	98.55
KOG4532		344	consensus WD40-like repeat containing protein [Gen	98.51
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	98.51
KOG4190		1034	consensus Uncharacterized conserved protein [Funct	98.5
KOG3914		390	consensus WD repeat protein WDR4 [Function unknown	98.48
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	98.47
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	98.45
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	98.41
KOG2695		425	consensus WD40 repeat protein [General function pr	98.37
KOG1275		1118	consensus PAB-dependent poly(A) ribonuclease, subu	98.33
COG4946		668	Uncharacterized protein related to the periplasmic	98.31
KOG2041		1189	consensus WD40 repeat protein [General function pr	98.29
COG5170		460	CDC55 Serine/threonine protein phosphatase 2A, reg	98.29
KOG2041		1189	consensus WD40 repeat protein [General function pr	98.28
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	98.28
KOG1275		1118	consensus PAB-dependent poly(A) ribonuclease, subu	98.27
PRK01029		428	tolB translocation protein TolB; Provisional	98.26
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	98.26
PRK04043		419	tolB translocation protein TolB; Provisional	98.22
KOG2314		698	consensus Translation initiation factor 3, subunit	98.22
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	98.21
KOG2695		425	consensus WD40 repeat protein [General function pr	98.14
KOG2066		846	consensus Vacuolar assembly/sorting protein VPS41	98.13
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	98.11
COG4946		668	Uncharacterized protein related to the periplasmic	98.08
KOG2066		846	consensus Vacuolar assembly/sorting protein VPS41	98.07
KOG0882		558	consensus Cyclophilin-related peptidyl-prolyl cis-	98.07
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	98.06
PRK04043		419	tolB translocation protein TolB; Provisional	98.0
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	98.0
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	97.96
smart00320		40	WD40 WD40 repeats. Note that these repeats are per	97.95
KOG1008		783	consensus Uncharacterized conserved protein, conta	97.94
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	97.94
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	97.9
PF06977		248	SdiA-regulated: SdiA-regulated; InterPro: IPR00972	97.87
KOG1008		783	consensus Uncharacterized conserved protein, conta	97.77
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	97.65
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	97.63
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	97.6
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	97.6
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	97.55
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	97.49
KOG3621		726	consensus WD40 repeat-containing protein [General	97.47
smart00320		40	WD40 WD40 repeats. Note that these repeats are per	97.39
KOG1920		1265	consensus IkappaB kinase complex, IKAP component [	97.37
KOG1832		1516	consensus HIV-1 Vpr-binding protein [Cell cycle co	97.36
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	97.23
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	97.14
PF14783		111	BBS2_Mid: Ciliary BBSome complex subunit 2, middle	97.11
KOG4640		665	consensus Anaphase-promoting complex (APC), subuni	96.95
KOG4649		354	consensus PQQ (pyrrolo-quinoline quinone) repeat p	96.87
COG3204		316	Uncharacterized protein conserved in bacteria [Fun	96.83
PF08596		395	Lgl_C: Lethal giant larvae(Lgl) like, C-terminal;	96.73
PF04841		410	Vps16_N: Vps16, N-terminal region; InterPro: IPR00	96.67
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	96.51
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	96.47
PF14583		386	Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C	96.43
KOG1920		1265	consensus IkappaB kinase complex, IKAP component [	96.4
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	96.36
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	96.34
PF06977		248	SdiA-regulated: SdiA-regulated; InterPro: IPR00972	96.19
PF08553		794	VID27: VID27 cytoplasmic protein; InterPro: IPR013	96.16
KOG4640		665	consensus Anaphase-promoting complex (APC), subuni	96.13
KOG3621		726	consensus WD40 repeat-containing protein [General	96.08
COG3391		381	Uncharacterized conserved protein [Function unknow	96.03
PRK02888		635	nitrous-oxide reductase; Validated	96.01
PF14783		111	BBS2_Mid: Ciliary BBSome complex subunit 2, middle	96.01
PF12894		47	Apc4_WD40: Anaphase-promoting complex subunit 4 WD	96.01
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	95.94
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	95.91
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	95.88
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	95.74
PF03178		321	CPSF_A: CPSF A subunit region; InterPro: IPR004871	95.74
PF12894		47	Apc4_WD40: Anaphase-promoting complex subunit 4 WD	95.74
PF08596		395	Lgl_C: Lethal giant larvae(Lgl) like, C-terminal;	95.74
PF03178		321	CPSF_A: CPSF A subunit region; InterPro: IPR004871	95.71
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	95.67
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	95.66
PF08553		794	VID27: VID27 cytoplasmic protein; InterPro: IPR013	95.48
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	95.33
PHA02713		557	hypothetical protein; Provisional	95.01
COG3391		381	Uncharacterized conserved protein [Function unknow	94.94
PF04841		410	Vps16_N: Vps16, N-terminal region; InterPro: IPR00	94.83
COG3490		366	Uncharacterized protein conserved in bacteria [Fun	94.83
PRK02888		635	nitrous-oxide reductase; Validated	94.66
KOG2444		238	consensus WD40 repeat protein [General function pr	94.32
KOG4441		571	consensus Proteins containing BTB/POZ and Kelch do	94.29
PF00780		275	CNH: CNH domain; InterPro: IPR001180 Based on sequ	94.06
KOG2079		1206	consensus Vacuolar assembly/sorting protein VPS8 [	93.71
PF12234		631	Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0	93.62
KOG4649		354	consensus PQQ (pyrrolo-quinoline quinone) repeat p	93.56
KOG2079		1206	consensus Vacuolar assembly/sorting protein VPS8 [	93.54
PF05694		461	SBP56: 56kDa selenium binding protein (SBP56); Int	93.29
KOG4441		571	consensus Proteins containing BTB/POZ and Kelch do	93.06
KOG2395		644	consensus Protein involved in vacuole import and d	92.78
KOG0553		304	consensus TPR repeat-containing protein [General f	92.77
KOG1897		1096	consensus Damage-specific DNA binding complex, sub	92.75
KOG2444		238	consensus WD40 repeat protein [General function pr	92.62
COG3490		366	Uncharacterized protein conserved in bacteria [Fun	92.27
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	92.25
cd00216		488	PQQ_DH Dehydrogenases with pyrrolo-quinoline quino	92.16
cd00216		488	PQQ_DH Dehydrogenases with pyrrolo-quinoline quino	92.08
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	92.02
PF07569		219	Hira: TUP1-like enhancer of split; InterPro: IPR01	91.87
KOG4234		271	consensus TPR repeat-containing protein [General f	91.81
PHA02713		557	hypothetical protein; Provisional	91.71
KOG3630		1405	consensus Nuclear pore complex, Nup214/CAN compone	91.64
PF15390		671	DUF4613: Domain of unknown function (DUF4613)	91.43
KOG4499		310	consensus Ca2+-binding protein Regucalcin/SMP30 [I	91.31
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	91.1
PF10313		43	DUF2415: Uncharacterised protein domain (DUF2415);	91.06
PRK13616		591	lipoprotein LpqB; Provisional	90.85
PHA03098		534	kelch-like protein; Provisional	90.52
KOG2395		644	consensus Protein involved in vacuole import and d	90.51
KOG4499		310	consensus Ca2+-binding protein Regucalcin/SMP30 [I	90.35
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	90.12
PF15390		671	DUF4613: Domain of unknown function (DUF4613)	89.5
PF14655		415	RAB3GAP2_N: Rab3 GTPase-activating protein regulat	89.44
PF08728		717	CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans	89.34
PF10313		43	DUF2415: Uncharacterised protein domain (DUF2415);	89.23
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	89.13
PF05694		461	SBP56: 56kDa selenium binding protein (SBP56); Int	89.11
KOG3630		1405	consensus Nuclear pore complex, Nup214/CAN compone	88.87
PF11635		753	Med16: Mediator complex subunit 16; InterPro: IPR0	88.82
PF14655		415	RAB3GAP2_N: Rab3 GTPase-activating protein regulat	88.31
KOG1916		1283	consensus Nuclear protein, contains WD40 repeats [	87.78
PHA02790		480	Kelch-like protein; Provisional	87.73
PF11715		547	Nup160: Nucleoporin Nup120/160; InterPro: IPR02171	86.94
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	86.82
PF00780		275	CNH: CNH domain; InterPro: IPR001180 Based on sequ	86.59
KOG1916		1283	consensus Nuclear protein, contains WD40 repeats [	86.45
PHA03098		534	kelch-like protein; Provisional	86.32
KOG4460		741	consensus Nuclear pore complex, Nup88/rNup84 compo	85.64
PF14583		386	Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C	84.15
TIGR03075		527	PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan	84.0
PRK13616		591	lipoprotein LpqB; Provisional	83.07
PF07676		39	PD40: WD40-like Beta Propeller Repeat; InterPro: I	82.77
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	82.75
PF07569		219	Hira: TUP1-like enhancer of split; InterPro: IPR01	82.23
PF14870		302	PSII_BNR: Photosynthesis system II assembly factor	81.73
PHA02790		480	Kelch-like protein; Provisional	81.39
KOG2247		615	consensus WD40 repeat-containing protein [General	80.85
KOG2377		657	consensus Uncharacterized conserved protein [Funct	80.4

>KOG1310 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=6.4e-62  Score=484.95  Aligned_cols=712  Identities=36%  Similarity=0.509  Sum_probs=564.6

Q ss_pred             CCCCCCCCChhhhhhhccccCCCCCcccccccccccccccccceeecccCCceEEEEEcCCCCEEEEEeCCCcEEEEECC
Q 004679            1 MENFPFHDGSIYDMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYS   80 (737)
Q Consensus         1 ~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~H~~~V~~l~~s~~g~~lasgs~dg~V~vwd~~   80 (737)
                      |-+..|+++.+...|..+-..+.......--..+..++++.+...|.||++.|+|+.|+.+|.+|++|+.|-.+.|||.-
T Consensus         1 M~~vs~s~~~i~rql~~r~~~~~h~~rq~y~~~s~~lrrL~lE~eL~GH~GCVN~LeWn~dG~lL~SGSDD~r~ivWd~~   80 (758)
T KOG1310|consen    1 MSGVSLSDGNILRQLDYRDAFQLHISRQIYMGNSTWLRRLDLEAELTGHTGCVNCLEWNADGELLASGSDDTRLIVWDPF   80 (758)
T ss_pred             CCceeccchhHhhhccccccchhhhHHHHhccccHHHhhcchhhhhccccceecceeecCCCCEEeecCCcceEEeecch
Confidence            66778888887777776665554433331116778899999999999999999999999999999999999999999999


Q ss_pred             CCeEEEEEcccCccceEEEEEeeCCCCCEEEEEECCCcEEEEecCCCCCCCCCCCCCCCceeeccCCCceeEEEEecCCC
Q 004679           81 SRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNP  160 (737)
Q Consensus        81 ~~~~~~~~~~~h~~~V~~v~~sp~~~~~~l~sgs~dg~I~iwd~~~~~~~~~~~~~~~~~~~~~~h~~~v~~l~~~p~~~  160 (737)
                      ..+.++.+..+|...|.|++|.|..+..++++|..|..|+++|+....+...+.+.......+..|...|..|+-.|.++
T Consensus        81 ~~KllhsI~TgHtaNIFsvKFvP~tnnriv~sgAgDk~i~lfdl~~~~~~~~d~~~~~~~~~~~cht~rVKria~~p~~P  160 (758)
T KOG1310|consen   81 EYKLLHSISTGHTANIFSVKFVPYTNNRIVLSGAGDKLIKLFDLDSSKEGGMDHGMEETTRCWSCHTDRVKRIATAPNGP  160 (758)
T ss_pred             hcceeeeeecccccceeEEeeeccCCCeEEEeccCcceEEEEecccccccccccCccchhhhhhhhhhhhhheecCCCCC
Confidence            99999999899999999999999887789999999999999999987777777777778888999999999999999888


Q ss_pred             cEEEEEeCCCcEEEEEcCCCCCCCCCCCCCCccceEEEeccCCceeeccCCCCCccceEEEEEecCCCcEEEEEeCCCcE
Q 004679          161 HVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFA  240 (737)
Q Consensus       161 ~~l~s~s~Dg~I~vwdl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~i~~sp~~~~~l~t~s~Dg~i  240 (737)
                      +.+.+++.||+|+-+|++...........+..+..               .........++..+|.++.+|++|+.|-..
T Consensus       161 htfwsasEDGtirQyDiREph~c~p~~~~~~~l~n---------------y~~~lielk~ltisp~rp~~laVGgsdpfa  225 (758)
T KOG1310|consen  161 HTFWSASEDGTIRQYDIREPHVCNPDEDCPSILVN---------------YNPQLIELKCLTISPSRPYYLAVGGSDPFA  225 (758)
T ss_pred             ceEEEecCCcceeeecccCCccCCccccccHHHHH---------------hchhhheeeeeeecCCCCceEEecCCCchh
Confidence            99999999999999999986544322222222221               122235678999999999999999999999


Q ss_pred             EEEECC-CCCCcccccCCCCCC----CCcccccccccc-CCCCccc---ceeEEEEcCCCCEEEEEeCCCeEEEEEcCCC
Q 004679          241 RLYDRR-MLPPLTSCQKRMSPP----PCVNYFCPMHLS-EHGRSSL---HLTHVTFSPNGEEVLLSYSGEHVYLMDVNHA  311 (737)
Q Consensus       241 ~iwd~~-~~~~~~~~~~~~~~~----~~~~~~~~~~~~-~~~~~~~---~i~~v~~sp~g~~l~~g~~dg~v~iwd~~~~  311 (737)
                      ++||.| ..++...-.....++    .|+++|++.++. ..+....   .++-+.|+|+|..|++.-....|++||+..+
T Consensus       226 rLYD~Rr~lks~~s~~~~~~~pp~~~~cv~yf~p~hlkn~~gn~~~~~~~~t~vtfnpNGtElLvs~~gEhVYlfdvn~~  305 (758)
T KOG1310|consen  226 RLYDRRRVLKSFRSDGTMNTCPPKDCRCVRYFSPGHLKNSQGNLDRYITCCTYVTFNPNGTELLVSWGGEHVYLFDVNED  305 (758)
T ss_pred             hhhhhhhhccCCCCCccccCCCCcccchhheecCccccCcccccccceeeeEEEEECCCCcEEEEeeCCeEEEEEeecCC
Confidence            999954 444443333323333    489999999983 2221111   2577889999999999988889999999997


Q ss_pred             Ccceeeeec------CCCCeeeeecc----CCCCccCCCCCCCccc-ccccccccccccccchhhhHHHHhhhcccCCCC
Q 004679          312 GGRAMRYTV------GDASKIMSFTP----TLNGLELQPPIHDFLQ-TNIRVRGEVATGLGKCRMLVEIARNSLEEGKHP  380 (737)
Q Consensus       312 ~~~~~~~~~------~~~~~~~~~~p----~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  380 (737)
                      +.+...+..      +.......|..    ......+........+ .+.+.. .......++..+.+...+....+...
T Consensus       306 ~~~~~y~~~~~~~~~~~~~~~~lfT~~~~~sN~lh~~en~~~~~tP~sr~hrs-p~~a~~~~~~eL~e~ie~~~~egnd~  384 (758)
T KOG1310|consen  306 KSPTPYFLPIEDSNKKPSKPSLLFTQPLKRSNYLHWYENNFGASTPASRVHRS-PYTAAQPRFYELPENIEKFKTEGNDG  384 (758)
T ss_pred             CCceeecCcccccccCCCCcchhhccccccccccccccCCccccCCccccccC-cccccccchhhchHHHHHHHhhccch
Confidence            765544332      11122222321    1111111111111111 112222 22344555677777777777777666


Q ss_pred             ccchhhhhhhhhcccCCCCCcchhhhhhHHHHHhhhcccccchhhhHHHHHHhhccCCcccchhHHHHHHHHHHhhHHHH
Q 004679          381 YYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEA  460 (737)
Q Consensus       381 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  460 (737)
                      .......+.+.......+.-+....++++|+++++.|.|++|.++|++||+.++.+++..+++|+++.++|..+.+..++
T Consensus       385 ly~~~~~~~i~~~s~a~q~~~~~~~~l~nraa~lmkRkW~~d~~~AlrDch~Alrln~s~~kah~~la~aL~el~r~~ea  464 (758)
T KOG1310|consen  385 LYESIVSGAISHYSRAIQYVPDAIYLLENRAAALMKRKWRGDSYLALRDCHVALRLNPSIQKAHFRLARALNELTRYLEA  464 (758)
T ss_pred             hhhHHHHHHHHHHHHHhhhccchhHHHHhHHHHHHhhhccccHHHHHHhHHhhccCChHHHHHHHHHHHHHHHHhhHHHh
Confidence            55555554444444444444555789999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcccCCCchhhHHHHHHHHhhhhhhhhhcCCCCCCCCCCCCCCcCccccccccccccccCCCCCCCCCCCCCCC
Q 004679          461 LDFAIAAQCLDPSNSVMAEKVENIKKHIAAAETEKNNKANDGGARSEPRTGRVLSLSDIIYRSEANSDASQDGPRSERED  540 (737)
Q Consensus       461 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  540 (737)
                      ......++..+|...-....+..+...+..+..++..-       ....+.||.+..+++.|.+-..+...+...+...+
T Consensus       465 l~~~~alq~~~Ptd~a~~~~v~~l~rDi~aa~~~~~~e-------~~~~~~ri~t~~~~~~r~~~~~~~~~~~~~l~s~d  537 (758)
T KOG1310|consen  465 LSCHWALQMSFPTDVARQNFVLCLPRDISAALFSNPSE-------MIRAFARIDTDLSSVRRFFWIHKVLRGCLLLISSD  537 (758)
T ss_pred             hhhHHHHhhcCchhhhhhhhhhccccchHHHhccCchh-------hhhhhheeccchhhhhhhhhhhhhhhhhhhhhccc
Confidence            99999999999977666667777777776654433222       23356788999999999999999999999999999


Q ss_pred             CCcchhhhhcccCCCCCCCCcccccccccccceeeeccCCCCccccccCCCCCCCCCCCCCCCCCCCCccccccceEEEe
Q 004679          541 SDYDEEVEVDFHTSVPGDEGRDVEANFLHGSLNVRIHRRGDSARETVDANGSSGSPSSSSQNDRIPYQPETVIDMKQRYV  620 (737)
Q Consensus       541 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  620 (737)
                      ...+++.+.+...+....+.+...+|...+.|.+++++.++.+...--...+.....++.++|...+.+........+|.
T Consensus       538 ~~~e~e~p~d~qts~vds~~R~dd~n~~~~~l~~~v~~~~~~~~~~~~~~~~~~~~~ssl~nDe~dyq~E~sydy~~rYv  617 (758)
T KOG1310|consen  538 IYWEQEQPWDSQTSDVDSSQRLDDENGFLTLLEPPVNYENEVESSSGENIVSMYTGHSSLNNDEDDYQDEESYDYASRYV  617 (758)
T ss_pred             ccccccCCCCCCceeccccccccccccccccccCccccccccccccccccccccccccccccchhhcccchhhhHHhhhc
Confidence            99999999999999999999999899999999999999887654443333444455566788999998888889999999


Q ss_pred             eecccccceeeeecccCCCCEEEEecCCCcEEEEEcCcccEEEEeecCCCceEEEEecCCCCeEEEEecCCcEEEEcCCC
Q 004679          621 GHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGRLIKMLLGDEAVVNCVQCHPFDCVVATSGIDNTIKIWTPSA  700 (737)
Q Consensus       621 gh~~~~~~i~~~~~~s~d~~~l~sgs~D~~i~iWd~~t~~~~~~l~gH~~~V~~v~~sp~~~~l~S~~~Dg~i~lW~~~~  700 (737)
                      ||++..++|+.+.|+...|.|+++||.||...||+..+|.++.++.|-...|.|+.-+|..+++||+|.|.+|+||.+..
T Consensus       618 GHCNv~TDIKeanFlGqrgeyiasgSddgr~fiwek~tg~i~av~~gdssivnciqghP~~~~latSgiDstiKIwsp~a  697 (758)
T KOG1310|consen  618 GHCNVTTDIKEANFLGQRGEYIASGSDDGRFFIWEKLTGSILAVIHGDSSIVNCIQGHPRCPTLATSGIDSTIKIWSPEA  697 (758)
T ss_pred             cccccccccccccccccCCCeeeEecCCCceEEeecCCcceEEEeeCchhheeeccCCCCCceeeeccCccceEEecccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCccccCCCCCCChhhHHHHHHHHHHHhhhcccCC
Q 004679          701 SVPSIVSGGAAGPDTADVLEAMESNQRKLSRNREHS  736 (737)
Q Consensus       701 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  736 (737)
                       .|.+...+..+|.+..+.+.++.|||+++|+++..
T Consensus       698 -~p~~~as~~h~pns~~iv~~~e~n~Q~~sR~~~~~  732 (758)
T KOG1310|consen  698 -TPPSGASRNHRPNSYAIVATNEMNRQQGSRDSYIT  732 (758)
T ss_pred             -CCCcccccccCCchhhhhhhhhhhhhhhccCCcch
Confidence             77778888889999999999999999999998754

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG1408 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1334 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

Back alignment and domain information

>KOG0641 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown]	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0300 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]	Back alignment and domain information

>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG4227 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown]	Back alignment and domain information

>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0269 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG4328 consensus WD40 protein [Function unknown]	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown]	Back alignment and domain information

>KOG0269 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0641 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0300 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0302 consensus Ribosome Assembly protein [General function prediction only]	Back alignment and domain information

>KOG0270 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0302 consensus Ribosome Assembly protein [General function prediction only]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG1408 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism]	Back alignment and domain information

>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair]	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1188 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription]	Back alignment and domain information

>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription]	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0270 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG4328 consensus WD40 protein [Function unknown]	Back alignment and domain information

>KOG1963 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton]	Back alignment and domain information

>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown]	Back alignment and domain information

>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown]	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only]	Back alignment and domain information

>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown]	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1188 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton]	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair]	Back alignment and domain information

>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown]	Back alignment and domain information

>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton]	Back alignment and domain information

>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton]	Back alignment and domain information

>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton]	Back alignment and domain information

>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only]	Back alignment and domain information

>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only]	Back alignment and domain information

>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0649 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1310 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4227 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1963 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG0649 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only]	Back alignment and domain information

>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG3881 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only]	Back alignment and domain information

>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton]	Back alignment and domain information

>KOG1334 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG3881 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only]	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown]	Back alignment and domain information

>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown]	Back alignment and domain information

>KOG4532 consensus WD40-like repeat containing protein [General function prediction only]	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1912 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4547 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG4547 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG4190 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1912 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG4714 consensus Nucleoporin [Nuclear structure]	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>KOG3914 consensus WD repeat protein WDR4 [Function unknown]	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG4714 consensus Nucleoporin [Nuclear structure]	Back alignment and domain information

>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG4532 consensus WD40-like repeat containing protein [General function prediction only]	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>KOG4190 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3914 consensus WD repeat protein WDR4 [Function unknown]	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>KOG2695 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair]	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair]	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2695 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>smart00320 WD40 WD40 repeats	Back alignment and domain information

>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators []	Back alignment and domain information

>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>KOG3621 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>smart00320 WD40 WD40 repeats	Back alignment and domain information

>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region	Back alignment and domain information

>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>COG3204 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals	Back alignment and domain information

>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A	Back alignment and domain information

>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators []	Back alignment and domain information

>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins	Back alignment and domain information

>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3621 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>COG3391 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region	Back alignment and domain information

>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit	Back alignment and domain information

>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain	Back alignment and domain information

>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals	Back alignment and domain information

>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit	Back alignment and domain information

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>PHA02713 hypothetical protein; Provisional	Back alignment and domain information

>COG3391 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>COG3490 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>KOG2444 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase	Back alignment and domain information

>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length	Back alignment and domain information

>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea	Back alignment and domain information

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0553 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair]	Back alignment and domain information

>KOG2444 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>COG3490 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases	Back alignment and domain information

>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin	Back alignment and domain information

>KOG4234 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PHA02713 hypothetical protein; Provisional	Back alignment and domain information

>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF15390 DUF4613: Domain of unknown function (DUF4613)	Back alignment and domain information

>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins	Back alignment and domain information

>PRK13616 lipoprotein LpqB; Provisional	Back alignment and domain information

>PHA03098 kelch-like protein; Provisional	Back alignment and domain information

>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>PF15390 DUF4613: Domain of unknown function (DUF4613)	Back alignment and domain information

>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus	Back alignment and domain information

>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes []	Back alignment and domain information

>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea	Back alignment and domain information

>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF11635 Med16: Mediator complex subunit 16; InterPro: IPR021665 Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [],[]	Back alignment and domain information

>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus	Back alignment and domain information

>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>PHA02790 Kelch-like protein; Provisional	Back alignment and domain information

>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase	Back alignment and domain information

>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>PHA03098 kelch-like protein; Provisional	Back alignment and domain information

>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A	Back alignment and domain information

>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family	Back alignment and domain information

>PRK13616 lipoprotein LpqB; Provisional	Back alignment and domain information

>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin	Back alignment and domain information

>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A	Back alignment and domain information

>PHA02790 Kelch-like protein; Provisional	Back alignment and domain information

>KOG2247 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2377 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

Homologous Structure Templates