Citrus Sinensis ID: 004681

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------
MNGEWEKAEKYLSAFTKLDDSNHSKKMFFELRKHKYCEALCRHERTEADSIFRKDLKVFSVSQNRIDCELAELLALKDLRENEQLSGYTNATSSRAKLIDSLKLLVKENRILQDKLIFPCVNNSALSSLIKLICPSFEKETKEELIYLIHQFLNEEEFKETLHKLEQETRVFFDINYFREYITSGEWDNAEKYLSAFTNMNDNTYSAKMFSQIQRQKYLEAVDRQQKLPSDFAERAHLFDDFKVLVERNPMLQDKLKFPSMDKSRLLSLIKQIMDWWVPYCINVMPNANNETISLKDFPTVSNLRYASSILTDKPNQEGRPLDASSGDDSNDSSCFNDNNQSRESTSLPDADSAVCAKSLEKSVNLKLQLINEPSECRTLLLPDNSFGGRVVRLIYSHSGDFLVALTQTATHKLWKWQSNKQSLEEENVNMESQLYQPSSKLVMTNDIAADPKDSISCFALRGSHLFSASGGKISIFSLETFQTLATFANPPPIATYFILLPQDLFAFGFDDSSILVHCPCTKKTKAKLKGHQNRITCLAYSLSLNVLVSSGADAQLCVWDAVGWKKLCSKFLHSFQTGLVPETTIVNHIQFHPDQIHLLSIHEGQIDVYEAPTLNHTSQLVPDKMDLPITYATYSCDGKCIYVSCKSGHVKVFDTSTLELRCQINLTAYAQPGTISLELYPLVIAAHPLEPNRIALGLTNGRVHVIEPLESEVEWGKLPFTDSREFSTTFGSTALE
ccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccccccccccccEEEEEcccccccccccccEEEEcccccccccccccccccccccccccccccEEEEEEcccccEEEEEccccEEEEEEccccccccEEEEccccccccccEEEEEEcccccEEEEEEccccEEEEEccccccccccccccEEEEEEcccccEEEEEEccccccEEEEEEEccccEEEEEEccEEEEEEcccccEEEEEccccccEEEEEEccccEEEEEEccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEcccccccccccccccEEEEEEcccccEEEEEEcccEEEEEcccccEEEEEccccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEccccccccccEEEccccEEEEEEcccccEEEEEEccccEEEEcccccccccccccccccccccccccccccc
ccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHccccccHHHHHHHHHHHHHHHHHccHHHcccccccccHHHHHHHHHHHcccccHccHHHHHHHHHHHHcHHcHHHHHHHHHHHcccEEcHHHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccEEEEEEEEccccccEEEEEcccccccccEEEEEEcccccEEEEEccccEEEEEEEccccccccccccccccccEcccccEEEEcccccccccEEEEEcccccEEEEEcccEEEEEEcccccEEEEcccccccEEEEEEccccEEEEEccccEEEEEEEccccEEEEEccccccEEEEEEcccccEEEEcccccEEEEEEcccccccccEEEEEcccccccccccEEEEEEccccEEEEEEcccEEEEEEcccccEEEEEccccccccEEEEEEcccccEEEEEccccEEEEEEccccEEEEEEccccccccccccccccEEEEEEccccccEEEEEcccccEEEEEccccccccccccccccccccccccccccc
MNGEWEKAEKYLSAFTklddsnhsKKMFFELRKHKYCEALCRHERTEADSIFRKDLKVFSVSQNRIDCELAELLALKDLreneqlsgytnatsSRAKLIDSLKLLVKENRIlqdklifpcvnnsaLSSLIKLICPSFEKETKEELIYLIHQFLNEEEFKETLHKLEQETRVFFDINYFREYITSGEWDNAEKYLSAFTNmndntysaKMFSQIQRQKYLEAVDRQQKLPSDFAERAHLFDDFKVLVernpmlqdklkfpsmdKSRLLSLIKQIMDWWVPYcinvmpnannetislkdfptvsnlryassiltdkpnqegrpldassgddsndsscfndnnqsrestslpdadsAVCAKSLEKSVNLKLQLinepsecrtlllpdnsfggRVVRLIYSHSGDFLVALTQTATHKLWKWQSNKQSLEEENVNmesqlyqpssklvmtndiaadpkdsiscfalrgshlfsasggkisifSLETFQtlatfanpppiatyfillpqdlfafgfddssilvhcpctkktkaklkghqnriTCLAYSLSLNVLVSSGADAQLCVWDAVGWKKLCSKFLHSfqtglvpettIVNHIQFHPDQIHLLsihegqidvyeaptlnhtsqlvpdkmdlpityatyscdgkciyvscksghvkvfdtstLELRCQINltayaqpgtislelyplviaahplepnrialgltngrvhvieplesevewgklpftdsrefsttfgstale
MNGEWEKAEKYLSaftklddsnhSKKMFFELRKHKYCEALCRHErteadsifrkdLKVFSVSQNRIDCELAELLALKDLRENEQlsgytnatssrakLIDSLKLLVKENRILQDKLIFPCVNNSALSSLIKLICPSFEKETKEELIYLIHQFLNEEEFKETLHKLEQETRVFFDINYFREYITSGEWDNAEKYLSAFTNMNDNTYSAKMFSQIQRQKYLEAVDRQQKLPSDFAERAHLFDDFKVLVERnpmlqdklkfpsmDKSRLLSLIKQIMDWWVPYCINVMPNANNETISLKDFPTVSNLRYASsiltdkpnqegRPLDASSGDDSNDSSCFNDNNQsrestslpdaDSAVCAKSLEKSVNLKLQLINEPSECRTLLLPDNSFGGRVVRLIYSHSGDFLVALTQTATHKLWKWQSNKQSLEEENVNMESQLYQPSSKLVMTNDIAADPKDSISCFALRGSHLFSASGGKISIFSLETFQTLATFANPPPIATYFILLPQDLFAFGFDDSSILVHCPCTKKtkaklkghqnRITCLAYSLSLNVLVSSGADAQLCVWDAVGWKKLCSKFLHSFQTGLVPETTIVNHIQFHPDQIHLLSIHEGQIDVYEAPTLNHTSQLVPDKMDLPITYATYSCDGKCIYVSCKSGHVKVFDTSTLELRCQINLTAYAQPGTISLELYPLVIAAHPLEPNRIALGLTNGRVHVIEPLEsevewgklpftdsrefsttfgstale
MNGEWEKAEKYLSAFTKLDDSNHSKKMFFELRKHKYCEALCRHERTEADSIFRKDLKVFSVSQNRIDCELAELLALKDLRENEQLSGYTNATSSRAKLIDSLKLLVKENRILQDKLIFPCVNNSALSSLIKLICPSFEKETKEELIYLIHQFLNEEEFKETLHKLEQETRVFFDINYFREYITSGEWDNAEKYLSAFTNMNDNTYSAKMFSQIQRQKYLEAVDRQQKLPSDFAERAHLFDDFKVLVERNPMLQDKLKFPSMDKSRLLSLIKQIMDWWVPYCINVMPNANNETISLKDFPTVSNLRYASSILTDKPNQEGRPLdassgddsndsscfndnnqsRESTSLPDADSAVCAKSLEKSVNLKLQLINEPSECRTLLLPDNSFGGRVVRLIYSHSGDFLVALTQTATHKLWKWQSNKQSLEEENVNMESQLYQPSSKLVMTNDIAADPKDSISCFALRGSHLFSASGGKISIFSLETFQTLATFANPPPIATYFILLPQDLFAFGFDDSSILVHCPCTKKTKAKLKGHQNRITCLAYSLSLNVLVSSGADAQLCVWDAVGWKKLCSKFLHSFQTGLVPETTIVNHIQFHPDQIHLLSIHEGQIDVYEAPTLNHTSQLVPDKMDLPITYATYSCDGKCIYVSCKSGHVKVFDTSTLELRCQINLTAYAQPGTISLELYPLVIAAHPLEPNRIALGLTNGRVHVIEPLESEVEWGKLPFTDSREFSTTFGSTALE
*************************KMFFELRKHKYCEALCRHERTEADSIFRKDLKVFSVSQNRIDCELAELLALKDLRENEQLSGYTNATSSRAKLIDSLKLLVKENRILQDKLIFPCVNNSALSSLIKLICPSFEKETKEELIYLIHQFLNEEEFKETLHKLEQETRVFFDINYFREYITSGEWDNAEKYLSAFTNMNDNTYSAKMFSQIQRQKYLEAVD******SDFAERAHLFDDFKVLVERNPMLQDKLKFPSMDKSRLLSLIKQIMDWWVPYCINVMPNANNETISLKDFPTVSNLRYA*******************************************************SVNLKLQLINEPSECRTLLLPDNSFGGRVVRLIYSHSGDFLVALTQTATHKLWKWQ*****************************IA***KDSISCFALRGSHLFSASGGKISIFSLETFQTLATFANPPPIATYFILLPQDLFAFGFDDSSILVHCPCTKKTKAKLKGHQNRITCLAYSLSLNVLVSSGADAQLCVWDAVGWKKLCSKFLHSFQTGLVPETTIVNHIQFHPDQIHLLSIHEGQIDVYEAPTLNHTSQLVPDKMDLPITYATYSCDGKCIYVSCKSGHVKVFDTSTLELRCQINLTAYAQPGTISLELYPLVIAAHPLEPNRIALGLTNGRVHVIEPLESEVEWGKLPFT***************
***EWEKAEKYLSAFTKLDDSNHSKKMFFELRKHKYCEAL**HERTEADSIFRKDLKVFSVSQNRIDCELAELLALKDLRENE*************KLIDSLKLLVKENRILQDKLIFPCVNNSALSSLIKLICPSFEKETKEELIYLIHQFLNEEEFKETLHKLEQETRVFFDINYFREYITSGEWDNAEKYLSAFTNMNDNTYSAKMFSQIQRQKYLEAVDRQQKLPSDFAERAHLFDDFKVLVERNPMLQDKLKFPSMDKSRLLSLIKQIMDWWVPYCINVMPNANNETISLKDFPTVSNLRYASSILTDKPNQEGRPLDASSGDDSNDSSCFNDNNQSRESTSLPDADSAVCAKSLEKSVNLKLQLINEPSECRTLLLPDNSFGGRVVRLIYSHSGDFLVALTQTATHKLWKWQSNKQSLEEENVNMESQLYQPSSKLVMTNDIAADPKDSISCFALRGSHLFSASGGKISIFSLETFQTLATFANPPPIATYFILLPQDLFAFGFDDSSILVHCPCTKKTKAKLKGHQNRITCLAYSLSLNVLVSSGADAQLCVWDAVGWKKLCSKFLHSFQTGLVPETTIVNHIQFHPDQIHLLSIHEGQIDVYEAPTLNHTSQLVPDKMDLPITYATYSCDGKCIYVSCKSGHVKVFDTSTLELRCQINLTAYAQPGTISLELYPLVIAAHPLEPNRIALGLTNGRVHVIEPLESEV***********************
********EKYLSAFTKLDDSNHSKKMFFELRKHKYCEALCRHERTEADSIFRKDLKVFSVSQNRIDCELAELLALKDLRENEQLSGYTNATSSRAKLIDSLKLLVKENRILQDKLIFPCVNNSALSSLIKLICPSFEKETKEELIYLIHQFLNEEEFKETLHKLEQETRVFFDINYFREYITSGEWDNAEKYLSAFTNMNDNTYSAKMFSQIQRQKYLEAVDRQQKLPSDFAERAHLFDDFKVLVERNPMLQDKLKFPSMDKSRLLSLIKQIMDWWVPYCINVMPNANNETISLKDFPTVSNLRYASSILTDKP**************************************AVCAKSLEKSVNLKLQLINEPSECRTLLLPDNSFGGRVVRLIYSHSGDFLVALTQTATHKLWKWQSNKQSLEEENVNMESQLYQPSSKLVMTNDIAADPKDSISCFALRGSHLFSASGGKISIFSLETFQTLATFANPPPIATYFILLPQDLFAFGFDDSSILVHCPCTKKTKAKLKGHQNRITCLAYSLSLNVLVSSGADAQLCVWDAVGWKKLCSKFLHSFQTGLVPETTIVNHIQFHPDQIHLLSIHEGQIDVYEAPTLNHTSQLVPDKMDLPITYATYSCDGKCIYVSCKSGHVKVFDTSTLELRCQINLTAYAQPGTISLELYPLVIAAHPLEPNRIALGLTNGRVHVIEPLESEVEWGKLPFTDSREFSTTFGSTALE
*NGEWEKAEKYLSAFTKLDDSNHSKKMFFELRKHKYCEALCRHERTEADSIFRKDLKVFSVSQNRIDCELAELLALKDLRENEQLSGYTNATSSRAKLIDSLKLLVKENRILQDKLIFPCVNNSALSSLIKLICPSFEKETKEELIYLIHQFLNEEEFKETLHKLEQETRVFFDINYFREYITSGEWDNAEKYLSAFTNMNDNTYSAKMFSQIQRQKYLEAVDRQQKLPSDFAERAHLFDDFKVLVERNPMLQDKLKFPSMDKSRLLSLIKQIMDWWVPYCINVMPNANNETISLKDFPTVSNLRYASSILTDKPNQEGRP***************************PDADSAVCAKSLEKSVNLKLQLINEPSECRTLLLPDNSFGGRVVRLIYSHSGDFLVALTQTATHKLWKWQSN******ENVNMESQLYQPSSKLVMTNDIAADPKDSISCFALRGSHLFSASGGKISIFSLETFQTLATFANPPPIATYFILLPQDLFAFGFDDSSILVHCPCTKKTKAKLKGHQNRITCLAYSLSLNVLVSSGADAQLCVWDAVGWKKLCSKFLHSFQTGLVPETTIVNHIQFHPDQIHLLSIHEGQIDVYEAPTLNHTSQLVPDKMDLPITYATYSCDGKCIYVSCKSGHVKVFDTSTLELRCQINLTAYAQPGTISLELYPLVIAAHPLEPNRIALGLTNGRVHVIEPLESEVEWGK*******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNGEWEKAEKYLSAFTKLDDSNHSKKMFFELRKHKYCEALCRHERTEADSIFRKDLKVFSVSQNRIDCELAELLALKDLRENEQLSGYTNATSSRAKLIDSLKLLVKENRILQDKLIFPCVNNSALSSLIKLICPSFEKETKEELIYLIHQFLNEEEFKETLHKLEQETRVFFDINYFREYITSGEWDNAEKYLSAFTNMNDNTYSAKMFSQIQRQKYLEAVDRQQKLPSDFAERAHLFDDFKVLVERNPMLQDKLKFPSMDKSRLLSLIKQIMDWWVPYCINVMPNANNETISLKDFPTVSNLRYASSILTDKPNQEGRPLDASSGDDSNDSSCFNDNNQSRESTSLPDADSAVCAKSLEKSVNLKLQLINEPSECRTLLLPDNSFGGRVVRLIYSHSGDFLVALTQTATHKxxxxxxxxxxxxxxxxxxxxxLYQPSSKLVMTNDIAADPKDSISCFALRGSHLFSASGGKISIFSLETFQTLATFANPPPIATYFILLPQDLFAFGFDDSSILVHCPCTKKTKAKLKGHQNRITCLAYSLSLNVLVSSGADAQLCVWDAVGWKKLCSKFLHSFQTGLVPETTIVNHIQFHPDQIHLLSIHEGQIDVYEAPTLNHTSQLVPDKMDLPITYATYSCDGKCIYVSCKSGHVKVFDTSTLELRCQINLTAYAQPGTISLELYPLVIAAHPLEPNRIALGLTNGRVHVIEPLESEVEWGKLPFTDSREFSTTFGSTALE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query737 2.2.26 [Sep-21-2011]
Q27GK71135 Topless-related protein 4 no no 0.503 0.326 0.468 8e-91
Q94AI71131 Protein TOPLESS OS=Arabid no no 0.535 0.349 0.427 1e-88
Q0WV901120 Topless-related protein 1 no no 0.575 0.378 0.415 2e-88
Q9LRZ01131 Topless-related protein 2 no no 0.480 0.312 0.417 9e-76
Q84JM41108 Topless-related protein 3 no no 0.485 0.323 0.387 2e-73
Q06078 939 U3 small nucleolar RNA-as yes no 0.166 0.130 0.281 0.0002
Q8YTC21258 Uncharacterized WD repeat no no 0.396 0.232 0.221 0.0005
Q0J3D9 1218 Coatomer subunit alpha-3 no no 0.343 0.207 0.218 0.0005
Q54S79 942 WD repeat-containing prot no no 0.233 0.182 0.243 0.0007
Q9AUR7 1218 Coatomer subunit alpha-2 no no 0.347 0.210 0.208 0.0008
>sp|Q27GK7|TPR4_ARATH Topless-related protein 4 OS=Arabidopsis thaliana GN=TPR4 PE=1 SV=2 Back     alignment and function desciption
 Score =  335 bits (859), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 178/380 (46%), Positives = 239/380 (62%), Gaps = 9/380 (2%)

Query: 344  ESTSLPDADSAVCAKSLEKSVNLKLQLINEPSECRTLLLPDNSFGGRVVRLIYSHSGDFL 403
            ++ SLPD    + A   EKS   KL  I+E S+ RTL LPD     RVV+LIY++SG  +
Sbjct: 735  DNRSLPDVKPRI-ADDAEKSKTWKLTEISERSQLRTLRLPDTLLPARVVKLIYTNSGGAI 793

Query: 404  VALTQTATHKLWKWQ-SNKQSLEEENVNMESQLYQPSSKLVMTNDI-AADPKDSISCFAL 461
            +AL + A HKLWKWQ S +  L + N N+  QL+QPSS ++MTND    + +D + CFAL
Sbjct: 794  LALAENAAHKLWKWQKSERNLLGKANSNVPPQLWQPSSGVLMTNDTREGNKEDVVPCFAL 853

Query: 462  --RGSHLFSASGGKISIFSLETFQTLATFANPPPIATYFILLPQD--LFAFGFDDSSILV 517
                S++ SASGGKIS+F++ TF+T+ TF  PPP AT     PQD  + A G DDSSI +
Sbjct: 854  SKNDSYVMSASGGKISLFNMMTFKTMTTFMAPPPAATSLAFHPQDNNIIAIGMDDSSIQI 913

Query: 518  HCPCTKKTKAKLKGHQNRITCLAYSLSLNVLVSSGADAQLCVWDAVGWKKLCSKFLHSFQ 577
            +     + K+KLKGHQ R+T LA+S  LNVLVSSGAD+QLCVW   GW+K  SK +    
Sbjct: 914  YNVRVDEVKSKLKGHQKRVTGLAFSNVLNVLVSSGADSQLCVWSMDGWEKQASKQIQ-IP 972

Query: 578  TGLVPETTIVNHIQFHPDQIHLLSIHEGQIDVYEAPTLNHTSQLVPDKMDLPITYATYSC 637
            +G  P       +QFH DQIH+L +H  Q+ +YEAP L +  Q +P +    +T A YSC
Sbjct: 973  SGHSPNPLAHTRVQFHQDQIHVLVVHASQLAIYEAPKLENMKQWIPKESSGSVTDAVYSC 1032

Query: 638  DGKCIYVSCKSGHVKVFDTSTLELRCQINLTAYAQPGTISLELYPLVIAAHPLEPNRIAL 697
            D + IY +   G V +   +TL+L+C+I   +Y  P   S  +YP  +AAHP EPN+ A+
Sbjct: 1033 DSQSIYAAFDDGSVSILTATTLQLKCRIGPNSYL-PSNPSSRVYPATVAAHPSEPNQFAV 1091

Query: 698  GLTNGRVHVIEPLESEVEWG 717
            GLT+G VHVIEP   E +WG
Sbjct: 1092 GLTDGGVHVIEPPGPEGKWG 1111
Transcriptional corepressor. Negative regulator of jasmonate responses.
Arabidopsis thaliana (taxid: 3702)
>sp|Q94AI7|TPL_ARATH Protein TOPLESS OS=Arabidopsis thaliana GN=TPL PE=1 SV=1 Back     alignment and function description
>sp|Q0WV90|TPR1_ARATH Topless-related protein 1 OS=Arabidopsis thaliana GN=TPR1 PE=1 SV=3 Back     alignment and function description
>sp|Q9LRZ0|TPR2_ARATH Topless-related protein 2 OS=Arabidopsis thaliana GN=TPR2 PE=1 SV=2 Back     alignment and function description
>sp|Q84JM4|TPR3_ARATH Topless-related protein 3 OS=Arabidopsis thaliana GN=TPR3 PE=1 SV=1 Back     alignment and function description
>sp|Q06078|UTP21_YEAST U3 small nucleolar RNA-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP21 PE=1 SV=1 Back     alignment and function description
>sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=4 SV=1 Back     alignment and function description
>sp|Q0J3D9|COPA3_ORYSJ Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 Back     alignment and function description
>sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 Back     alignment and function description
>sp|Q9AUR7|COPA2_ORYSJ Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query737
297821939749 hypothetical protein ARALYDRAFT_901180 [ 0.922 0.907 0.432 1e-158
20197750730 hypothetical protein [Arabidopsis thalia 0.876 0.884 0.397 1e-129
224142595 1126 predicted protein [Populus trichocarpa] 0.530 0.347 0.507 1e-104
224087108 1132 predicted protein [Populus trichocarpa] 0.583 0.379 0.474 1e-103
357478183 1132 WD repeat-containing protein [Medicago t 0.516 0.336 0.510 1e-101
255572487 1134 WD-repeat protein, putative [Ricinus com 0.511 0.332 0.518 1e-100
356562983 1134 PREDICTED: topless-related protein 4-lik 0.531 0.345 0.490 1e-100
356546114 1232 PREDICTED: topless-related protein 4-lik 0.533 0.318 0.492 1e-100
449443059 1134 PREDICTED: topless-related protein 4-lik 0.507 0.329 0.508 1e-100
449517894623 PREDICTED: topless-related protein 4-lik 0.507 0.600 0.508 1e-99
>gi|297821939|ref|XP_002878852.1| hypothetical protein ARALYDRAFT_901180 [Arabidopsis lyrata subsp. lyrata] gi|297324691|gb|EFH55111.1| hypothetical protein ARALYDRAFT_901180 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  564 bits (1454), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 321/742 (43%), Positives = 446/742 (60%), Gaps = 62/742 (8%)

Query: 1   MNGEWEKAEKYLSAFTKLDDSNHSKKMFFELRKHKYCEALCRHERTEADSIFRKDLKVFS 60
           +NG +++A+ YL AFT+ + + +S+KMFF+L K K  EA  R   +EA SIF KDL+   
Sbjct: 49  LNGNFKEADDYLLAFTRPEANTYSRKMFFDLFKRKLSEAPDRSGGSEAVSIFSKDLRRIP 108

Query: 61  VSQNRIDCELAELLALKDLRENEQLSGY--TNATSSRAKLIDSLKLLVKENRILQDKLIF 118
           V ++    +L E++A+ D+R+   L G    +    RAKL   L  L + N  L DKL F
Sbjct: 109 VLKDDSFDDLVEVIAVDDMRQG-ILEGTCCVDKVPGRAKLCVDLHKLAESNPCLCDKLEF 167

Query: 119 PCVNNSALSSLIKLICPSFEKET---KEELIYLIHQFLNEEEFKETLHKLEQETRVFFDI 175
           P +N SAL SLI LICP+        KE+LI LI QFL E ++K TLHKLEQET+VFF++
Sbjct: 168 PSLNKSALLSLISLICPNCSGRNGGLKEDLICLILQFLYEAKYKNTLHKLEQETKVFFNL 227

Query: 176 NYFREYITSGEWDNAEKYLSAFTNMNDNTYSAKMFSQIQRQKYLEAVDRQQKLPS----D 231
           NY  E +  GE+  AE+YL AFT+  DN YS  MF +IQ+   L++ + +   PS    +
Sbjct: 228 NYLAEVMKLGEYGKAEEYLGAFTDSKDNKYSKAMFLEIQKLTCLQSTEWEVATPSGSLDN 287

Query: 232 FAERAHLFDDFKVLVERNPMLQDKLKFPSMDKSRLLSLIKQIMDWWVPYCINVMPNANNE 291
            + +  L     +L ++NP+L+DKLKFPSM+KSRLL+L+KQ MDWW            N 
Sbjct: 288 MSPKIKLHASVAMLAKKNPVLKDKLKFPSMEKSRLLTLMKQTMDWWTS-------RTCNN 340

Query: 292 TISLKDFPTVSNLRYASSILTDKPNQEGRPLDASSGDDSNDSSCFNDNNQSRESTSLPDA 351
           + SL++ P VS L      L  K N+ G+                               
Sbjct: 341 SSSLENVPVVSYLCGTPFSLKKKFNKTGQ------------------------------- 369

Query: 352 DSAVCAKSLEKSVNLKLQLINEPSECRTLLLPDNSFGGRVVRLIYSHSGDFLVALTQTAT 411
                    +K VN K   IN+PS+C  L+LPD      + RL YS SGD+++AL + AT
Sbjct: 370 --------RKKVVNYKPNEINDPSQCNALVLPDYFSEEMIARLTYSPSGDYILALAEDAT 421

Query: 412 HKLWKWQSNKQSLEEENVNMESQLYQPSSKLVMTNDIAADPKDSISCFALRGSHLFSASG 471
           HKLW W S++    +ENV  + +L+QP S   M N++AA  ++S SCFA++GS+LFS SG
Sbjct: 422 HKLWTWSSSQNEFSKENVFPKPRLHQPQSGKTMKNEMAASVQNSTSCFAIKGSYLFSTSG 481

Query: 472 GKISIFSLETFQTLATFANPPPIATYFILLPQDLFAFGFDDSSILVHCPCTKKTKAKLKG 531
           GKI++F L++F+ +A F +P P+ATYFI +P DL A G DD SI +HC  ++K K KL+G
Sbjct: 482 GKIAVFDLKSFEKVAAFGSPTPMATYFIFIPGDLLAVGLDDGSIFIHCLSSRKVKEKLEG 541

Query: 532 HQNRITCLAYSLSLNVLVSSGADAQLCVWDAVGWKKLCSK-FLHSFQTGLVPE-TTIVNH 589
           H  +ITCLA+S   NVLVSS +D +LC+W    W KL SK     F T    E T++V H
Sbjct: 542 HDQKITCLAFSRCFNVLVSSDSDGKLCLWSTKSWVKLTSKNSTRKFCTRSNHESTSLVTH 601

Query: 590 IQFHPDQIHLLSIHEGQIDVYEAPTLNHTSQLVPDKMDLPITYATYSCDGKCIYVSCKSG 649
           IQF P QI LL +HEG I +YEA TL+   Q +PD+ D  IT ATYS DG+ IY   +SG
Sbjct: 602 IQFDPYQIELLVVHEGWIGIYEARTLDCRLQWIPDESDTSITSATYSSDGEIIYAGFRSG 661

Query: 650 HVKVFDTSTLELRCQINLTAYAQPG--TISLELYPLVIAAHPLEPNRIALGLTNGRVHVI 707
            +K+ D+ T    C+IN+T+  QP    I LE+YP V+AAHP  P++I+ GL+NG+V V+
Sbjct: 662 FIKIVDSRTFMTVCRINMTSLTQPSPNNIRLEVYPTVVAAHPSHPSQISAGLSNGKVIVL 721

Query: 708 EPLESEVEWGK-LPFTDSREFS 728
           +PL S   WG+  P  D+ ++S
Sbjct: 722 QPLWSG-GWGEAAPLEDNGDYS 742

Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|20197750|gb|AAD20702.2| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224142595|ref|XP_002324641.1| predicted protein [Populus trichocarpa] gi|222866075|gb|EEF03206.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224087108|ref|XP_002308068.1| predicted protein [Populus trichocarpa] gi|222854044|gb|EEE91591.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357478183|ref|XP_003609377.1| WD repeat-containing protein [Medicago truncatula] gi|355510432|gb|AES91574.1| WD repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255572487|ref|XP_002527178.1| WD-repeat protein, putative [Ricinus communis] gi|223533443|gb|EEF35191.1| WD-repeat protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356562983|ref|XP_003549747.1| PREDICTED: topless-related protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|356546114|ref|XP_003541476.1| PREDICTED: topless-related protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|449443059|ref|XP_004139298.1| PREDICTED: topless-related protein 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449517894|ref|XP_004165979.1| PREDICTED: topless-related protein 4-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query737
TAIR|locus:2040100740 AT2G25420 "AT2G25420" [Arabido 0.484 0.482 0.479 3.6e-148
TAIR|locus:20362041131 TPL "TOPLESS" [Arabidopsis tha 0.510 0.332 0.446 4.7e-116
TAIR|locus:21988881120 TPR1 "TOPLESS-related 1" [Arab 0.510 0.335 0.443 2e-115
TAIR|locus:20867701131 TPR2 "TOPLESS-related 2" [Arab 0.483 0.314 0.416 2.9e-102
WB|WBGene00004895510 smu-1 [Caenorhabditis elegans 0.204 0.296 0.228 1.7e-05
FB|FBgn0027524331 CG3909 [Drosophila melanogaste 0.170 0.380 0.313 5.1e-05
GENEDB_PFALCIPARUM|PFC0365w532 PFC0365w "conserved protein, p 0.256 0.355 0.258 6.9e-05
UNIPROTKB|O77325532 PFC0365w "PRP19-like protein, 0.256 0.355 0.258 6.9e-05
ASPGD|ASPL0000006214434 AN6385 [Emericella nidulans (t 0.291 0.495 0.264 8.5e-05
FB|FBgn0040066361 wds "will die slowly" [Drosoph 0.194 0.396 0.253 0.0006
TAIR|locus:2040100 AT2G25420 "AT2G25420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 887 (317.3 bits), Expect = 3.6e-148, Sum P(2) = 3.6e-148
 Identities = 174/363 (47%), Positives = 240/363 (66%)

Query:   371 INEPSECRTLLLPDNSFGGRVVRLIYSHSGDFLVALTQTATHKLWKWQSNKQSLEEENVN 430
             I +PS+C  L+LPD     ++ RL YS SGD+++AL + ATHKLW W S++    +ENV 
Sbjct:   372 IKDPSQCNALVLPDCFSEEKIARLTYSPSGDYILALAEDATHKLWTWSSSQNEFCKENVY 431

Query:   431 MESQLYQPSSKLVMTNDIAADPKDSISCFALRGSHLFSASGGKISIFSLETFQTLATFAN 490
              + +L+QP S   M N++A   + S SCFA++GS+LFS SGGKI++F L+ F+ +A+F +
Sbjct:   432 PKPRLHQPQSGKTMENEMATSVQKSTSCFAVKGSYLFSTSGGKIAVFDLKNFEKVASFGS 491

Query:   491 PPPIATYFILLPQDLFAFGFDDSSILVHCPCTKKTKAKLKGHQNRITCLAYSLSLNVLVS 550
             P P+ATYFI +P DL A G DD SI +HC  ++K K KL+GH  +ITCLA+S   NVLVS
Sbjct:   492 PTPMATYFIFIPGDLLAVGLDDGSIFIHCLSSRKVKEKLEGHDQKITCLAFSRCFNVLVS 551

Query:   551 SGADAQLCVWDAVGWKKLCSK-FLHSF-QTGLVPETTIVNHIQFHPDQIHLLSIHEGQID 608
             S +D +LC+W    W KL SK     F     +  T++V HIQF P QI LL +H+G I 
Sbjct:   552 SDSDGKLCLWSTKSWVKLTSKNSTRKFCNRSNLESTSLVTHIQFDPYQIELLVVHDGWIG 611

Query:   609 VYEAPTLNHTSQLVPDKMDLPITYATYSCDGKCIYVSCKSGHVKVFDTSTLELRCQINLT 668
             +YE  TL+   Q +PD  D  IT ATYS DG+ IYV  + G +K+ D+ T    CQINLT
Sbjct:   612 LYEVRTLDCRLQWIPDASDPAITSATYSSDGEIIYVGFRCGSIKIVDSKTFMTLCQINLT 671

Query:   669 AYAQPGT--ISLELYPLVIAAHPLEPNRIALGLTNGRVHVIEPLESEVEWGKL-PFTDSR 725
             ++ Q  T  ISLE+YP V+AAHP  PN+I+ GL+NG+V V++PL S   WG+  P  D+ 
Sbjct:   672 SFTQLSTSNISLEVYPTVVAAHPSHPNQISAGLSNGKVIVLQPLWSG-GWGEAAPLEDNG 730

Query:   726 EFS 728
             ++S
Sbjct:   731 DYS 733
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0007267 "cell-cell signaling" evidence=RCA
GO:0009616 "virus induced gene silencing" evidence=RCA
GO:0009855 "determination of bilateral symmetry" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010050 "vegetative phase change" evidence=RCA
GO:0010073 "meristem maintenance" evidence=RCA
GO:0010267 "production of ta-siRNAs involved in RNA interference" evidence=RCA
GO:0031048 "chromatin silencing by small RNA" evidence=RCA
GO:0035196 "production of miRNAs involved in gene silencing by miRNA" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
TAIR|locus:2036204 TPL "TOPLESS" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198888 TPR1 "TOPLESS-related 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086770 TPR2 "TOPLESS-related 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00004895 smu-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0027524 CG3909 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFC0365w PFC0365w "conserved protein, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|O77325 PFC0365w "PRP19-like protein, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
ASPGD|ASPL0000006214 AN6385 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
FB|FBgn0040066 wds "will die slowly" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
scaffold_400681.1
annotation not avaliable (749 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
fgenesh2_kg.8__2735__AT5G66810.1
annotation not avaliable (745 aa)
      • 0.417

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query737
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-13
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-10
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-08
smart0066858 smart00668, CTLH, C-terminal to LisH motif 1e-07
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-07
smart0066858 smart00668, CTLH, C-terminal to LisH motif 2e-06
smart0032040 smart00320, WD40, WD40 repeats 2e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-05
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-05
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-05
smart0066734 smart00667, LisH, Lissencephaly type-1-like homolo 3e-04
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information 
 Score = 70.1 bits (172), Expect = 4e-13
 Identities = 51/218 (23%), Positives = 83/218 (38%), Gaps = 16/218 (7%)

Query: 453 KDSISCFAL--RGSHLFSASG-GKISIFSLETFQTLATFANPPPIATYFILLPQD-LFAF 508
              ++C A    G  L + SG G I ++ LET + L T                    A 
Sbjct: 9   TGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGTYLAS 68

Query: 509 GFDDSSILVHCPCTKKTKAKLKGHQNRITCLAYSLSLNVLVSSGADAQLCVWDAVGWKKL 568
           G  D +I +    T +    L GH + ++ +A+S    +L SS  D  + VWD       
Sbjct: 69  GSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVE--TGK 126

Query: 569 CSKFLHSFQTGLVPETTIVNHIQFHPDQIHLLSIH-EGQIDVYEAPTLNHTSQLVPDKMD 627
           C   L             VN + F PD   + S   +G I +++  T    + L      
Sbjct: 127 CLTTLRGHTDW-------VNSVAFSPDGTFVASSSQDGTIKLWDLRTGKCVATL--TGHT 177

Query: 628 LPITYATYSCDGKCIYVSCKSGHVKVFDTSTLELRCQI 665
             +    +S DG+ +  S   G +K++D ST +    +
Sbjct: 178 GEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTL 215

Length = 289
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|128914 smart00668, CTLH, C-terminal to LisH motif Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|128914 smart00668, CTLH, C-terminal to LisH motif Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|128913 smart00667, LisH, Lissencephaly type-1-like homology motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 737
KOG0293519 consensus WD40 repeat-containing protein [Function 100.0
KOG0275508 consensus Conserved WD40 repeat-containing protein 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0293519 consensus WD40 repeat-containing protein [Function 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0282503 consensus mRNA splicing factor [Function unknown] 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0296399 consensus Angio-associated migratory cell protein 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0275508 consensus Conserved WD40 repeat-containing protein 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 100.0
KOG0316307 consensus Conserved WD40 repeat-containing protein 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0278334 consensus Serine/threonine kinase receptor-associa 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.98
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.97
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.97
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.97
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.97
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.97
KOG0296399 consensus Angio-associated migratory cell protein 99.97
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.97
KOG0283712 consensus WD40 repeat-containing protein [Function 99.97
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.97
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.97
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.97
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.97
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.97
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.97
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.96
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.96
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.96
KOG0643327 consensus Translation initiation factor 3, subunit 99.96
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.96
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.96
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.96
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.96
KOG1539 910 consensus WD repeat protein [General function pred 99.95
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.95
KOG0294362 consensus WD40 repeat-containing protein [Function 99.95
KOG0283 712 consensus WD40 repeat-containing protein [Function 99.95
PTZ00421 493 coronin; Provisional 99.95
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.95
KOG0643327 consensus Translation initiation factor 3, subunit 99.95
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.95
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.95
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.95
KOG0772641 consensus Uncharacterized conserved protein, conta 99.95
KOG0641350 consensus WD40 repeat protein [General function pr 99.95
PTZ00421493 coronin; Provisional 99.95
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.95
KOG0641350 consensus WD40 repeat protein [General function pr 99.95
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.95
KOG0300481 consensus WD40 repeat-containing protein [Function 99.95
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.95
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.95
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.94
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.94
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.94
KOG0289506 consensus mRNA splicing factor [General function p 99.94
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.94
KOG0300481 consensus WD40 repeat-containing protein [Function 99.94
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.94
PTZ00420 568 coronin; Provisional 99.94
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.93
KOG1274 933 consensus WD40 repeat protein [General function pr 99.93
KOG0289506 consensus mRNA splicing factor [General function p 99.93
PTZ00420 568 coronin; Provisional 99.93
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.93
KOG0639705 consensus Transducin-like enhancer of split protei 99.93
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.93
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.93
KOG2096420 consensus WD40 repeat protein [General function pr 99.93
KOG2106626 consensus Uncharacterized conserved protein, conta 99.93
KOG2096420 consensus WD40 repeat protein [General function pr 99.93
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.92
KOG0294362 consensus WD40 repeat-containing protein [Function 99.92
KOG1539 910 consensus WD repeat protein [General function pred 99.92
KOG4283397 consensus Transcription-coupled repair protein CSA 99.92
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.92
KOG2048 691 consensus WD40 repeat protein [General function pr 99.92
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.92
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.92
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.92
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.92
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.91
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.91
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.91
KOG0639705 consensus Transducin-like enhancer of split protei 99.91
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.91
KOG2048 691 consensus WD40 repeat protein [General function pr 99.91
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.91
KOG2055514 consensus WD40 repeat protein [General function pr 99.91
KOG0646 476 consensus WD40 repeat protein [General function pr 99.9
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.9
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.9
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.9
KOG2106 626 consensus Uncharacterized conserved protein, conta 99.9
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.9
KOG1273405 consensus WD40 repeat protein [General function pr 99.9
KOG0646476 consensus WD40 repeat protein [General function pr 99.89
KOG0267 825 consensus Microtubule severing protein katanin p80 99.89
KOG4283397 consensus Transcription-coupled repair protein CSA 99.89
KOG1273405 consensus WD40 repeat protein [General function pr 99.88
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.88
KOG2055514 consensus WD40 repeat protein [General function pr 99.88
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.88
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.88
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.88
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.88
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.88
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.88
KOG4328498 consensus WD40 protein [Function unknown] 99.87
KOG1274 933 consensus WD40 repeat protein [General function pr 99.87
KOG0267 825 consensus Microtubule severing protein katanin p80 99.86
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.86
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.85
KOG0270463 consensus WD40 repeat-containing protein [Function 99.85
KOG0270463 consensus WD40 repeat-containing protein [Function 99.84
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.84
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.83
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.83
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.83
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.83
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.83
KOG0302440 consensus Ribosome Assembly protein [General funct 99.83
KOG0649325 consensus WD40 repeat protein [General function pr 99.82
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.82
KOG4328498 consensus WD40 protein [Function unknown] 99.82
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.81
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.8
KOG0302440 consensus Ribosome Assembly protein [General funct 99.8
KOG4227 609 consensus WD40 repeat protein [General function pr 99.79
COG2319466 FOG: WD40 repeat [General function prediction only 99.79
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.78
COG2319466 FOG: WD40 repeat [General function prediction only 99.78
KOG1963 792 consensus WD40 repeat protein [General function pr 99.78
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.78
KOG1334559 consensus WD40 repeat protein [General function pr 99.78
KOG0649325 consensus WD40 repeat protein [General function pr 99.77
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.77
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.76
KOG0303472 consensus Actin-binding protein Coronin, contains 99.76
KOG1310 758 consensus WD40 repeat protein [General function pr 99.76
KOG1188376 consensus WD40 repeat protein [General function pr 99.75
KOG0303472 consensus Actin-binding protein Coronin, contains 99.74
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.74
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.74
PRK11028330 6-phosphogluconolactonase; Provisional 99.74
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.73
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.72
PRK11028330 6-phosphogluconolactonase; Provisional 99.72
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.72
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.72
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.71
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.71
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.71
KOG2110391 consensus Uncharacterized conserved protein, conta 99.7
KOG1188376 consensus WD40 repeat protein [General function pr 99.7
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.69
KOG1963 792 consensus WD40 repeat protein [General function pr 99.68
KOG2110 391 consensus Uncharacterized conserved protein, conta 99.68
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.67
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.67
KOG4227 609 consensus WD40 repeat protein [General function pr 99.67
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.66
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.66
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.65
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.65
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.64
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.63
PRK01742429 tolB translocation protein TolB; Provisional 99.63
KOG2321 703 consensus WD40 repeat protein [General function pr 99.62
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.61
KOG0771398 consensus Prolactin regulatory element-binding pro 99.61
PRK01742429 tolB translocation protein TolB; Provisional 99.6
KOG0771398 consensus Prolactin regulatory element-binding pro 99.6
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 99.6
KOG2139445 consensus WD40 repeat protein [General function pr 99.6
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.59
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.57
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.57
KOG2139445 consensus WD40 repeat protein [General function pr 99.56
KOG1334559 consensus WD40 repeat protein [General function pr 99.56
KOG2111346 consensus Uncharacterized conserved protein, conta 99.55
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.53
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 99.53
KOG2111346 consensus Uncharacterized conserved protein, conta 99.53
KOG2321 703 consensus WD40 repeat protein [General function pr 99.53
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.52
PRK05137435 tolB translocation protein TolB; Provisional 99.52
KOG2315 566 consensus Predicted translation initiation factor 99.51
PRK03629429 tolB translocation protein TolB; Provisional 99.49
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.48
PRK04922433 tolB translocation protein TolB; Provisional 99.48
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.48
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.48
KOG1310 758 consensus WD40 repeat protein [General function pr 99.47
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.47
PRK03629429 tolB translocation protein TolB; Provisional 99.47
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 99.46
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.46
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.45
PRK02889427 tolB translocation protein TolB; Provisional 99.45
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.44
PRK05137435 tolB translocation protein TolB; Provisional 99.43
PRK04922433 tolB translocation protein TolB; Provisional 99.42
PRK02889427 tolB translocation protein TolB; Provisional 99.41
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.39
KOG2314698 consensus Translation initiation factor 3, subunit 99.38
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.36
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.36
KOG2315566 consensus Predicted translation initiation factor 99.36
PRK00178430 tolB translocation protein TolB; Provisional 99.29
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.29
KOG1409404 consensus Uncharacterized conserved protein, conta 99.25
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.25
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.24
PRK04792448 tolB translocation protein TolB; Provisional 99.24
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.24
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.24
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.23
PRK01029428 tolB translocation protein TolB; Provisional 99.23
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.23
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.21
PRK04792448 tolB translocation protein TolB; Provisional 99.21
PRK00178430 tolB translocation protein TolB; Provisional 99.2
COG4946668 Uncharacterized protein related to the periplasmic 99.2
PRK01029428 tolB translocation protein TolB; Provisional 99.19
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.19
KOG4547 541 consensus WD40 repeat-containing protein [General 99.19
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.18
KOG4547 541 consensus WD40 repeat-containing protein [General 99.18
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.18
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.13
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.1
COG4946 668 Uncharacterized protein related to the periplasmic 99.09
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.08
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.06
KOG41901034 consensus Uncharacterized conserved protein [Funct 99.04
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.03
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.03
KOG1912 1062 consensus WD40 repeat protein [General function pr 99.0
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 99.0
KOG4532344 consensus WD40-like repeat containing protein [Gen 99.0
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.0
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.99
KOG2314698 consensus Translation initiation factor 3, subunit 98.97
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.96
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.93
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.93
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.91
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.91
PRK04043419 tolB translocation protein TolB; Provisional 98.91
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.9
KOG1409404 consensus Uncharacterized conserved protein, conta 98.89
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.87
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.86
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.84
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.83
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.81
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.8
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.77
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.76
PRK04043419 tolB translocation protein TolB; Provisional 98.76
KOG2695425 consensus WD40 repeat protein [General function pr 98.76
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.74
KOG3914 390 consensus WD repeat protein WDR4 [Function unknown 98.69
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.64
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.64
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.59
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.58
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.57
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.53
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.52
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.52
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.52
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.49
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.47
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.44
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.43
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.42
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.42
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 98.41
KOG2695425 consensus WD40 repeat protein [General function pr 98.4
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.39
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.36
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.35
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.34
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.28
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 98.27
PRK02888 635 nitrous-oxide reductase; Validated 98.24
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.2
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.18
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 98.15
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.11
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.1
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.09
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 98.09
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.06
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.05
KOG3621 726 consensus WD40 repeat-containing protein [General 98.02
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.02
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.93
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.93
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.92
PF0851327 LisH: LisH; InterPro: IPR013720 The LisH motif is 97.92
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 97.9
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.89
PRK02888 635 nitrous-oxide reductase; Validated 97.88
KOG1008 783 consensus Uncharacterized conserved protein, conta 97.87
KOG1008 783 consensus Uncharacterized conserved protein, conta 97.87
smart0066858 CTLH C-terminal to LisH motif. Alpha-helical motif 97.82
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 97.81
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.79
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.79
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.77
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.76
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.76
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.73
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.71
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.67
smart0066734 LisH Lissencephaly type-1-like homology motif. Alp 97.67
KOG2659228 consensus LisH motif-containing protein [Cytoskele 97.64
KOG3621 726 consensus WD40 repeat-containing protein [General 97.62
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.59
COG3391381 Uncharacterized conserved protein [Function unknow 97.57
PRK13616591 lipoprotein LpqB; Provisional 97.56
PF10607145 CLTH: CTLH/CRA C-terminal to LisH motif domain; In 97.56
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.52
COG3391381 Uncharacterized conserved protein [Function unknow 97.51
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.49
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.45
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 97.43
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.41
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.4
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.31
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.3
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.29
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.27
smart0066858 CTLH C-terminal to LisH motif. Alpha-helical motif 97.21
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.15
KOG2395644 consensus Protein involved in vacuole import and d 97.07
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.04
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.99
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.99
KOG2395644 consensus Protein involved in vacuole import and d 96.99
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.9
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 96.82
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 96.78
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 96.77
PRK13616591 lipoprotein LpqB; Provisional 96.7
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.69
PHA02713557 hypothetical protein; Provisional 96.63
COG3490366 Uncharacterized protein conserved in bacteria [Fun 96.61
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.59
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 96.58
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.54
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 96.53
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 96.41
KOG2659228 consensus LisH motif-containing protein [Cytoskele 96.41
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 96.31
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.28
PHA02713557 hypothetical protein; Provisional 96.26
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.22
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 96.01
KOG2444238 consensus WD40 repeat protein [General function pr 95.97
KOG2444238 consensus WD40 repeat protein [General function pr 95.97
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 95.96
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 95.88
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 95.88
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 95.86
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.86
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 95.85
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.81
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 95.69
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 95.62
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 95.62
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 95.44
COG1520370 FOG: WD40-like repeat [Function unknown] 95.25
PRK13684334 Ycf48-like protein; Provisional 95.22
PF14727418 PHTB1_N: PTHB1 N-terminus 95.12
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 94.94
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 94.9
PRK10115 686 protease 2; Provisional 94.79
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 94.77
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 94.74
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 94.73
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 94.72
KOG2377 657 consensus Uncharacterized conserved protein [Funct 94.65
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 94.6
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 94.48
PHA03098534 kelch-like protein; Provisional 94.45
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 94.13
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 94.09
PHA03098534 kelch-like protein; Provisional 93.64
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 93.61
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 93.14
KOG4460 741 consensus Nuclear pore complex, Nup88/rNup84 compo 93.09
PRK10115 686 protease 2; Provisional 92.87
PHA02790480 Kelch-like protein; Provisional 92.86
KOG0396389 consensus Uncharacterized conserved protein [Funct 92.64
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 92.58
COG5167776 VID27 Protein involved in vacuole import and degra 92.31
PF13449326 Phytase-like: Esterase-like activity of phytase 92.26
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 92.22
PLN00033398 photosystem II stability/assembly factor; Provisio 92.05
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 92.02
COG3823262 Glutamine cyclotransferase [Posttranslational modi 92.02
PHA02790480 Kelch-like protein; Provisional 91.9
PF05935 477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 91.83
KOG3616 1636 consensus Selective LIM binding factor [Transcript 91.26
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 91.17
COG1520370 FOG: WD40-like repeat [Function unknown] 91.11
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 90.72
PF06588199 Muskelin_N: Muskelin N-terminus; InterPro: IPR0105 90.71
KOG2247 615 consensus WD40 repeat-containing protein [General 90.32
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 90.21
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 89.99
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 89.65
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 89.04
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 89.04
PRK13684334 Ycf48-like protein; Provisional 88.91
KOG2247 615 consensus WD40 repeat-containing protein [General 88.89
KOG4460 741 consensus Nuclear pore complex, Nup88/rNup84 compo 88.89
PLN00033398 photosystem II stability/assembly factor; Provisio 88.85
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 88.84
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 88.79
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 88.24
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 88.02
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 87.65
COG3823262 Glutamine cyclotransferase [Posttranslational modi 87.62
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 87.45
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 87.15
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 87.1
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 86.32
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 86.06
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 85.93
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 85.08
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 84.52
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 84.52
COG5276370 Uncharacterized conserved protein [Function unknow 83.81
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 83.57
PF13449326 Phytase-like: Esterase-like activity of phytase 83.52
COG4590 733 ABC-type uncharacterized transport system, permeas 83.4
COG5167776 VID27 Protein involved in vacuole import and degra 83.16
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 83.04
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 82.56
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 82.54
KOG18961366 consensus mRNA cleavage and polyadenylation factor 82.37
smart00036302 CNH Domain found in NIK1-like kinases, mouse citro 81.76
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 81.73
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 80.24
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 80.08
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=7.5e-59  Score=454.35  Aligned_cols=458  Identities=16%  Similarity=0.235  Sum_probs=373.8

Q ss_pred             hhhHHHHHHHHHHhhhhhhHHHHHHHHhhcccccc---HHHHHHHhhcCChHHHHHHHhhhcccCCCcchHHHHHHHHHH
Q 004681          140 ETKEELIYLIHQFLNEEEFKETLHKLEQETRVFFD---INYFREYITSGEWDNAEKYLSAFTNMNDNTYSAKMFSQIQRQ  216 (737)
Q Consensus       140 ~~~~evirlI~q~L~e~G~~~s~~~L~~Es~i~~~---~~~~~~~i~~G~w~~~~~~l~~~~~~~~~~~~~~~~~~l~~q  216 (737)
                      -.+.|++|+++|+|.++||.+|+..||.|+|+...   ...|.++|+.|+|+.++..+..+...++.......|+ +.+|
T Consensus        15 ikk~efi~il~q~l~slgy~~S~~~lE~es~ll~~tat~klf~q~vlqg~w~q~v~~~~~i~~~de~~~~ea~fL-v~kQ   93 (519)
T KOG0293|consen   15 IKKGEFIRILWQILYSLGYDHSSPLLEWESGLLIPTATTKLFDQQVLQGQWDQQVMSLVRISFEDERNRKEAMFL-VNKQ   93 (519)
T ss_pred             eccchhhHhHHHHHHhcCccccchhhHHhhCcccccchHHHHHHHHHcccHHHHHHHHhhccCcchhhhHHHHHH-HHHH
Confidence            46789999999999999999999999999999883   8999999999999999999999877777788889999 9999


Q ss_pred             HHHHHHhhc-----------ccCcchHH-HhhhHHHHHHHh---------------hccCcccccccCC---CCC--ChH
Q 004681          217 KYLEAVDRQ-----------QKLPSDFA-ERAHLFDDFKVL---------------VERNPMLQDKLKF---PSM--DKS  264 (737)
Q Consensus       217 ~~lEll~~~-----------~~~p~~~~-~~~~~l~~~~~~---------------~~~~~~l~~~l~~---~~~--~~~  264 (737)
                      +|||++..+           +..+++.. ++.|.|.+....               ...|..|+++++.   |.+  |+.
T Consensus        94 ~fLEf~k~~~is~al~~l~~~~~~lr~~~kk~~el~~sll~sn~~~~ne~~~~~~~~n~R~~ll~elskyi~p~illP~r  173 (519)
T KOG0293|consen   94 IFLEFLKTGSISHALPVLRNPVLYLRKNKKKFHELASSLLVSNDQFSNEENTTAQLNNERDKLLDELSKYIPPNILLPKR  173 (519)
T ss_pred             HHHHHHhhccHhhhhHhhhcchhhhhhhHHHHHHHHHHHhccccccccccchhhhhchhHHHHHHHHHhhCCHhhcCChH
Confidence            999999874           23345555 676777765533               2235556666644   433  999


Q ss_pred             HHHHHHHHhhccccceeccccCCCCCccccccCCccccccccccccccCCCCCCCcceeeccCCCCCcceeeeCCCCccc
Q 004681          265 RLLSLIKQIMDWWVPYCINVMPNANNETISLKDFPTVSNLRYASSILTDKPNQEGRPLDASSGDDSNDSSCFNDNNQSRE  344 (737)
Q Consensus       265 rL~~ll~qa~~~q~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~gh~~~~s~l~~~~~~~~~  344 (737)
                      ||++|++||+.+|+..|.  +||..+. ++                                        ++.++.|...
T Consensus       174 RLehLl~qAv~~Q~d~cv--yhnslds-vs----------------------------------------ll~Dh~c~~~  210 (519)
T KOG0293|consen  174 RLEHLLEQAVKYQRDSCV--YHNSLDS-VS----------------------------------------LLSDHFCGRL  210 (519)
T ss_pred             HHHHHHHHHHHHHHhHhH--Hhcccch-hh----------------------------------------hhhhcccCcc
Confidence            999999999999998887  8875221 11                                        4445544443


Q ss_pred             cccCCCCCEEEEEecCCeEEEeecCccCCCCceeeeecCCCCCCCCeEEEEEecCCCEEEEEECCCcEEEeeccCCcccc
Q 004681          345 STSLPDADSAVCAKSLEKSVNLKLQLINEPSECRTLLLPDNSFGGRVVRLIYSHSGDFLVALTQTATHKLWKWQSNKQSL  424 (737)
Q Consensus       345 ~~~spdg~~la~~s~dg~v~iW~~~~~~~~~~~~~~~l~~~~h~~~V~~v~fspdg~~L~s~s~dg~i~iWd~~~~~~~~  424 (737)
                        ..|                         ....++ +..  |+++||.+.||++|+||||+|.|.+..||.+..     
T Consensus       211 --qip-------------------------~qt~qi-l~~--htdEVWfl~FS~nGkyLAsaSkD~Taiiw~v~~-----  255 (519)
T KOG0293|consen  211 --QIP-------------------------SQTWQI-LQD--HTDEVWFLQFSHNGKYLASASKDSTAIIWIVVY-----  255 (519)
T ss_pred             --cCC-------------------------chhhhh-Hhh--CCCcEEEEEEcCCCeeEeeccCCceEEEEEEec-----
Confidence              222                         111122 445  999999999999999999999999999998652     


Q ss_pred             cccceeeeeEEeecCCCeeeeeccCCCCCCCeEEEEEe--CCEEEEEe-CCeEEEEECCCCcEEEEec-CCCCCeEEEEE
Q 004681          425 EEENVNMESQLYQPSSKLVMTNDIAADPKDSISCFALR--GSHLFSAS-GGKISIFSLETFQTLATFA-NPPPIATYFIL  500 (737)
Q Consensus       425 g~~~~~~~~~l~~~~~~~~~~~~~~~~h~~~V~~v~~s--~~~l~s~s-dg~i~vwd~~~~~~~~~~~-~~~~~v~~~~~  500 (737)
                                  |.. -++.+++.  +|..+|..+.||  ++++++|+ +..+.+||+.+|.....+. ++...+.+++|
T Consensus       256 ------------d~~-~kl~~tlv--gh~~~V~yi~wSPDdryLlaCg~~e~~~lwDv~tgd~~~~y~~~~~~S~~sc~W  320 (519)
T KOG0293|consen  256 ------------DVH-FKLKKTLV--GHSQPVSYIMWSPDDRYLLACGFDEVLSLWDVDTGDLRHLYPSGLGFSVSSCAW  320 (519)
T ss_pred             ------------Ccc-eeeeeeee--cccCceEEEEECCCCCeEEecCchHheeeccCCcchhhhhcccCcCCCcceeEE
Confidence                        222 22333333  799999999999  88999999 8999999999999988886 55678999999


Q ss_pred             cCCC-eEEEEECCCeEEEEecCCCcEEEEEcCC-CcceEEEEEeCCCCEEEEEeCCCcEEEEeCCCCceeeceeeeeccc
Q 004681          501 LPQD-LFAFGFDDSSILVHCPCTKKTKAKLKGH-QNRITCLAYSLSLNVLVSSGADAQLCVWDAVGWKKLCSKFLHSFQT  578 (737)
Q Consensus       501 s~~~-~l~sgs~dg~I~vwd~~~~~~~~~l~~~-~~~v~~l~~sp~g~~l~s~s~dg~I~lwdl~~~~~~~~~~~~~~~~  578 (737)
                      .||| .+++|+.|+++..||++ |.....+++- .-.|.+++.++||+++++.+.|..|++++..+...     .. +..
T Consensus       321 ~pDg~~~V~Gs~dr~i~~wdlD-gn~~~~W~gvr~~~v~dlait~Dgk~vl~v~~d~~i~l~~~e~~~d-----r~-lis  393 (519)
T KOG0293|consen  321 CPDGFRFVTGSPDRTIIMWDLD-GNILGNWEGVRDPKVHDLAITYDGKYVLLVTVDKKIRLYNREARVD-----RG-LIS  393 (519)
T ss_pred             ccCCceeEecCCCCcEEEecCC-cchhhcccccccceeEEEEEcCCCcEEEEEecccceeeechhhhhh-----hc-ccc
Confidence            9999 99999999999999987 4556666653 34689999999999999999999999999987321     11 222


Q ss_pred             CCCCCCCCeEEEEEecCCCEEEEE-ecCcEEEEeCCCCceeEEecCCCCCCCeEEEEEcc-CCCEEEEEecCCeEEEEEc
Q 004681          579 GLVPETTIVNHIQFHPDQIHLLSI-HEGQIDVYEAPTLNHTSQLVPDKMDLPITYATYSC-DGKCIYVSCKSGHVKVFDT  656 (737)
Q Consensus       579 ~~~~~~~~v~~l~~sp~g~~l~~~-~dg~I~iwd~~~~~~~~~~~~~~h~~~v~~~~~sp-~~~~l~sgs~dg~I~vwd~  656 (737)
                      .+    .+|++.++|.+|+++++. .+..|++||++....++.+.++.....+..-||.- +..++++||+|+.||||+.
T Consensus       394 e~----~~its~~iS~d~k~~LvnL~~qei~LWDl~e~~lv~kY~Ghkq~~fiIrSCFgg~~~~fiaSGSED~kvyIWhr  469 (519)
T KOG0293|consen  394 EE----QPITSFSISKDGKLALVNLQDQEIHLWDLEENKLVRKYFGHKQGHFIIRSCFGGGNDKFIASGSEDSKVYIWHR  469 (519)
T ss_pred             cc----CceeEEEEcCCCcEEEEEcccCeeEEeecchhhHHHHhhcccccceEEEeccCCCCcceEEecCCCceEEEEEc
Confidence            22    589999999999999996 89999999999989999998877778888899975 6689999999999999999


Q ss_pred             CCCeeEEEEecccccCCCCccCceeeEEEEEccCCCCEEEEEECCCcEEEEecCCC
Q 004681          657 STLELRCQINLTAYAQPGTISLELYPLVIAAHPLEPNRIALGLTNGRVHVIEPLES  712 (737)
Q Consensus       657 ~~~~~~~~~~~~~~~~~g~~~~~v~~~~v~~sp~d~~~las~s~Dg~V~iWd~~~~  712 (737)
                      .+|+++..+.+|        ...++  +|+|+|.+..++|+||+||+||||.+...
T Consensus       470 ~sgkll~~LsGH--------s~~vN--cVswNP~~p~m~ASasDDgtIRIWg~~~~  515 (519)
T KOG0293|consen  470 ISGKLLAVLSGH--------SKTVN--CVSWNPADPEMFASASDDGTIRIWGPSDN  515 (519)
T ss_pred             cCCceeEeecCC--------cceee--EEecCCCCHHHhhccCCCCeEEEecCCcc
Confidence            999999999754        44455  99999999999999999999999988643

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08513 LisH: LisH; InterPro: IPR013720 The LisH motif is found in a large number of eukaryotic proteins, from metazoa, fungi and plants that have a wide range of functions Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>smart00668 CTLH C-terminal to LisH motif Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00667 LisH Lissencephaly type-1-like homology motif Back     alignment and domain information
>KOG2659 consensus LisH motif-containing protein [Cytoskeleton] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF10607 CLTH: CTLH/CRA C-terminal to LisH motif domain; InterPro: IPR019589 This entry represents the CRA (or CT11-RanBPM) domain, which is a protein-protein interaction domain present in crown eukaryotes (plants, animals, fungi) and which is found in Ran-binding proteins such as Ran-binding protein 9 (RanBP9 or RanBPM) and RanBP10 Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>smart00668 CTLH C-terminal to LisH motif Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG2659 consensus LisH motif-containing protein [Cytoskeleton] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG0396 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>PF06588 Muskelin_N: Muskelin N-terminus; InterPro: IPR010565 This entry represents the N-terminal region of muskelin and is found in conjunction with several IPR006652 from INTERPRO repeats Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1896 consensus mRNA cleavage and polyadenylation factor II complex, subunit CFT1 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 737
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-12
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 8e-09
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-07
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-04
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 9e-12
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-10
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-07
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-09
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-05
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-04
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-08
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-06
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 8e-05
d1erja_ 388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.003
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 5e-06
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.001
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.003
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 7e-06
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-05
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-05
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-04
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 0.002
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 5e-05
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 5e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-04
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.001
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.001
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-04
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 0.002
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 0.003
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 0.004
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 66.7 bits (161), Expect = 2e-12
 Identities = 24/164 (14%), Positives = 59/164 (35%), Gaps = 10/164 (6%)

Query: 493 PIATYFILLPQDLFAFGFDDSSILVHCPCTKKTKAKLKGHQNRITCLAYSLSLNVLVSSG 552
            + +  +     LF  G  D+S  +        +    GH++ I  + +  + N   +  
Sbjct: 186 DVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGS 245

Query: 553 ADAQLCVWDAVGWKKLCSKFLHSFQTGLVPETTIVNHIQFHPDQIHLLSIHE-GQIDVYE 611
            DA   ++D    ++L +    +   G       +  + F      LL+ ++    +V++
Sbjct: 246 DDATCRLFDLRADQELMTYSHDNIICG-------ITSVSFSKSGRLLLAGYDDFNCNVWD 298

Query: 612 APTLNHTSQLVPDKMDLPITYATYSCDGKCIYVSCKSGHVKVFD 655
           A   +    L     D  ++    + DG  +        +K+++
Sbjct: 299 ALKADRAGVL--AGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN 340
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query737
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.98
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.97
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.96
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.96
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.96
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.96
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.95
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.93
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.92
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.92
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.91
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.89
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.88
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.88
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.88
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.87
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.87
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.85
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.84
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.83
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.81
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.78
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.77
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.73
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.63
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.62
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.48
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.35
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.33
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.32
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.23
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.18
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.18
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.09
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.02
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.01
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.99
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.95
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.93
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.8
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.79
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.7
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.49
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.49
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.43
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.36
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.04
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.04
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.77
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.71
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.7
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.64
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.23
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.14
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 96.96
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.87
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 96.84
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.62
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 96.24
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 95.94
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 95.63
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 95.51
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 95.05
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 94.88
d1uuja_76 Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-te 93.65
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 91.77
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 91.73
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 91.51
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 91.4
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 90.9
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 86.01
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.5e-36  Score=278.94  Aligned_cols=280  Identities=15%  Similarity=0.182  Sum_probs=237.2

Q ss_pred             CCCCEEEEEEECCCCEEEEEECCCCEEEEECCCCCCCCCCCCEEEEEEEEECCCCEEEEECCCCCCCCCEEEEEEE--CC
Q ss_conf             9997389999259999999978990999541688655544310112488516988066301378999986999980--99
Q 004681          387 FGGRVVRLIYSHSGDFLVALTQTATHKLWKWQSNKQSLEEENVNMESQLYQPSSKLVMTNDIAADPKDSISCFALR--GS  464 (737)
Q Consensus       387 h~~~V~~v~fspdg~~L~s~s~dg~i~iWd~~~~~~~~g~~~~~~~~~i~~~~~~~~~~~~~~~~h~~~V~~i~~s--~~  464 (737)
                      |...|.+++|+|+|++|++|+ ||+|+|||+.......                  ........+|.+.|.+++|+  ++
T Consensus        50 H~~~V~~v~fs~~g~~latg~-dg~V~iWd~~~~~~~~------------------~~~~~~~~~h~~~I~~v~~s~dg~  110 (337)
T d1gxra_          50 HGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKS------------------PVSQLDCLNRDNYIRSCKLLPDGC  110 (337)
T ss_dssp             CSSCCCEEEECSSSSEEEEEC-BSEEEEEETTSTTCCS------------------CSEEEECSCTTSBEEEEEECTTSS
T ss_pred             CCCCEEEEEECCCCCEEEEEE-CCEEEEEECCCCCCCC------------------EEEEEEECCCCCCEEEEEECCCCC
T ss_conf             999289999989999999997-9988997736776331------------------168764048899689999867998


Q ss_pred             EEEEEE-CCEEEEEECCC--CCEEEEECCCCCCEEEEEECCCC-EEEEEECCCEEEEEECCCCCEEEEECCCCCCEEEEE
Q ss_conf             999984-89099998799--71789961899986899995999-599998899099995699927999737786568999
Q 004681          465 HLFSAS-GGKISIFSLET--FQTLATFANPPPIATYFILLPQD-LFAFGFDDSSILVHCPCTKKTKAKLKGHQNRITCLA  540 (737)
Q Consensus       465 ~l~s~~-dg~i~iwd~~~--~~~~~~~~~~~~~v~~i~~s~~~-~l~sgs~dg~I~iwd~~~~~~~~~l~~~~~~v~~i~  540 (737)
                      +|++++ ||.|++||+..  +.....+..|...+.++.|+|++ .+++++.|+.|.+|++.++++.....+|...+.+++
T Consensus       111 ~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~~~~~~~~~~~~v~~l~  190 (337)
T d1gxra_         111 TLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCID  190 (337)
T ss_dssp             EEEEEESSSEEEEEECCCC--EEEEEEECSSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEECCCSSCEEEEE
T ss_pred             EEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             89886123321111111111111111111111111111111111111111111111111111111111111111111012


Q ss_pred             EECCCCEEEEEECCCCEEEEECCCCCEEECEEEEECCCCCCCCCCCEEEEEEECCCCEEEE-EECCCEEEEECCCCCEEE
Q ss_conf             9089999999958994999957998024102101001488778877389999069979999-916819999689994457
Q 004681          541 YSLSLNVLVSSGADAQLCVWDAVGWKKLCSKFLHSFQTGLVPETTIVNHIQFHPDQIHLLS-IHEGQIDVYEAPTLNHTS  619 (737)
Q Consensus       541 ~sp~~~~l~s~s~dg~I~iwdl~~~~~~~~~~~~~~~~~~~~~~~~v~~i~~sp~g~~l~~-~~dg~I~iwd~~~~~~~~  619 (737)
                      |++++..+++++.|+.+++||++++.     .+...  .+.   ..|.+++|+|++..+++ +.++.+++||++++....
T Consensus       191 ~s~~~~~~~~~~~d~~v~i~d~~~~~-----~~~~~--~~~---~~i~~l~~~~~~~~l~~~~~d~~i~i~d~~~~~~~~  260 (337)
T d1gxra_         191 ISNDGTKLWTGGLDNTVRSWDLREGR-----QLQQH--DFT---SQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQ  260 (337)
T ss_dssp             ECTTSSEEEEEETTSEEEEEETTTTE-----EEEEE--ECS---SCEEEEEECTTSSEEEEEETTSCEEEEETTSSCEEE
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCE-----EECCC--CCC---CCEEEEEECCCCCCCCEECCCCCCCCCCCCCCCCCC
T ss_conf             34443211223566553211111100-----00024--666---615799971530300000025642111111111000


Q ss_pred             EECCCCCCCCEEEEEECCCCCEEEEEECCCEEEEEECCCCEEEEEEECCCCCCCCCCCCCEEEEEEEECCCCCCEEEEEE
Q ss_conf             84289999895899990599899999469909999859980678971121147887557510189999259998999997
Q 004681          620 QLVPDKMDLPITYATYSCDGKCIYVSCKSGHVKVFDTSTLELRCQINLTAYAQPGTISLELYPLVIAAHPLEPNRIALGL  699 (737)
Q Consensus       620 ~~~~~~h~~~i~~i~~spdg~~l~sgs~dg~I~iwd~~~~~~~~~~~~~~~~~~g~~~~~v~~~~v~~sp~d~~~las~s  699 (737)
                      ..   .|...|++++|+|+++++++++.||.|++|+..+++.+..+..         ...+.  +++|+| ++++|++|+
T Consensus       261 ~~---~~~~~i~~v~~s~~g~~l~s~s~Dg~i~iwd~~~~~~~~~~~~---------~~~v~--~~~~s~-d~~~l~t~s  325 (337)
T d1gxra_         261 LH---LHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKE---------SSSVL--SCDISV-DDKYIVTGS  325 (337)
T ss_dssp             EC---CCSSCEEEEEECTTSSEEEEEETTSEEEEEETTTCCEEEEEEC---------SSCEE--EEEECT-TSCEEEEEE
T ss_pred             CC---CCCCCCCEEEECCCCCEEEEEECCCEEEEEECCCCCEEEECCC---------CCCEE--EEEEEC-CCCEEEEEE
T ss_conf             01---2456541699989999999994899699998999979999269---------99879--999927-999999990


Q ss_pred             CCCCEEEEECC
Q ss_conf             99929999458
Q 004681          700 TNGRVHVIEPL  710 (737)
Q Consensus       700 ~Dg~V~iWd~~  710 (737)
                      .||.|+||++.
T Consensus       326 ~D~~I~vWdl~  336 (337)
T d1gxra_         326 GDKKATVYEVI  336 (337)
T ss_dssp             TTSCEEEEEEE
T ss_pred             CCCEEEEEEEE
T ss_conf             89969999778
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1uuja_ a.221.1.1 (A:) Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure